Metagenome Family F031379

Overview

Basic Information

• Family ID: F031379
• Family Type: Metagenome
• Number of Sequences: 182
• Average Sequence Length: 44 residues
• Representative Sequence: INWRDTVNKDLQRMGLTWEEVEASAQDRQTWRQRVALCIGDAG
• Number of Associated Samples: 18
• Number of Associated Scaffolds: 182

Quality Assessment

• Transcriptomic Evidence: No
• Most common taxonomic group: Unclassified
• % of genes with valid RBS motifs: 0.00 %
• % of genes near scaffold ends (potentially truncated): 92.31 %
• % of genes from short scaffolds (< 2000 bps): 65.38 %
• Associated GOLD sequencing projects: 13
• AlphaFold2 3D model prediction: No

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.

Most Common Taxonomy

• Group: Unclassified (71.429 % of family members)
• NCBI Taxonomy ID: N/A
• Taxonomy: N/A

Most Common Ecosystem

• GOLD Ecosystem: Host-Associated → Annelida → Digestive System → Digestive Tube → Extracellular Symbionts → Marine Gutless Worms Symbiont (62.637 % of family members)
• Environment Ontology (ENVO): Unclassified (100.000 % of family members)
• Earth Microbiome Project Ontology (EMPO): Host-associated → Animal → Animal proximal gut (100.000 % of family members)

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure

• Classification: Globular
• Signal Peptide: No
• Secondary Structure distribution:
  α-helix: 72.09%
  β-sheet: 0.00%
  Coil/Unstructured: 27.91%

Gene Neighborhood

Neighboring Pfam domains

Pfam ID	Name	% Frequency in 182 Family Scaffolds
PF01391	Collagen	1.65
PF05470	eIF-3c_N	1.10
PF04799	Fzo_mitofusin	0.55
PF00209	SNF	0.55
PF03224	V-ATPase_H_N	0.55
PF03133	TTL	0.55
PF13894	zf-C2H2_4	0.55
PF00665	rve	0.55
PF07714	PK_Tyr_Ser-Thr	0.55
PF02140	Gal_Lectin	0.55
PF13912	zf-C2H2_6	0.55
PF00078	RVT_1	0.55
PF12661	hEGF	0.55
PF00282	Pyridoxal_deC	0.55
PF09004	ALKBH8_N	0.55
PF13843	DDE_Tnp_1_7	0.55

Neighboring Clusters of Orthologous Genes (COGs)

COG ID	Name	Functional Category	% Frequency in 182 Family Scaffolds
COG0515	Serine/threonine protein kinase	Signal transduction mechanisms [T]	2.20
COG0076	Glutamate or tyrosine decarboxylase or a related PLP-dependent protein	Amino acid transport and metabolism [E]	0.55
COG0733	Na+-dependent transporter, SNF family	General function prediction only [R]	0.55
COG2801	Transposase InsO and inactivated derivatives	Mobilome: prophages, transposons [X]	0.55
COG2826	Transposase and inactivated derivatives, IS30 family	Mobilome: prophages, transposons [X]	0.55
COG3316	Transposase (or an inactivated derivative), DDE domain	Mobilome: prophages, transposons [X]	0.55
COG4584	Transposase	Mobilome: prophages, transposons [X]	0.55

Phylogeny

NCBI Taxonomy

Level 1

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	71.43 %
All Organisms	root	All Organisms	28.57 %

Level 2

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	71.43 %
cellular organisms	root	All Organisms → cellular organisms	28.02 %
Viruses	superkingdom	All Organisms → Viruses	0.55 %

Level 3

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	71.43 %
Eukaryota	superkingdom	All Organisms → cellular organisms → Eukaryota	26.92 %
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	1.10 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.55 %

Level 4

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	71.43 %
Opisthokonta	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta	26.37 %
FCB group	clade	All Organisms → cellular organisms → Bacteria → FCB group	1.10 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.55 %

Level 5

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	71.43 %
Metazoa	kingdom	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa	9.34 %
Bacteroidetes/Chlorobi group	clade	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group	1.10 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.55 %

Level 6

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	71.43 %
Eumetazoa	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa	9.34 %
Bacteroidetes	phylum	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes	1.10 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.55 %

Level 7

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	71.43 %
Bilateria	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria	8.79 %
Cytophagia	class	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia	1.10 %
Cnidaria	phylum	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Cnidaria	0.55 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.55 %

Level 8

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	71.43 %
Protostomia	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia	8.24 %
Cytophagales	order	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales	1.10 %
Anthozoa	class	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Cnidaria → Anthozoa	0.55 %
Deuterostomia	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia	0.55 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.55 %

Level 9

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	71.43 %
Ecdysozoa	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa	4.40 %
Spiralia	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia	3.85 %
Cytophagaceae	family	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae	1.10 %
Chordata	phylum	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata	0.55 %
Anthozoa	class	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Cnidaria → Anthozoa	0.55 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.55 %

Level 10

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	71.43 %
Panarthropoda	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda	4.40 %
Lophotrochozoa	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa	3.85 %
Candidatus Nephrothrix	genus	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix	1.10 %
Cephalochordata	subphylum	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Cephalochordata	0.55 %
Anthozoa	class	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Cnidaria → Anthozoa	0.55 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.55 %

Level 11

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	71.43 %
Arthropoda	phylum	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda	4.40 %
Mollusca	phylum	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Mollusca	2.20 %
Annelida	phylum	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida	1.65 %
unclassified Candidatus Nephrothrix	no rank	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix	1.10 %
Leptocardii	class	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Cephalochordata → Leptocardii	0.55 %
Anthozoa	class	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Cnidaria → Anthozoa	0.55 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.55 %

Level 12

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	71.43 %
Mandibulata	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata	3.85 %
Polychaeta	class	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida → Polychaeta	1.65 %
Bivalvia	class	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Mollusca → Bivalvia	1.10 %
Candidatus Nephrothrix sp. EaCA	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	1.10 %
Amphioxiformes	order	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Cephalochordata → Leptocardii → Amphioxiformes	0.55 %
Gastropoda	class	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Mollusca → Gastropoda	0.55 %
Anthozoa	class	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Cnidaria → Anthozoa	0.55 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.55 %

Level 13

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	71.43 %
Pancrustacea	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea	3.85 %
Sedentaria	subclass	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida → Polychaeta → Sedentaria	1.65 %
Autobranchia	subclass	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Mollusca → Bivalvia → Autobranchia	1.10 %
Candidatus Nephrothrix sp. EaCA	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	1.10 %
Heterobranchia	subclass	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Mollusca → Gastropoda → Heterobranchia	0.55 %
Branchiostomidae	family	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Cephalochordata → Leptocardii → Amphioxiformes → Branchiostomidae	0.55 %
Anthozoa	class	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Cnidaria → Anthozoa	0.55 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.55 %

Level 14

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	71.43 %
Hexapoda	subphylum	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda	3.30 %
Scolecida	infraclass	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida → Polychaeta → Sedentaria → Scolecida	1.65 %
Pteriomorphia	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Mollusca → Bivalvia → Autobranchia → Pteriomorphia	1.10 %
Candidatus Nephrothrix sp. EaCA	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	1.10 %
Euthyneura	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Mollusca → Gastropoda → Heterobranchia → Euthyneura	0.55 %
Crustacea	subphylum	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea	0.55 %
Branchiostoma	genus	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Cephalochordata → Leptocardii → Amphioxiformes → Branchiostomidae → Branchiostoma	0.55 %
Anthozoa	class	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Cnidaria → Anthozoa	0.55 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.55 %

Level 15

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	71.43 %
Insecta	class	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta	3.30 %
Capitellidae	family	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida → Polychaeta → Sedentaria → Scolecida → Capitellidae	1.65 %
Mytiloida	order	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Mollusca → Bivalvia → Autobranchia → Pteriomorphia → Mytiloida	1.10 %
Candidatus Nephrothrix sp. EaCA	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	1.10 %
Tectipleura	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Mollusca → Gastropoda → Heterobranchia → Euthyneura → Tectipleura	0.55 %
Multicrustacea	superclass	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea	0.55 %
Branchiostoma	genus	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Cephalochordata → Leptocardii → Amphioxiformes → Branchiostomidae → Branchiostoma	0.55 %
Anthozoa	class	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Cnidaria → Anthozoa	0.55 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.55 %

Level 16

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	71.43 %
Dicondylia	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia	3.30 %
Capitella	genus	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida → Polychaeta → Sedentaria → Scolecida → Capitellidae → Capitella	1.65 %
Mytiloidea	superfamily	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Mollusca → Bivalvia → Autobranchia → Pteriomorphia → Mytiloida → Mytiloidea	1.10 %
Candidatus Nephrothrix sp. EaCA	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	1.10 %
Aplysiida	order	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Mollusca → Gastropoda → Heterobranchia → Euthyneura → Tectipleura → Aplysiida	0.55 %
Malacostraca	class	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Malacostraca	0.55 %
Branchiostoma	genus	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Cephalochordata → Leptocardii → Amphioxiformes → Branchiostomidae → Branchiostoma	0.55 %
Anthozoa	class	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Cnidaria → Anthozoa	0.55 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.55 %

