NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metatranscriptome Family F031347

Metatranscriptome Family F031347

Go to section:
Overview Alignments Structure & Topology Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F031347
Family Type Metatranscriptome
Number of Sequences 182
Average Sequence Length 194 residues
Representative Sequence QRASEDRKAENQEFQRIVADQIRTIGALKAAHAKLAEFYFKDSSFLQQKVPTPAQLAAGVEAAPEMQDYENNGNSNKVMGLIQKVMGEAQVTKDNAVSDEQNAADAYVKLVGESNDSIKAKSKAVVDNSEALADTEQSISQATISKGATLRDLETLAASKAELHAQCDFILENFSVRQKARLAEMDALAEVKAILGGMK
Number of Associated Samples 106
Number of Associated Scaffolds 182

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Eukaryota
% of genes with valid RBS motifs 2.22 %
% of genes near scaffold ends (potentially truncated) 96.15 %
% of genes from short scaffolds (< 2000 bps) 98.90 %
Associated GOLD sequencing projects 103
AlphaFold2 3D model prediction Yes
3D model pTM-score0.28

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Eukaryota (79.670 % of family members)
NCBI Taxonomy ID 2759
Taxonomy All Organisms → cellular organisms → Eukaryota

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine
(45.604 % of family members)
Environment Ontology (ENVO) Unclassified
(87.363 % of family members)
Earth Microbiome Project Ontology (EMPO) Unclassified
(68.132 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 77.97%    β-sheet: 0.00%    Coil/Unstructured: 22.03%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.28
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms79.67 %
UnclassifiedrootN/A20.33 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300009023|Ga0103928_10431872All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata518Open in IMG/M
3300009608|Ga0115100_11205479All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata519Open in IMG/M
3300010981|Ga0138316_10504331All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata703Open in IMG/M
3300010981|Ga0138316_11056839All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata618Open in IMG/M
3300010985|Ga0138326_10365731All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata672Open in IMG/M
3300010985|Ga0138326_10607916All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata532Open in IMG/M
3300010985|Ga0138326_10895601All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata613Open in IMG/M
3300010987|Ga0138324_10157624All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata1020Open in IMG/M
3300010987|Ga0138324_10645566Not Available531Open in IMG/M
3300012413|Ga0138258_1007332All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata1042Open in IMG/M
3300012416|Ga0138259_1742209All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata937Open in IMG/M
3300012417|Ga0138262_1038363All Organisms → cellular organisms → Eukaryota → Sar819Open in IMG/M
3300012417|Ga0138262_1343739All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata511Open in IMG/M
3300012418|Ga0138261_1486377All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata510Open in IMG/M
3300012418|Ga0138261_1492989All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata956Open in IMG/M
3300012418|Ga0138261_1614674All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata514Open in IMG/M
3300012419|Ga0138260_10708230All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata689Open in IMG/M
3300012419|Ga0138260_10921846All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata743Open in IMG/M
3300012782|Ga0138268_1388150Not Available506Open in IMG/M
3300012935|Ga0138257_1340613All Organisms → cellular organisms → Eukaryota → Sar794Open in IMG/M
3300018658|Ga0192906_1034109All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata571Open in IMG/M
3300018658|Ga0192906_1037057All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata545Open in IMG/M
3300018768|Ga0193503_1048964All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata609Open in IMG/M
3300018810|Ga0193422_1042370All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata803Open in IMG/M
3300018817|Ga0193187_1067986All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata610Open in IMG/M
3300018825|Ga0193048_1061272All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata570Open in IMG/M
3300018846|Ga0193253_1104158All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata658Open in IMG/M
3300018846|Ga0193253_1123602All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata580Open in IMG/M
3300018861|Ga0193072_1088340All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata598Open in IMG/M
3300018862|Ga0193308_1061414All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata615Open in IMG/M
3300018871|Ga0192978_1062818All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata690Open in IMG/M
3300018889|Ga0192901_1129201Not Available521Open in IMG/M
3300018955|Ga0193379_10202420All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata545Open in IMG/M
3300021169|Ga0206687_1826273All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata639Open in IMG/M
3300021345|Ga0206688_10530206All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata892Open in IMG/M
3300021345|Ga0206688_11088953All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata599Open in IMG/M
3300021350|Ga0206692_1016736All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata566Open in IMG/M
3300021350|Ga0206692_1373128All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata590Open in IMG/M
3300021359|Ga0206689_10299268All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata559Open in IMG/M
3300021878|Ga0063121_1019336All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata633Open in IMG/M
3300021887|Ga0063105_1057815Not Available508Open in IMG/M
3300021891|Ga0063093_1052035All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata675Open in IMG/M
3300021895|Ga0063120_1026299All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata621Open in IMG/M
3300021901|Ga0063119_1045624All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata700Open in IMG/M
3300021921|Ga0063870_1083683All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata569Open in IMG/M
3300021921|Ga0063870_1101138Not Available576Open in IMG/M
3300021928|Ga0063134_1059994All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata531Open in IMG/M
3300021932|Ga0063872_1123388All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata514Open in IMG/M
3300021937|Ga0063754_1092096Not Available615Open in IMG/M
3300021942|Ga0063098_1110946All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata750Open in IMG/M
3300021942|Ga0063098_1139042All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata579Open in IMG/M
3300021943|Ga0063094_1131508All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata526Open in IMG/M
3300021954|Ga0063755_1120575All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata560Open in IMG/M
3300028575|Ga0304731_10093039All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata703Open in IMG/M
3300028575|Ga0304731_10097789All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata748Open in IMG/M
3300028575|Ga0304731_10437552All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata691Open in IMG/M
3300028575|Ga0304731_11204299All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata618Open in IMG/M