Level 17

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	71.43 %
Pterygota	subclass	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota	3.30 %
Capitella teleta	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida → Polychaeta → Sedentaria → Scolecida → Capitellidae → Capitella → Capitella teleta	1.65 %
Mytilidae	family	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Mollusca → Bivalvia → Autobranchia → Pteriomorphia → Mytiloida → Mytiloidea → Mytilidae	1.10 %
Candidatus Nephrothrix sp. EaCA	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	1.10 %
Aplysioidea	superfamily	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Mollusca → Gastropoda → Heterobranchia → Euthyneura → Tectipleura → Aplysiida → Aplysioidea	0.55 %
Eumalacostraca	subclass	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Malacostraca → Eumalacostraca	0.55 %
Branchiostoma	genus	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Cephalochordata → Leptocardii → Amphioxiformes → Branchiostomidae → Branchiostoma	0.55 %
Anthozoa	class	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Cnidaria → Anthozoa	0.55 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.55 %

Level 18

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	71.43 %
Neoptera	infraclass	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera	3.30 %
Capitella teleta	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida → Polychaeta → Sedentaria → Scolecida → Capitellidae → Capitella → Capitella teleta	1.65 %
Mytilinae	subfamily	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Mollusca → Bivalvia → Autobranchia → Pteriomorphia → Mytiloida → Mytiloidea → Mytilidae → Mytilinae	1.10 %
Candidatus Nephrothrix sp. EaCA	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	1.10 %
Aplysiidae	family	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Mollusca → Gastropoda → Heterobranchia → Euthyneura → Tectipleura → Aplysiida → Aplysioidea → Aplysiidae	0.55 %
Eucarida	superorder	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Malacostraca → Eumalacostraca → Eucarida	0.55 %
Branchiostoma	genus	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Cephalochordata → Leptocardii → Amphioxiformes → Branchiostomidae → Branchiostoma	0.55 %
Anthozoa	class	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Cnidaria → Anthozoa	0.55 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.55 %

Level 19

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	71.43 %
Endopterygota	cohort	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Endopterygota	1.65 %
Capitella teleta	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida → Polychaeta → Sedentaria → Scolecida → Capitellidae → Capitella → Capitella teleta	1.65 %
Mytilus	genus	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Mollusca → Bivalvia → Autobranchia → Pteriomorphia → Mytiloida → Mytiloidea → Mytilidae → Mytilinae → Mytilus	1.10 %
Candidatus Nephrothrix sp. EaCA	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	1.10 %
Aplysia	genus	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Mollusca → Gastropoda → Heterobranchia → Euthyneura → Tectipleura → Aplysiida → Aplysioidea → Aplysiidae → Aplysia	0.55 %
Decapoda	order	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Malacostraca → Eumalacostraca → Eucarida → Decapoda	0.55 %
Polyneoptera	cohort	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera	0.55 %
Branchiostoma	genus	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Cephalochordata → Leptocardii → Amphioxiformes → Branchiostomidae → Branchiostoma	0.55 %
Anthozoa	class	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Cnidaria → Anthozoa	0.55 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.55 %

Level 20

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	71.43 %
Amphiesmenoptera	superorder	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Endopterygota → Amphiesmenoptera	1.65 %
Capitella teleta	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida → Polychaeta → Sedentaria → Scolecida → Capitellidae → Capitella → Capitella teleta	1.65 %
Mytilus	genus	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Mollusca → Bivalvia → Autobranchia → Pteriomorphia → Mytiloida → Mytiloidea → Mytilidae → Mytilinae → Mytilus	1.10 %
Candidatus Nephrothrix sp. EaCA	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	1.10 %
Pleocyemata	suborder	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Malacostraca → Eumalacostraca → Eucarida → Decapoda → Pleocyemata	0.55 %
Aplysia californica	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Mollusca → Gastropoda → Heterobranchia → Euthyneura → Tectipleura → Aplysiida → Aplysioidea → Aplysiidae → Aplysia → Aplysia californica	0.55 %
Dictyoptera	superorder	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera	0.55 %
Branchiostoma	genus	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Cephalochordata → Leptocardii → Amphioxiformes → Branchiostomidae → Branchiostoma	0.55 %
Anthozoa	class	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Cnidaria → Anthozoa	0.55 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.55 %

Level 21

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	71.43 %
Lepidoptera	order	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Endopterygota → Amphiesmenoptera → Lepidoptera	1.65 %
Capitella teleta	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida → Polychaeta → Sedentaria → Scolecida → Capitellidae → Capitella → Capitella teleta	1.65 %
Mytilus	genus	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Mollusca → Bivalvia → Autobranchia → Pteriomorphia → Mytiloida → Mytiloidea → Mytilidae → Mytilinae → Mytilus	1.10 %
Candidatus Nephrothrix sp. EaCA	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	1.10 %
Blattodea	order	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea	0.55 %
Pleocyemata	suborder	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Malacostraca → Eumalacostraca → Eucarida → Decapoda → Pleocyemata	0.55 %
Aplysia californica	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Mollusca → Gastropoda → Heterobranchia → Euthyneura → Tectipleura → Aplysiida → Aplysioidea → Aplysiidae → Aplysia → Aplysia californica	0.55 %
Branchiostoma	genus	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Cephalochordata → Leptocardii → Amphioxiformes → Branchiostomidae → Branchiostoma	0.55 %
Anthozoa	class	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Cnidaria → Anthozoa	0.55 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.55 %

Level 22

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	71.43 %
Glossata	suborder	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Endopterygota → Amphiesmenoptera → Lepidoptera → Glossata	1.65 %
Capitella teleta	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida → Polychaeta → Sedentaria → Scolecida → Capitellidae → Capitella → Capitella teleta	1.65 %
Mytilus	genus	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Mollusca → Bivalvia → Autobranchia → Pteriomorphia → Mytiloida → Mytiloidea → Mytilidae → Mytilinae → Mytilus	1.10 %
Candidatus Nephrothrix sp. EaCA	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	1.10 %
Blattoidea	superfamily	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea → Blattoidea	0.55 %
Pleocyemata	suborder	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Malacostraca → Eumalacostraca → Eucarida → Decapoda → Pleocyemata	0.55 %
Aplysia californica	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Mollusca → Gastropoda → Heterobranchia → Euthyneura → Tectipleura → Aplysiida → Aplysioidea → Aplysiidae → Aplysia → Aplysia californica	0.55 %
Branchiostoma	genus	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Cephalochordata → Leptocardii → Amphioxiformes → Branchiostomidae → Branchiostoma	0.55 %
Anthozoa	class	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Cnidaria → Anthozoa	0.55 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.55 %

Level 23

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	71.43 %
Neolepidoptera	infraorder	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Endopterygota → Amphiesmenoptera → Lepidoptera → Glossata → Neolepidoptera	1.65 %
Capitella teleta	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida → Polychaeta → Sedentaria → Scolecida → Capitellidae → Capitella → Capitella teleta	1.65 %
Mytilus	genus	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Mollusca → Bivalvia → Autobranchia → Pteriomorphia → Mytiloida → Mytiloidea → Mytilidae → Mytilinae → Mytilus	1.10 %
Candidatus Nephrothrix sp. EaCA	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	1.10 %
Termitoidae	no rank	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea → Blattoidea → Termitoidae	0.55 %
Pleocyemata	suborder	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Malacostraca → Eumalacostraca → Eucarida → Decapoda → Pleocyemata	0.55 %
Aplysia californica	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Mollusca → Gastropoda → Heterobranchia → Euthyneura → Tectipleura → Aplysiida → Aplysioidea → Aplysiidae → Aplysia → Aplysia californica	0.55 %
Branchiostoma	genus	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Cephalochordata → Leptocardii → Amphioxiformes → Branchiostomidae → Branchiostoma	0.55 %
Anthozoa	class	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Cnidaria → Anthozoa	0.55 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.55 %

Level 24

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	71.43 %
Heteroneura	parvorder	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Endopterygota → Amphiesmenoptera → Lepidoptera → Glossata → Neolepidoptera → Heteroneura	1.65 %
Capitella teleta	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida → Polychaeta → Sedentaria → Scolecida → Capitellidae → Capitella → Capitella teleta	1.65 %
Mytilus	genus	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Mollusca → Bivalvia → Autobranchia → Pteriomorphia → Mytiloida → Mytiloidea → Mytilidae → Mytilinae → Mytilus	1.10 %
Candidatus Nephrothrix sp. EaCA	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	1.10 %
Rhinotermitidae	family	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea → Blattoidea → Termitoidae → Rhinotermitidae	0.55 %
Pleocyemata	suborder	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Malacostraca → Eumalacostraca → Eucarida → Decapoda → Pleocyemata	0.55 %
Aplysia californica	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Mollusca → Gastropoda → Heterobranchia → Euthyneura → Tectipleura → Aplysiida → Aplysioidea → Aplysiidae → Aplysia → Aplysia californica	0.55 %
Branchiostoma	genus	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Cephalochordata → Leptocardii → Amphioxiformes → Branchiostomidae → Branchiostoma	0.55 %
Anthozoa	class	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Cnidaria → Anthozoa	0.55 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.55 %

Level 25

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	71.43 %
Ditrysia	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Endopterygota → Amphiesmenoptera → Lepidoptera → Glossata → Neolepidoptera → Heteroneura → Ditrysia	1.65 %
Capitella teleta	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida → Polychaeta → Sedentaria → Scolecida → Capitellidae → Capitella → Capitella teleta	1.65 %
Mytilus	genus	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Mollusca → Bivalvia → Autobranchia → Pteriomorphia → Mytiloida → Mytiloidea → Mytilidae → Mytilinae → Mytilus	1.10 %
Candidatus Nephrothrix sp. EaCA	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	1.10 %
Coptotermitinae	subfamily	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea → Blattoidea → Termitoidae → Rhinotermitidae → Coptotermitinae	0.55 %
Pleocyemata	suborder	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Malacostraca → Eumalacostraca → Eucarida → Decapoda → Pleocyemata	0.55 %
Aplysia californica	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Mollusca → Gastropoda → Heterobranchia → Euthyneura → Tectipleura → Aplysiida → Aplysioidea → Aplysiidae → Aplysia → Aplysia californica	0.55 %
Branchiostoma	genus	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Cephalochordata → Leptocardii → Amphioxiformes → Branchiostomidae → Branchiostoma	0.55 %
Anthozoa	class	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Cnidaria → Anthozoa	0.55 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.55 %

Level 26

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	71.43 %
Yponomeutoidea	superfamily	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Endopterygota → Amphiesmenoptera → Lepidoptera → Glossata → Neolepidoptera → Heteroneura → Ditrysia → Yponomeutoidea	1.65 %
Capitella teleta	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida → Polychaeta → Sedentaria → Scolecida → Capitellidae → Capitella → Capitella teleta	1.65 %
Mytilus	genus	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Mollusca → Bivalvia → Autobranchia → Pteriomorphia → Mytiloida → Mytiloidea → Mytilidae → Mytilinae → Mytilus	1.10 %
Candidatus Nephrothrix sp. EaCA	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	1.10 %
Coptotermes	genus	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea → Blattoidea → Termitoidae → Rhinotermitidae → Coptotermitinae → Coptotermes	0.55 %
Pleocyemata	suborder	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Malacostraca → Eumalacostraca → Eucarida → Decapoda → Pleocyemata	0.55 %
Aplysia californica	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Mollusca → Gastropoda → Heterobranchia → Euthyneura → Tectipleura → Aplysiida → Aplysioidea → Aplysiidae → Aplysia → Aplysia californica	0.55 %
Branchiostoma	genus	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Cephalochordata → Leptocardii → Amphioxiformes → Branchiostomidae → Branchiostoma	0.55 %
Anthozoa	class	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Cnidaria → Anthozoa	0.55 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.55 %

Level 27

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	71.43 %
Plutellidae	family	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Endopterygota → Amphiesmenoptera → Lepidoptera → Glossata → Neolepidoptera → Heteroneura → Ditrysia → Yponomeutoidea → Plutellidae	1.65 %
Capitella teleta	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida → Polychaeta → Sedentaria → Scolecida → Capitellidae → Capitella → Capitella teleta	1.65 %
Mytilus	genus	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Mollusca → Bivalvia → Autobranchia → Pteriomorphia → Mytiloida → Mytiloidea → Mytilidae → Mytilinae → Mytilus	1.10 %
Candidatus Nephrothrix sp. EaCA	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	1.10 %
Coptotermes formosanus	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea → Blattoidea → Termitoidae → Rhinotermitidae → Coptotermitinae → Coptotermes → Coptotermes formosanus	0.55 %
Pleocyemata	suborder	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Malacostraca → Eumalacostraca → Eucarida → Decapoda → Pleocyemata	0.55 %
Aplysia californica	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Mollusca → Gastropoda → Heterobranchia → Euthyneura → Tectipleura → Aplysiida → Aplysioidea → Aplysiidae → Aplysia → Aplysia californica	0.55 %
Branchiostoma	genus	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Cephalochordata → Leptocardii → Amphioxiformes → Branchiostomidae → Branchiostoma	0.55 %
Anthozoa	class	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Cnidaria → Anthozoa	0.55 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.55 %

Level 28

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	71.43 %
Plutella	genus	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Endopterygota → Amphiesmenoptera → Lepidoptera → Glossata → Neolepidoptera → Heteroneura → Ditrysia → Yponomeutoidea → Plutellidae → Plutella	1.65 %
Capitella teleta	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida → Polychaeta → Sedentaria → Scolecida → Capitellidae → Capitella → Capitella teleta	1.65 %
Mytilus	genus	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Mollusca → Bivalvia → Autobranchia → Pteriomorphia → Mytiloida → Mytiloidea → Mytilidae → Mytilinae → Mytilus	1.10 %
Candidatus Nephrothrix sp. EaCA	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	1.10 %
Coptotermes formosanus	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea → Blattoidea → Termitoidae → Rhinotermitidae → Coptotermitinae → Coptotermes → Coptotermes formosanus	0.55 %
Pleocyemata	suborder	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Malacostraca → Eumalacostraca → Eucarida → Decapoda → Pleocyemata	0.55 %
Aplysia californica	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Mollusca → Gastropoda → Heterobranchia → Euthyneura → Tectipleura → Aplysiida → Aplysioidea → Aplysiidae → Aplysia → Aplysia californica	0.55 %
Branchiostoma	genus	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Cephalochordata → Leptocardii → Amphioxiformes → Branchiostomidae → Branchiostoma	0.55 %
Anthozoa	class	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Cnidaria → Anthozoa	0.55 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.55 %

Level 29

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	71.43 %
Plutella xylostella	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Endopterygota → Amphiesmenoptera → Lepidoptera → Glossata → Neolepidoptera → Heteroneura → Ditrysia → Yponomeutoidea → Plutellidae → Plutella → Plutella xylostella	1.65 %
Capitella teleta	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida → Polychaeta → Sedentaria → Scolecida → Capitellidae → Capitella → Capitella teleta	1.65 %
Mytilus	genus	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Mollusca → Bivalvia → Autobranchia → Pteriomorphia → Mytiloida → Mytiloidea → Mytilidae → Mytilinae → Mytilus	1.10 %
Candidatus Nephrothrix sp. EaCA	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	1.10 %
Coptotermes formosanus	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea → Blattoidea → Termitoidae → Rhinotermitidae → Coptotermitinae → Coptotermes → Coptotermes formosanus	0.55 %
Pleocyemata	suborder	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Malacostraca → Eumalacostraca → Eucarida → Decapoda → Pleocyemata	0.55 %
Aplysia californica	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Mollusca → Gastropoda → Heterobranchia → Euthyneura → Tectipleura → Aplysiida → Aplysioidea → Aplysiidae → Aplysia → Aplysia californica	0.55 %
Branchiostoma	genus	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Cephalochordata → Leptocardii → Amphioxiformes → Branchiostomidae → Branchiostoma	0.55 %
Anthozoa	class	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Cnidaria → Anthozoa	0.55 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.55 %

Associated Scaffolds

Scaffold	Taxonomy	Length
3300004626|Ga0066188_1090323	Not Available	1066
3300004626|Ga0066188_1182576	Not Available	749
3300004626|Ga0066188_1216702	Not Available	675
3300004626|Ga0066188_1225774	Not Available	658
3300004626|Ga0066188_1255764	Not Available	605
3300005648|Ga0056131_1053488	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Mollusca → Bivalvia → Autobranchia → Pteriomorphia → Mytiloida → Mytiloidea → Mytilidae → Mytilinae → Mytilus	2266
3300005648|Ga0056131_1180651	Not Available	979
3300005648|Ga0056131_1299503	Not Available	594
3300005871|Ga0056124_1013190	Not Available	4338
3300005871|Ga0056124_1015289	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda	4091
3300005871|Ga0056124_1017542	Not Available	3861
3300005871|Ga0056124_1023017	Not Available	3422
3300005871|Ga0056124_1025437	Not Available	3265
3300005871|Ga0056124_1029976	Not Available	3025
3300005871|Ga0056124_1031708	Not Available	2943
3300005871|Ga0056124_1036043	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida → Polychaeta → Sedentaria → Scolecida → Capitellidae → Capitella → Capitella teleta	2755
3300005871|Ga0056124_1040207	Not Available	2600
3300005871|Ga0056124_1046063	Not Available	2413
3300005871|Ga0056124_1048136	Not Available	2354
3300005871|Ga0056124_1057830	Not Available	2114
3300005871|Ga0056124_1076203	Not Available	1774
3300005871|Ga0056124_1076846	All Organisms → cellular organisms → Eukaryota → Opisthokonta	1764
3300005871|Ga0056124_1092234	Not Available	1552
3300005871|Ga0056124_1096992	Not Available	1495
3300005871|Ga0056124_1099749	Not Available	1463
3300005871|Ga0056124_1104017	All Organisms → cellular organisms → Eukaryota → Opisthokonta	1417
3300005871|Ga0056124_1105665	Not Available	1400
3300005871|Ga0056124_1126963	Not Available	1209
3300005871|Ga0056124_1127343	Not Available	1206
3300005871|Ga0056124_1163401	Not Available	960
3300005871|Ga0056124_1168819	Not Available	929
3300005871|Ga0056124_1179008	Not Available	876
3300005871|Ga0056124_1179599	Not Available	873
3300005871|Ga0056124_1203078	Not Available	767
3300005871|Ga0056124_1208623	Not Available	744
3300005871|Ga0056124_1209859	All Organisms → cellular organisms → Eukaryota → Opisthokonta	739
3300005871|Ga0056124_1219361	Not Available	704
3300005871|Ga0056124_1220704	Not Available	699
3300005871|Ga0056124_1242160	Not Available	627
3300005871|Ga0056124_1256448	All Organisms → cellular organisms → Eukaryota → Opisthokonta	585
3300005871|Ga0056124_1265930	Not Available	559
3300005871|Ga0056124_1275558	Not Available	535
3300005871|Ga0056124_1280048	Not Available	524
3300005871|Ga0056124_1280061	Not Available	524
3300005968|Ga0056130_1011452	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Endopterygota → Amphiesmenoptera → Lepidoptera → Glossata → Neolepidoptera → Heteroneura → Ditrysia → Yponomeutoidea → Plutellidae → Plutella → Plutella xylostella	3334
3300005968|Ga0056130_1024096	Not Available	2630
3300005968|Ga0056130_1035590	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	2275
3300005968|Ga0056130_1036184	Not Available	2260
3300005968|Ga0056130_1037421	Not Available	2228
3300005968|Ga0056130_1062594	All Organisms → cellular organisms → Eukaryota → Opisthokonta	1778
3300005968|Ga0056130_1099143	All Organisms → cellular organisms → Eukaryota → Opisthokonta	1396
3300005968|Ga0056130_1143145	Not Available	1105
3300005968|Ga0056130_1150404	Not Available	1067
3300005968|Ga0056130_1204611	Not Available	837
3300005968|Ga0056130_1237051	Not Available	733
3300005968|Ga0056130_1261650	Not Available	667
3300005968|Ga0056130_1266271	Not Available	655
3300005968|Ga0056130_1278843	All Organisms → cellular organisms → Eukaryota → Opisthokonta	625
3300005968|Ga0056130_1285242	Not Available	611
3300005968|Ga0056130_1331084	Not Available	521
3300005978|Ga0056129_1003603	All Organisms → cellular organisms → Eukaryota → Opisthokonta	6472
3300005978|Ga0056129_1022809	All Organisms → cellular organisms → Eukaryota → Opisthokonta	3583
3300005978|Ga0056129_1031735	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida → Polychaeta → Sedentaria → Scolecida → Capitellidae → Capitella → Capitella teleta	3125
3300005978|Ga0056129_1053510	All Organisms → cellular organisms → Eukaryota → Opisthokonta	2427
3300005978|Ga0056129_1054563	All Organisms → cellular organisms → Eukaryota → Opisthokonta	2403
3300005978|Ga0056129_1061281	Not Available	2256
3300005978|Ga0056129_1079331	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida → Polychaeta → Sedentaria → Scolecida → Capitellidae → Capitella → Capitella teleta	1932
3300005978|Ga0056129_1090629	Not Available	1772
3300005978|Ga0056129_1104705	All Organisms → cellular organisms → Eukaryota → Opisthokonta	1601
3300005978|Ga0056129_1132274	Not Available	1335
3300005978|Ga0056129_1202515	Not Available	894
3300005978|Ga0056129_1245373	Not Available	721
3300005978|Ga0056129_1268331	Not Available	647
3300005978|Ga0056129_1286795	Not Available	596
3300005979|Ga0056132_1113937	Not Available	1400
3300005984|Ga0056126_10005994	All Organisms → cellular organisms → Eukaryota → Opisthokonta	4043
3300005984|Ga0056126_10007190	All Organisms → cellular organisms → Eukaryota → Opisthokonta	3829
3300005984|Ga0056126_10025940	All Organisms → cellular organisms → Eukaryota → Opisthokonta	2518
3300005984|Ga0056126_10032699	Not Available	2308
3300005984|Ga0056126_10034576	Not Available	2258
3300005984|Ga0056126_10049599	Not Available	1951
3300005984|Ga0056126_10140306	Not Available	1165
3300005984|Ga0056126_10142605	Not Available	1154
3300005984|Ga0056126_10165746	All Organisms → Viruses → Predicted Viral	1052
3300005984|Ga0056126_10171397	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Malacostraca → Eumalacostraca → Eucarida → Decapoda → Pleocyemata	1030
3300005984|Ga0056126_10345725	Not Available	617
3300005984|Ga0056126_10381152	Not Available	569
3300005984|Ga0056126_10416423	Not Available	528
3300006000|Ga0056123_1050794	Not Available	1811
3300006000|Ga0056123_1052476	Not Available	1785
3300006000|Ga0056123_1066880	Not Available	1593
3300006000|Ga0056123_1076592	Not Available	1492
3300006000|Ga0056123_1121382	Not Available	1167
3300006000|Ga0056123_1184955	Not Available	901
3300006000|Ga0056123_1196058	Not Available	866
3300006000|Ga0056123_1226671	Not Available	783
3300006000|Ga0056123_1230045	Not Available	775
3300006000|Ga0056123_1244006	Not Available	742
3300006000|Ga0056123_1260143	Not Available	707
3300006912|Ga0056114_1026379	All Organisms → cellular organisms → Eukaryota → Opisthokonta	4239
3300006912|Ga0056114_1045988	All Organisms → cellular organisms → Eukaryota	3167
3300006912|Ga0056114_1071641	Not Available	2364
3300006912|Ga0056114_1099228	All Organisms → cellular organisms → Eukaryota → Opisthokonta	1814
3300006912|Ga0056114_1110109	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea → Blattoidea → Termitoidae → Rhinotermitidae → Coptotermitinae → Coptotermes → Coptotermes formosanus	1647
3300006912|Ga0056114_1111461	Not Available	1628
3300006912|Ga0056114_1118429	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Endopterygota → Amphiesmenoptera → Lepidoptera → Glossata → Neolepidoptera → Heteroneura → Ditrysia → Yponomeutoidea → Plutellidae → Plutella → Plutella xylostella	1535
3300006912|Ga0056114_1191626	Not Available	877
3300006912|Ga0056114_1201868	Not Available	818
3300006912|Ga0056114_1237852	Not Available	655
3300006912|Ga0056114_1273017	Not Available	546
3300006913|Ga0056115_1027131	Not Available	3823
3300006913|Ga0056115_1186206	Not Available	982
3300006913|Ga0056115_1322091	Not Available	563
3300027098|Ga0209367_1009128	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Mollusca	13493
3300027118|Ga0209454_1120344	Not Available	722
3300027208|Ga0209671_1052217	All Organisms → cellular organisms → Eukaryota → Opisthokonta	2705
3300027208|Ga0209671_1094397	Not Available	684
3300027289|Ga0209787_1014453	Not Available	2581
3300027289|Ga0209787_1032558	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Cephalochordata → Leptocardii → Amphioxiformes → Branchiostomidae → Branchiostoma	1965
3300027289|Ga0209787_1061980	Not Available	1504
3300027289|Ga0209787_1085981	Not Available	1275
3300027289|Ga0209787_1092869	Not Available	1223
3300027289|Ga0209787_1097730	Not Available	1189
3300027289|Ga0209787_1116554	Not Available	1073
3300027289|Ga0209787_1171049	Not Available	828
3300027289|Ga0209787_1250660	Not Available	584
3300027289|Ga0209787_1273875	Not Available	529
3300027338|Ga0209052_1002733	Not Available	7479
3300027338|Ga0209052_1015211	Not Available	4055
3300027338|Ga0209052_1019100	Not Available	3676
3300027338|Ga0209052_1021967	All Organisms → cellular organisms → Eukaryota → Opisthokonta	3448
3300027338|Ga0209052_1024749	Not Available	3262
3300027338|Ga0209052_1025198	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera	3231
3300027338|Ga0209052_1026387	Not Available	3163
3300027338|Ga0209052_1043723	Not Available	2425
3300027338|Ga0209052_1049413	All Organisms → cellular organisms → Eukaryota → Opisthokonta	2262
3300027338|Ga0209052_1070029	All Organisms → cellular organisms → Eukaryota → Opisthokonta	1822
3300027338|Ga0209052_1082102	Not Available	1632
3300027338|Ga0209052_1085813	All Organisms → cellular organisms → Eukaryota → Opisthokonta	1580
3300027338|Ga0209052_1092824	All Organisms → cellular organisms → Eukaryota → Opisthokonta	1486
3300027338|Ga0209052_1109157	Not Available	1306
3300027338|Ga0209052_1119174	Not Available	1215
3300027338|Ga0209052_1130050	Not Available	1126
3300027338|Ga0209052_1152212	Not Available	973
3300027338|Ga0209052_1156538	Not Available	947
3300027338|Ga0209052_1199977	Not Available	720
3300027338|Ga0209052_1232751	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Cnidaria → Anthozoa	591
3300027338|Ga0209052_1233055	Not Available	590
3300027338|Ga0209052_1248335	Not Available	538
3300027392|Ga0209680_1005123	All Organisms → cellular organisms → Eukaryota → Opisthokonta	5607
3300027392|Ga0209680_1010051	All Organisms → cellular organisms → Eukaryota → Opisthokonta	4516
3300027392|Ga0209680_1018949	All Organisms → cellular organisms → Eukaryota → Opisthokonta	3607
3300027392|Ga0209680_1023763	All Organisms → cellular organisms → Eukaryota → Opisthokonta	3302
3300027392|Ga0209680_1065548	All Organisms → cellular organisms → Eukaryota → Opisthokonta	2034
3300027392|Ga0209680_1072662	Not Available	1915
3300027392|Ga0209680_1074192	Not Available	1892
3300027392|Ga0209680_1089840	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Mollusca → Gastropoda → Heterobranchia → Euthyneura → Tectipleura → Aplysiida → Aplysioidea → Aplysiidae → Aplysia → Aplysia californica	1675
3300027392|Ga0209680_1092237	All Organisms → cellular organisms → Eukaryota → Opisthokonta	1645
3300027392|Ga0209680_1111333	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	1430
3300027392|Ga0209680_1132383	Not Available	1242
3300027392|Ga0209680_1144760	Not Available	1146
3300027392|Ga0209680_1145649	Not Available	1139
3300027392|Ga0209680_1223842	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Endopterygota → Amphiesmenoptera → Lepidoptera → Glossata → Neolepidoptera → Heteroneura → Ditrysia → Yponomeutoidea → Plutellidae → Plutella → Plutella xylostella	707
3300027520|Ga0209681_1084207	Not Available	1635
3300027549|Ga0209458_1005783	All Organisms → cellular organisms → Eukaryota → Opisthokonta	3835
3300027549|Ga0209458_1027181	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera	2280
3300027549|Ga0209458_1075952	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Mollusca → Bivalvia → Autobranchia → Pteriomorphia → Mytiloida → Mytiloidea → Mytilidae → Mytilinae → Mytilus	1460
3300027549|Ga0209458_1105980	Not Available	1218
3300027549|Ga0209458_1174956	Not Available	890
3300027549|Ga0209458_1274996	All Organisms → cellular organisms → Eukaryota → Opisthokonta	617
3300027549|Ga0209458_1301311	Not Available	565

Environmental Properties

Associated Habitat Types

Ecosystem

Habitat	Taxonomy	Distribution
Host-Associated	Host-Associated	100.00%

Class

Habitat	Taxonomy	Distribution
Annelida	Host-Associated → Annelida	100.00%

Category

Habitat	Taxonomy	Distribution
Digestive System	Host-Associated → Annelida → Digestive System	100.00%

Type

Habitat	Taxonomy	Distribution
Digestive Tube	Host-Associated → Annelida → Digestive System → Digestive Tube	62.64%
Unclassified	Host-Associated → Annelida → Digestive System → Unclassified	37.36%

Subtype

Habitat	Taxonomy	Distribution
Extracellular Symbionts	Host-Associated → Annelida → Digestive System → Digestive Tube → Extracellular Symbionts	62.64%
Unclassified	Host-Associated → Annelida → Digestive System → Unclassified → Unclassified	37.36%

Habitat

Habitat	Taxonomy	Distribution
Marine Gutless Worms Symbiont	Host-Associated → Annelida → Digestive System → Digestive Tube → Extracellular Symbionts → Marine Gutless Worms Symbiont	62.64%
Marine Gutless Worms Symbiont	Host-Associated → Annelida → Digestive System → Unclassified → Unclassified → Marine Gutless Worms Symbiont	37.36%

Associated Samples

Taxon OID	Sample Name	Habitat Type
3300004626	Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Olavius loisae HERON ISLAND.2	Host-Associated
3300005648	Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Olavius clavatus LIZARD ISLAND.1	Host-Associated
3300005871	Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Olavius sp. 4 HERON ISLAND	Host-Associated
3300005968	Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Olavius loisae LIZARD ISLAND.2	Host-Associated
3300005978	Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Olavius loisae LIZARD ISLAND.1	Host-Associated
3300005979	Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Olavius clavatus LIZARD ISLAND.2	Host-Associated
3300005984	Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Inanidrilus manae LIZARD ISLAND	Host-Associated
3300006000	Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Olavius sp. 3 HERON ISLAND	Host-Associated
3300006912	Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Olavius loisae HERON ISLAND.1	Host-Associated
3300006913	Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Olavius sp. DAHAB.1	Host-Associated
3300027098	Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Olavius geniculatus LIZARD ISLAND.2 (SPAdes)	Host-Associated
3300027118	Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Olavius geniculatus HERON ISLAND.1 (SPAdes)	Host-Associated
3300027208	Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Olavius geniculatus HERON ISLAND.2 (SPAdes)	Host-Associated
3300027289	Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Olavius loisae LIZARD ISLAND.2 (SPAdes)	Host-Associated
3300027338	Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Olavius sp. 4 HERON ISLAND (SPAdes)	Host-Associated
3300027392	Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Olavius loisae LIZARD ISLAND.1 (SPAdes)	Host-Associated
3300027520	Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Olavius clavatus LIZARD ISLAND.2 (SPAdes)	Host-Associated
3300027549	Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Inanidrilus manae LIZARD ISLAND (SPAdes)	Host-Associated

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
Ga0066188_10903232	3300004626	Marine Gutless Worms Symbiont	NWRDVVNKDLQRMGLTWEEVEASAQDRQTWRQRVALCIGDTG*
Ga0066188_11825763	3300004626	Marine Gutless Worms Symbiont	RTNWRDVVNKDLQRMGLTWEEVEASAQDRQTWRQRVALCISDAG*
Ga0066188_12167021	3300004626	Marine Gutless Worms Symbiont	NWRDVVNKDLQRMGLTWEEVEASAQDRQTWRQRVALCIGDSG*
Ga0066188_12257741	3300004626	Marine Gutless Worms Symbiont	FKRRPSRPRTNWRDVVNKDLQRMRLTWEEVEALAQDRQTWRQRVALCVGDAG*
Ga0066188_12557641	3300004626	Marine Gutless Worms Symbiont	FKRRPGRPRTNWRDVVNKDLQRMGLTWEEVEASAQDRQTWCQRVALCIGDAG*
Ga0056131_10534881	3300005648	Marine Gutless Worms Symbiont	VAGFKRRPGRPRINWRDTVNKDLQRMGLTWEEVEASAQDRQTWRQRVALRIGDAG*
Ga0056131_11588804	3300005648	Marine Gutless Worms Symbiont	INWRDTVNKDLQRMGLTWEEVEASAQDRQTWRQRVALCNGDAG*
Ga0056131_11806512	3300005648	Marine Gutless Worms Symbiont	RDIVNKDLQRMGLTWEEVEASAQDRQTWRQRVALCIGDAA*
Ga0056131_12995032	3300005648	Marine Gutless Worms Symbiont	RDIVNKDLQRMGLTWEEVEASAQDRQTWRQRVALCIGDAG*
Ga0056124_101319012	3300005871	Marine Gutless Worms Symbiont	RINWRDTVNKDLQRMGLTWEEVEASAQDRQTWRQPVALCIEDAG*
Ga0056124_10152895	3300005871	Marine Gutless Worms Symbiont	LIWSDKDLQRMGLTWEEVEASAQDRQTWRQRVALCIEDAG*
Ga0056124_10175421	3300005871	Marine Gutless Worms Symbiont	RRPGRPTINWRDTVNKDLQRMGLTWEEVEASAQDRQTWRLRVALCIEDAG*
Ga0056124_10230175	3300005871	Marine Gutless Worms Symbiont	TKDKLEDTVNKDLQRMGLTWEEVEASAQDRQTWRQRVTLCIEDAG*
Ga0056124_10254371	3300005871	Marine Gutless Worms Symbiont	WRDTVNKDLQRMGLTWEEVEASAQDRQTWRQRVALCIEDAG*
Ga0056124_10299761	3300005871	Marine Gutless Worms Symbiont	GRPRINWRDTVNKDLQRMGLTWEEVEASAQDRQTWRQRVALCIEDAG*
Ga0056124_10317081	3300005871	Marine Gutless Worms Symbiont	DTVNKDLQRMGLTWEEVEASAQDRQTWRQRVALCIKDAG*
Ga0056124_10360431	3300005871	Marine Gutless Worms Symbiont	RPGRPRINWKDTVNKDLQRMGLTWEEVEASAQDRQTWRQRLALCIEDAG*
Ga0056124_10402077	3300005871	Marine Gutless Worms Symbiont	KRRPGRPRINWKDTVNKDLQRMGLTWEEVEASPQDRQTWRQRVALCIEDAG*
Ga0056124_10460634	3300005871	Marine Gutless Worms Symbiont	NWKDTVNKDLQRMGLTWEEVEASAQDRQTWRQRVALCIEDPG*
Ga0056124_10481361	3300005871	Marine Gutless Worms Symbiont	RINWRDTVNKDLQRMGLTWEEVEASAQDRQTWRQRVALCTEDAG*
Ga0056124_10578304	3300005871	Marine Gutless Worms Symbiont	DLQRMGLTWEEVEASAQDRQTCRQRVALCIEDAG*
Ga0056124_10762031	3300005871	Marine Gutless Worms Symbiont	DLQRMGLTWEEVEASAQDRETWRQRVALCIEDAG*
Ga0056124_10768461	3300005871	Marine Gutless Worms Symbiont	RINWRDTVNKDLQRMGLTWEEVEASAQDRQTWRQRVALCIGNAG*
Ga0056124_10922344	3300005871	Marine Gutless Worms Symbiont	WRDTVNKDLQRMGLTWVEVEASAQDRQTWRQRVALCIEDAG*
Ga0056124_10969921	3300005871	Marine Gutless Worms Symbiont	RRPGRPRINWRDTVNKDLQRMGLTWEEVEASAQDRQTWRHRVALCIEDAG*
Ga0056124_10997494	3300005871	Marine Gutless Worms Symbiont	NKDLQRMGLTWEEVEASAQDRQTWRQRVALCIEDAG*
Ga0056124_11040173	3300005871	Marine Gutless Worms Symbiont	KRRPGRPRINWRDTVNKDLQRMGLTWEEVEASAQDRQTWLQRVALCIEDAG*
Ga0056124_11056655	3300005871	Marine Gutless Worms Symbiont	DLQRMGLTWEEVEASAQDRQTWRQRVALCIEDAG*
Ga0056124_11269631	3300005871	Marine Gutless Worms Symbiont	RDTVNKDLQRMGLTWEEVEASAQDRQTWRQRVALCIEDAR*
Ga0056124_11273432	3300005871	Marine Gutless Worms Symbiont	KDLQRMGLTWEEVEASAQDRQTWRQRVALCIEDAG*
Ga0056124_11602643	3300005871	Marine Gutless Worms Symbiont	DTVNKDLQRMGLTWEEVEASAQDRQTWHQRVALCIEDAG*
Ga0056124_11634011	3300005871	Marine Gutless Worms Symbiont	PGRPRINWRDTVNKDLQRMGLTWEEVEASAQDRQTWRQRAALCIEDAG*
Ga0056124_11688191	3300005871	Marine Gutless Worms Symbiont	DLQRMGLTWEEVEASAQDRQTWRQRVALCIGDAG*
Ga0056124_11790081	3300005871	Marine Gutless Worms Symbiont	WRDTVNKDLQRMGLTWEEVEASAQDRQTWRQRVALCIEDEGSRKWLW*
Ga0056124_11795991	3300005871	Marine Gutless Worms Symbiont	RPRINWKDTVNKDLQRMGLTWEEVEASAQDRQTWRQRVALCIEDAG*
Ga0056124_12030782	3300005871	Marine Gutless Worms Symbiont	RDTVNKDLQRMGLTWEEVEASAQDRQTWRQRVALCIGDAE*
Ga0056124_12086232	3300005871	Marine Gutless Worms Symbiont	RPRINWRDTVNKDLQRMGLTWEEVEASAQDRQTWRQRVALCIEDAG*
Ga0056124_12098593	3300005871	Marine Gutless Worms Symbiont	GFKRRPGRPRINWRDTVNKDLQRMGLTWEEVEASAQDRHIWCQRVALCIEDAG*
Ga0056124_12193611	3300005871	Marine Gutless Worms Symbiont	NKDLQRMGLTWEEVEASAQDRQTWRQRVALCIGDAG*
Ga0056124_12207041	3300005871	Marine Gutless Worms Symbiont	RDTVNKDLQRMGLTWEEVEASAQDRQTWRQRVALCIEDAG*
Ga0056124_12421602	3300005871	Marine Gutless Worms Symbiont	TVNKDLQRMGLTWEEVEASAQDRQTWRQRVALCIEDAG*
Ga0056124_12564481	3300005871	Marine Gutless Worms Symbiont	AGFKRRPGRPRINWRDTVNKDLQRMGLTWEEVEASAQDRLTWRQRVALCIEDAG*
Ga0056124_12623782	3300005871	Marine Gutless Worms Symbiont	VNKDLQRMGLTWEEVEASAQDRQTWCQRVALCIEDAG*
Ga0056124_12659301	3300005871	Marine Gutless Worms Symbiont	KDLQRMGLTWEEVEASAQDRQTWRQRVALCIGDAG*
Ga0056124_12755583	3300005871	Marine Gutless Worms Symbiont	DTVNKDLQRLGLTWEEVEASAQDRQTWRQRVALCIENAG*
Ga0056124_12800483	3300005871	Marine Gutless Worms Symbiont	NWRDTVNKDLQRMGLTWEEVEASAQDRQTWRQRVALCIGDTG*
Ga0056124_12800612	3300005871	Marine Gutless Worms Symbiont	INWRDTVNKDLQRMGLTWEEVEASAQDRQTWRQRVALSIEDAG*
Ga0056130_10114521	3300005968	Marine Gutless Worms Symbiont	KRRPGRPRTNWRDVVNKDLQRMGLTWEEVEASAQDRHTWRQRVALCIGDAG*
Ga0056130_10240967	3300005968	Marine Gutless Worms Symbiont	RTNWRDVVNKDLQRMGLTWEEVEASAQDRQTWRQRVSLCIGDAG*
Ga0056130_10355901	3300005968	Marine Gutless Worms Symbiont	FKIRPGRPRTNWRDVVNKDLQRMGLTWEEVEASAQDRQTWRQRVALCIGDAG*
Ga0056130_10361845	3300005968	Marine Gutless Worms Symbiont	WRDVVNKDLQRMGLTWEEVEASAQDRQTWRQRVALCIGDAR*
Ga0056130_10374211	3300005968	Marine Gutless Worms Symbiont	RPRTNWRDVVNKDLQRMGLTWEDVEASAQDRQTWRQRVALCIGDAG*
Ga0056130_10625941	3300005968	Marine Gutless Worms Symbiont	VVGFKRRPGRPRTNWRDVVNKDLQRMGLTWEEVEASAQDRQTWRQRVALCIGDAG*
Ga0056130_10991431	3300005968	Marine Gutless Worms Symbiont	GRPRTNWRDVVNKDLQRMGLTWEEVEASAQDRQTWRQRVALCIGDAG*
Ga0056130_11431451	3300005968	Marine Gutless Worms Symbiont	NWRNVVNKDLQRMGLTWEEVEASAQDRQTWRQCVALCIGDAG*
Ga0056130_11504043	3300005968	Marine Gutless Worms Symbiont	DVVNKDLQRMGLTWEEVEASAQDRQTWRQRVALCIGDAG*
Ga0056130_12046112	3300005968	Marine Gutless Worms Symbiont	TNWRDVVNKDLQRMGLTWEEVEASAQDRQTWRQRVALCIGDAG*
Ga0056130_12370511	3300005968	Marine Gutless Worms Symbiont	VNKDLQRMGLTWEEVEASAQDRQTRHQRVALCIGDAG*
Ga0056130_12616501	3300005968	Marine Gutless Worms Symbiont	RRPGRPRTNWRDVVNKDLQRMGLTWEEVEASAQDRQTWRQRVALCIGDAG*
Ga0056130_12662712	3300005968	Marine Gutless Worms Symbiont	WRDVVNKDLQRMGLTWEEVEASAQDRQTWRQRVALCIGDAG*
Ga0056130_12788431	3300005968	Marine Gutless Worms Symbiont	GFKRRPGRPRTNWRDVVNKDLQRMGLTWEEVEASALDRQTWRQRVALCIGDAG*
Ga0056130_12852421	3300005968	Marine Gutless Worms Symbiont	FKRRPGRPRTNWRDVVNKDLQRMGLTWEEVEASAQDRQTCRQRVALCIGDAV*
Ga0056130_13310841	3300005968	Marine Gutless Worms Symbiont	NWRDVVNKDLQRMGLTWEEVEASAQDRQTWRQRVALCISDAG*
Ga0056129_10036039	3300005978	Marine Gutless Worms Symbiont	GFKRRPGRPRTNWRDVVNKDLQRMGLTWEEVEASAQDRQTRHQRVALCIGDAG*
Ga0056129_10228096	3300005978	Marine Gutless Worms Symbiont	FKRRPGRPRTNWRDVVNKDLQRMGLTWEEVEASAQDRQTWRQRVALCIGDAG*
Ga0056129_10317357	3300005978	Marine Gutless Worms Symbiont	PGRPRTNWRDVVNKDLQRMGLTWEEVEASAQDRQTWRQRVSLCIGDAG*
Ga0056129_10535101	3300005978	Marine Gutless Worms Symbiont	RDVVNKDLQRMGLTWEEVEASAQDRQTWRQRVALCIGDAE*
Ga0056129_10545633	3300005978	Marine Gutless Worms Symbiont	VGFKRRPGRPRTNWRDVVNKDLQRMGLTWEEVEASAQDRQTWRQRVALCIGDAG*
Ga0056129_10612811	3300005978	Marine Gutless Worms Symbiont	VNKDLQRMGLTWEEVEASAQDRQTWRQRVALCIGDAR*
Ga0056129_10793311	3300005978	Marine Gutless Worms Symbiont	RPRTNCRDVVNKDLQRMGLTWEEVEASAQDRQTRRQRVALCIGDAG*
Ga0056129_10906294	3300005978	Marine Gutless Worms Symbiont	FKRRPGRPRTNWRDVGNKDLQRMGLTWEEVEASAQDRQTWCQRVALCIGDAG*
Ga0056129_11047052	3300005978	Marine Gutless Worms Symbiont	FKRRPGRPRTNWRNVVNKDLQRMGLTWEEVEASAQDRQTWRQCVALCIGDAG*
Ga0056129_11322741	3300005978	Marine Gutless Worms Symbiont	RTNWRDVVNKDLQRMGLTWEEVEASALDRQTWRQRVALCIGDAG*
Ga0056129_12025153	3300005978	Marine Gutless Worms Symbiont	PGRPRTNWRDVVNKDLQRMGLTWEEVEASAQDRQTWRQRVPVALCIGDAG*
Ga0056129_12453731	3300005978	Marine Gutless Worms Symbiont	SRPGRPRTNWRDVVNKDLQRMGLTWEEVEASAQDRQTWRKRVALCIGDAG*
Ga0056129_12683311	3300005978	Marine Gutless Worms Symbiont	TNWRDVVNKDLQRMGLTWEEVEASAQDRQTWRQRVALCIGNAG*
Ga0056129_12867952	3300005978	Marine Gutless Worms Symbiont	FKRRPGRPRTNWRDVGNKDLQRMGLTWEEVEASAQDRQTWRQPVALCIGDAG*
Ga0056132_11139372	3300005979	Marine Gutless Worms Symbiont	DIVNKDLQRMGLTWEEVEASAQDRQTWRQRVALCIGDAGSIKSSHVK*
Ga0056126_100059941	3300005984	Marine Gutless Worms Symbiont	VAGFKRRPGRPRINWRDTVNKDLQRMGLTWEEVEASAQDRQTWRQRVALCIGDAG*
Ga0056126_100071908	3300005984	Marine Gutless Worms Symbiont	AGFKRRPGRPRINWRDTVNKDLQRMGLTWEEVEASAQDRQTWRQRVALCIGDAG*
Ga0056126_100259405	3300005984	Marine Gutless Worms Symbiont	FKRRPGRPRINWRDTVNKDLQRMGLTWEEVEALAQERQAWHQRVALCIGDAG*
Ga0056126_100326991	3300005984	Marine Gutless Worms Symbiont	INWRDTVNKDLQRMGLTWEEVEASAQDRQTWRQRVALCIGDAG*
Ga0056126_100345765	3300005984	Marine Gutless Worms Symbiont	WRDTVNKDLQRMGLTWEEVEASAQDRQTWRQRVALCIGDAG*
Ga0056126_100495991	3300005984	Marine Gutless Worms Symbiont	PRINWRDTVNKDLQRMGLTWEEVEASAQDRQTWRQRVALCIGDAG*
Ga0056126_101403061	3300005984	Marine Gutless Worms Symbiont	KDLQRMGLTWEEVEASAQDRQTWRQHVALCIGDAG*
Ga0056126_101426054	3300005984	Marine Gutless Worms Symbiont	RPRINWRDTVNKDLQRMGLTWEEVEASAQDRQTWRQRVALRIGDAG*
Ga0056126_101657461	3300005984	Marine Gutless Worms Symbiont	RRPGRPRINWRDTVNKDLQRMGLTWEEVEASAQDRQTWRRRVALCIGDAG*
Ga0056126_101713973	3300005984	Marine Gutless Worms Symbiont	PGRPRINWRDTVNKDLQKMGLTWEEVKASAQDRQTWRQCVALCIGDAG*
Ga0056126_101742391	3300005984	Marine Gutless Worms Symbiont	PRINWRDTVNKDLQRMGLTWEEVEASAQDRQTWHQRVALCIGDAG*
Ga0056126_102931741	3300005984	Marine Gutless Worms Symbiont	NKDLQRMGLTWEEVEASAQDRQTWRQRVALCIWDAG*
Ga0056126_103457251	3300005984	Marine Gutless Worms Symbiont	NLQRMGLTWEEVEASAQDRQTWRQRVALCIGDAG*
Ga0056126_103811521	3300005984	Marine Gutless Worms Symbiont	INWRDTVNKDLQKMGLTWEEVEASAQDRQTWRQRVALCIGDAG*
Ga0056126_104164231	3300005984	Marine Gutless Worms Symbiont	DLQRMGLTWEEVEASAQDGQTWRQRVALCIGDAG*
Ga0056123_10198291	3300006000	Marine Gutless Worms Symbiont	PRINWRDIVNKDIQRMGLTWEEVEASAQDRQTWHQRVALCIGDA*
Ga0056123_10507941	3300006000	Marine Gutless Worms Symbiont	MHYIHWRDIVNKDIQRMGLTWEEVEASAQDRQTWRQRVALGDAG*
Ga0056123_10524761	3300006000	Marine Gutless Worms Symbiont	IVNKDIQRMGLTWEEVEASAQDRQTWRQHVALCIGDAG*
Ga0056123_10668801	3300006000	Marine Gutless Worms Symbiont	KDIQRMGLTWEEVEASAQDRQTWRQRVALCIGDAR*
Ga0056123_10765921	3300006000	Marine Gutless Worms Symbiont	DIVNKDIQRMGLTVTWEEVEASAQDRQTWRQRVALCIGDAG*
Ga0056123_11213823	3300006000	Marine Gutless Worms Symbiont	INWRDIVNKDIQRMGLTWEEVEASAQDRQTWRQSVALCIGNAG*
Ga0056123_11849551	3300006000	Marine Gutless Worms Symbiont	PRINWRDIVNKDIQRMGLTWEEVEASAQDRQTWRQRMALCIDNAG*
Ga0056123_11960581	3300006000	Marine Gutless Worms Symbiont	INWRDIVNKDIQRMGLTWEEVEASAQDRQTWRQRVALCIADAG*
Ga0056123_12146042	3300006000	Marine Gutless Worms Symbiont	RGPGRPRINWRDIVNKDIQRMGLTWEEVEASAQDRQTWHQRVALCIGDAG*
Ga0056123_12242021	3300006000	Marine Gutless Worms Symbiont	RDIVNKDIQRMGLTWEEVEASAQDRQTWCYRVALYIGDAE*
Ga0056123_12266711	3300006000	Marine Gutless Worms Symbiont	KDIQRMGLTWEEVEASAQDRQTWRQRVALCIGDAG*
Ga0056123_12300451	3300006000	Marine Gutless Worms Symbiont	RDIVNKDIQRMGLTWEEVEASAQDRQTWRQRVALCIGDAG*
Ga0056123_12358392	3300006000	Marine Gutless Worms Symbiont	MRAIAYKDIQRMGLTWEEVEASAQDRQTWCQRVALCIGDAG*
Ga0056123_12440062	3300006000	Marine Gutless Worms Symbiont	NWRDIVNKDIQRMGLTWEEVEASAQDRQTWRQRVALCIGNAG*
Ga0056123_12601431	3300006000	Marine Gutless Worms Symbiont	NKDIQRMGLTWEEVEASAQDRQTWRQRVALCIGDAG*
Ga0056123_13336571	3300006000	Marine Gutless Worms Symbiont	RYSLVNNDIQRMGLTREEVEASAQDRQTWRQRVAICIGDAG*
Ga0056114_10263791	3300006912	Marine Gutless Worms Symbiont	KRRPGRPRTNWRDVVNKDLQRMGLTWEEVEASAQDRQTWRQCVALCIGDAG*
Ga0056114_10459885	3300006912	Marine Gutless Worms Symbiont	PRTNWRDVVNKDLQRMGLTWEEVEASAQDRQTWRQRVALCISDAG*
Ga0056114_10716411	3300006912	Marine Gutless Worms Symbiont	KRRPGKPRTNWIDVVNKNLQRMGLTWEEVEASAQDRHTWRQCVALCIGDAG*
Ga0056114_10992284	3300006912	Marine Gutless Worms Symbiont	RTNWRDVVNKDLQRMGLTWEEVEASAQDRQTWRQRVALCIGDAG*
Ga0056114_11101093	3300006912	Marine Gutless Worms Symbiont	VNKDLQRMGLTWEEVEASAQDRQTWRQRVALCIGDAG*
Ga0056114_11114613	3300006912	Marine Gutless Worms Symbiont	PGRPRTNWRDVVNKDLQRMGLTWEEVEASAQDRQTWRQRVALCIGDAG*
Ga0056114_11184292	3300006912	Marine Gutless Worms Symbiont	FKRRPGRPRTNWRDVVNKDLQKMGLTWEEVEASAQDRQTWRQRVALCIGDAG*
Ga0056114_11916261	3300006912	Marine Gutless Worms Symbiont	RPGRPRTNWRDVVNKDLQRMGLTWEEVEASAQDRQTWRQRVPVALCIGDAG*
Ga0056114_12018681	3300006912	Marine Gutless Worms Symbiont	DLQRMGSTWEEVEASAQDRQTWRQRVALCIGDAG*
Ga0056114_12378521	3300006912	Marine Gutless Worms Symbiont	VVNKDLQRMGLTWEEVEASAQDRQTWRQRVALCIGDAG*
Ga0056114_12730171	3300006912	Marine Gutless Worms Symbiont	VNKDLQRMGLTWEEVEASAQDRQTWRQRVALCIGYAG*
Ga0056115_10271311	3300006913	Marine Gutless Worms Symbiont	VTKCHTTGFRRRPGRPRMNWRDVVKRYLQRMGLTWEQVKASAQDRHSWHKCVALCIGDAG
Ga0056115_11862061	3300006913	Marine Gutless Worms Symbiont	DVVKKDLQRMGLTWEEVEASAQDRHSWRQRVAVCIGDAG*
Ga0056115_13220913	3300006913	Marine Gutless Worms Symbiont	VKKDLQRMGLTWEEVEASAQDRHSWRQRVALCIGDAG*
Ga0209367_10091288	3300027098	Marine Gutless Worms Symbiont	SWKGVAKKDLQRMGLTWEEAEASAQDRQTWRQRVALCIQDAG
Ga0209454_11203441	3300027118	Marine Gutless Worms Symbiont	KKDLQRMGLTWEEVEASAQDRQTWRQRVALCIQDAG
Ga0209671_10522171	3300027208	Marine Gutless Worms Symbiont	VAKKDLQRMGLTWEEVEASAQDRQTWRQRVALCIQDAG
Ga0209671_10943972	3300027208	Marine Gutless Worms Symbiont	GVAKKDLQRMGLTWEEVEASAQDRQTWRQRVAVCIQDAG
Ga0209787_10144533	3300027289	Marine Gutless Worms Symbiont	VNKDLQRMGLTWEDVEASAQDRQTWRQRVALCIGDAG
Ga0209787_10325581	3300027289	Marine Gutless Worms Symbiont	NKDLQRMGLTWEEVEASAQDRQTWRQRVALCIGDAG
Ga0209787_10619802	3300027289	Marine Gutless Worms Symbiont	TNWRDVVNKDLQRMGLTWEEVEASAQDRQTWRQRVSLCIGDAG
Ga0209787_10859811	3300027289	Marine Gutless Worms Symbiont	FKIRPGRPRTNWRDVVNKDLQRMGLTWEEVEASAQDRQTWRQRVALCIGDAG
Ga0209787_10928691	3300027289	Marine Gutless Worms Symbiont	PGRPRTNWRDVVNKDLQRMGLTWEAVEASAQDRQTWRQRVALCIGDAG
Ga0209787_10977301	3300027289	Marine Gutless Worms Symbiont	VNKDLQRMGLTWEEVEASAQDRQTWRQRVALCIGDAG
Ga0209787_11165542	3300027289	Marine Gutless Worms Symbiont	WRDVVNKDLQRMGLTWEEVEASAQDRQTWRQRVALCIGDAG
Ga0209787_11710491	3300027289	Marine Gutless Worms Symbiont	VNKDLQRMGLTWEEVEASAQDRQTRHQRVALCIGDAG
Ga0209787_12506601	3300027289	Marine Gutless Worms Symbiont	PRTNWRDVVNKDLQRMGLTWEEVEASAQDRQTCRQRVALCIGDAV
Ga0209787_12738751	3300027289	Marine Gutless Worms Symbiont	KDLQRMGLTWEEVEASAQDRQTWRQRVALCIGDAG
Ga0209052_10027331	3300027338	Marine Gutless Worms Symbiont	RINWRDTVNKDLQRMGLTWEEVEASAQDRQTWRQPVALCIEDAG
Ga0209052_10152117	3300027338	Marine Gutless Worms Symbiont	VAGFKRRPGRPRINWRDTVNKDLQRMGLTWEEVEASAQDRQIWRQRVALCIEDAG
Ga0209052_10191001	3300027338	Marine Gutless Worms Symbiont	DTVNKDLQRMGLTWEEVEALAQDRQTWRQRVALCIEDAG
Ga0209052_10219674	3300027338	Marine Gutless Worms Symbiont	PRINWRDTVNKDLQRMGLTWEEVEASAQDRQTWRQRVALCIGDAG
Ga0209052_10247494	3300027338	Marine Gutless Worms Symbiont	RINWRDTVNKDLQRMGLTWEEVEASAQDRQTWLQRVALCIEDAG
Ga0209052_10251984	3300027338	Marine Gutless Worms Symbiont	RDTVNKDLQRVGLTWEEVEASAQDRQTWRQRVALCIEDAG
Ga0209052_10263874	3300027338	Marine Gutless Worms Symbiont	RPRINWRDTVNKDLQRMGLTWEEVEASAQDRQTWRQRVALCIKDAG
Ga0209052_10437231	3300027338	Marine Gutless Worms Symbiont	RINWKDTVNKDLQRMGLTWEEVEASAQDRQTWRQRVALCIEDPG
Ga0209052_10494131	3300027338	Marine Gutless Worms Symbiont	RINWRDTVNKDLQRMGLTWEEVEASAQDRQTWRQRVALCIGNAG
Ga0209052_10700293	3300027338	Marine Gutless Worms Symbiont	TVNKDLQRMGLTWEEVEASAQDRQTWRQRVALCIEDAG
Ga0209052_10821023	3300027338	Marine Gutless Worms Symbiont	RRPGRPRINWRDTVNKDLQRMGLTWEEVEASAQDRQTWRHRVALCIEDAG
Ga0209052_10858132	3300027338	Marine Gutless Worms Symbiont	PGRPRINWRDTVNKDLQRMGLTWEEVEASAQDRQTWRQRVALSIEDAG
Ga0209052_10928241	3300027338	Marine Gutless Worms Symbiont	VAGFKRRPGRPRINWRDTVNNDLQRMGLTWEEVEASAQDRQTWRQRVALCIGDAG
Ga0209052_11091572	3300027338	Marine Gutless Worms Symbiont	VNKDLQRMGLTWEEVEASAQDRQTWRQRVALCIEDAG
Ga0209052_11191742	3300027338	Marine Gutless Worms Symbiont	DTVNKDLQRMGLTWEEVEASAQDRQTWRQRVALCIEDAG
Ga0209052_11300501	3300027338	Marine Gutless Worms Symbiont	RPRINWKDTVNKDLQRMGLTWEEVEASAQDRQTWRQRVALCIEDAG
Ga0209052_11522121	3300027338	Marine Gutless Worms Symbiont	RRPGRPRINWRDTVNKDLQRMGLTWEEVEASAQDRQTWRQRAALCIEDAG
Ga0209052_11565382	3300027338	Marine Gutless Worms Symbiont	NKDLQRMGLTWEEVEASAQDRQTWRQRVALCIEDAG
Ga0209052_11999773	3300027338	Marine Gutless Worms Symbiont	NWRDTVNKDLQRMGLTWEEVEASAQDRQTWRQRVALCIEDAG
Ga0209052_12327511	3300027338	Marine Gutless Worms Symbiont	RDTVNKDLQRMGLTWEEVEASAQDRPTWRQRVALCIEDAG
Ga0209052_12330551	3300027338	Marine Gutless Worms Symbiont	RINWNDTVNKDLQRMGLTWEEVEASAQDRQTWRQCVALCIEDAG
Ga0209052_12483351	3300027338	Marine Gutless Worms Symbiont	PRINWRDTVNKDLQRMGLTWEEVEASAQDRQTWRQRVALSIEDAG
Ga0209680_10051233	3300027392	Marine Gutless Worms Symbiont	VVGFKRRPGRPRTNWRDVVNKDLQRMGLTWEEVEASAQDRQTRHQRVALCIGDAG
Ga0209680_10100511	3300027392	Marine Gutless Worms Symbiont	DVVNKDLQRMGLTWEEVEASAQDRQTWRQRVALCIDDAG
Ga0209680_10189491	3300027392	Marine Gutless Worms Symbiont	VVGFKRIPGRPRTNWRDVVNKDLQRMGLTWEEVEASAQDRQTWRQRVALCIGDAG
Ga0209680_10237634	3300027392	Marine Gutless Worms Symbiont	RTNWRDVVNKDLQRMGLTWEEVEASAQDRQTWRQRVALCIGDAG
Ga0209680_10655482	3300027392	Marine Gutless Worms Symbiont	NWRDVVNKDLQRMGLTWEEVEASAQDRQTWRQRVALCIGDAE
Ga0209680_10726621	3300027392	Marine Gutless Worms Symbiont	RDLQRMGLTWEEVEASAQDRQTWRQRVALCIGDAG
Ga0209680_10741921	3300027392	Marine Gutless Worms Symbiont	PRTNWRDVVNKDLQRMGLTWEEVEASAQDRQTWRQRVALCIGDAG
Ga0209680_10898401	3300027392	Marine Gutless Worms Symbiont	VNKDLQRMGLTWEEVEASAQDRQTWRQRVALCIGDAR
Ga0209680_10922371	3300027392	Marine Gutless Worms Symbiont	RTNWRDVVNKDLQRMGSTWEEVEASAQDRQTWRQRVALCIGDAG
Ga0209680_11113332	3300027392	Marine Gutless Worms Symbiont	VVNKDLQRMGLTWEEVEASAQDRQTWRQRVALCIGDAG
Ga0209680_11323832	3300027392	Marine Gutless Worms Symbiont	RTNWRDVVNKDLQRMGLTWEEVEASALDRQTWRQRVALCIGDAG
Ga0209680_11447601	3300027392	Marine Gutless Worms Symbiont	KDLQRMGLTWEEVEASAQDRQTWRQPVALCIGDAG
Ga0209680_11456492	3300027392	Marine Gutless Worms Symbiont	DVVNKDLQRMGLTWEEVEASAQDRQTWRQRVALCIGDAG
Ga0209680_12238422	3300027392	Marine Gutless Worms Symbiont	KRRPGRPRTNWRDVVNKDLQRMGLTWEEVEASAQDRQTWRQRVALCIGDAG
Ga0209681_10842071	3300027520	Marine Gutless Worms Symbiont	WRDIVNKDLQRMGLTWEEVEASAQDRQTWRQRVALCIGDAGSIKSSHVK
Ga0209458_10057833	3300027549	Marine Gutless Worms Symbiont	EVAGFKRRPGRPRINWRDTVNKDLQRMGLTWEEVEASAQDRQTWRQRVALCIGDAG
Ga0209458_10271814	3300027549	Marine Gutless Worms Symbiont	RRPGRPRINWRDTVNKDLQRMGLTWEEVEASAQDRQTWRQRVTLCIGDAG
Ga0209458_10759523	3300027549	Marine Gutless Worms Symbiont	GFKRRPGRPRINWRDTVNKDLQRMGLTWEEVEASAQDRQTWRQRVALCIGDAG
Ga0209458_11059801	3300027549	Marine Gutless Worms Symbiont	FKRRPGRPRINWRDTVNKDLQRMGLTWEEVEASAQDRQTTMARSCQRVALCIGDAG
Ga0209458_11749562	3300027549	Marine Gutless Worms Symbiont	INWRDTVNKDLQRMGLTWEEVEASAQDRQTWRQRVALCIGDAG
Ga0209458_12361671	3300027549	Marine Gutless Worms Symbiont	NKDLQRMGLTWEEVEASAQDRQTWRQRVALCIWDAG
Ga0209458_12749961	3300027549	Marine Gutless Worms Symbiont	VAGFKRRPGRPRINWRDTVNKDLQRMGLTWEEVEASAQDGQTWRQRVALCIGDAG
Ga0209458_13013111	3300027549	Marine Gutless Worms Symbiont	INWRDTVNKDLQKMGLTWEEVEASAQDRQTWRQRVALCIGDAG