3300030653|Ga0307402_10367604All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata827Open in IMG/M
3300030653|Ga0307402_10572074All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata657Open in IMG/M
3300030653|Ga0307402_10636479All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata621Open in IMG/M
3300030653|Ga0307402_10692332Not Available594Open in IMG/M
3300030653|Ga0307402_10752559Not Available568Open in IMG/M
3300030670|Ga0307401_10345088All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata676Open in IMG/M
3300030671|Ga0307403_10682696All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata558Open in IMG/M
3300030671|Ga0307403_10775365All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata522Open in IMG/M
3300030699|Ga0307398_10333713All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata826Open in IMG/M
3300030699|Ga0307398_10620226Not Available598Open in IMG/M
3300030699|Ga0307398_10855230All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata500Open in IMG/M
3300030702|Ga0307399_10649719All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata522Open in IMG/M
3300030709|Ga0307400_10794013All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata585Open in IMG/M
3300030709|Ga0307400_10842004All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata565Open in IMG/M
3300030786|Ga0073966_11221215All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata524Open in IMG/M
3300030786|Ga0073966_11632423All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata533Open in IMG/M
3300030859|Ga0073963_10753154All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata714Open in IMG/M
3300030910|Ga0073956_10882858Not Available568Open in IMG/M
3300030919|Ga0073970_11395910Not Available588Open in IMG/M
3300030952|Ga0073938_11684353Not Available530Open in IMG/M
3300030956|Ga0073944_11254364All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata592Open in IMG/M
3300031062|Ga0073989_13188451Not Available610Open in IMG/M
3300031063|Ga0073961_11763352All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata551Open in IMG/M
3300031063|Ga0073961_12053061All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata543Open in IMG/M
3300031121|Ga0138345_10100965All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata631Open in IMG/M
3300031121|Ga0138345_10479769All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata541Open in IMG/M
3300031126|Ga0073962_12008695All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata532Open in IMG/M
3300031459|Ga0073950_10761153Not Available520Open in IMG/M
3300031559|Ga0308135_1107203Not Available503Open in IMG/M
3300031579|Ga0308134_1124754All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata592Open in IMG/M
3300031710|Ga0307386_10414078All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata695Open in IMG/M
3300031710|Ga0307386_10474236All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata652Open in IMG/M
3300031710|Ga0307386_10499865All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata636Open in IMG/M
3300031710|Ga0307386_10733336Not Available530Open in IMG/M
3300031725|Ga0307381_10353146All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata536Open in IMG/M
3300031729|Ga0307391_10617956All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata614Open in IMG/M
3300031729|Ga0307391_10716537Not Available571Open in IMG/M
3300031729|Ga0307391_10863204All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata521Open in IMG/M
3300031729|Ga0307391_10893890All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata512Open in IMG/M
3300031734|Ga0307397_10600958Not Available516Open in IMG/M
3300031737|Ga0307387_10785321All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata601Open in IMG/M
3300031738|Ga0307384_10648807Not Available508Open in IMG/M
3300031739|Ga0307383_10598131All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata556Open in IMG/M
3300031742|Ga0307395_10253794All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata755Open in IMG/M
3300031742|Ga0307395_10275401All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata724Open in IMG/M
3300031742|Ga0307395_10276772Not Available722Open in IMG/M
3300031742|Ga0307395_10430198Not Available575Open in IMG/M
3300031743|Ga0307382_10272537All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata758Open in IMG/M
3300031743|Ga0307382_10440440Not Available594Open in IMG/M
3300031750|Ga0307389_10930764Not Available574Open in IMG/M
3300032463|Ga0314684_10491187All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata721Open in IMG/M
3300032463|Ga0314684_10656890All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata606Open in IMG/M
3300032470|Ga0314670_10516181All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata623Open in IMG/M
3300032470|Ga0314670_10665673All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata535Open in IMG/M
3300032481|Ga0314668_10623061Not Available544Open in IMG/M
3300032491|Ga0314675_10616391All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata530Open in IMG/M
3300032492|Ga0314679_10256854All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata799Open in IMG/M
3300032492|Ga0314679_10373241All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata648Open in IMG/M
3300032517|Ga0314688_10589319All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata601Open in IMG/M
3300032517|Ga0314688_10639553All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata573Open in IMG/M
3300032517|Ga0314688_10659989All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata563Open in IMG/M
3300032518|Ga0314689_10534236All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata611Open in IMG/M
3300032518|Ga0314689_10692045All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata524Open in IMG/M
3300032519|Ga0314676_10538578All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata692Open in IMG/M
3300032520|Ga0314667_10680153Not Available564Open in IMG/M
3300032520|Ga0314667_10712932All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata549Open in IMG/M
3300032521|Ga0314680_10521408All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata749Open in IMG/M
3300032521|Ga0314680_10592084All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata700Open in IMG/M
3300032521|Ga0314680_10984896All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata528Open in IMG/M
3300032522|Ga0314677_10306808All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata839Open in IMG/M
3300032522|Ga0314677_10416514All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata717Open in IMG/M
3300032522|Ga0314677_10544432All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata616Open in IMG/M
3300032540|Ga0314682_10379149All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata779Open in IMG/M
3300032540|Ga0314682_10389273All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata769Open in IMG/M
3300032615|Ga0314674_10485723All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata638Open in IMG/M
3300032615|Ga0314674_10628174All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata547Open in IMG/M
3300032616|Ga0314671_10452708All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata700Open in IMG/M
3300032617|Ga0314683_10829219All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata556Open in IMG/M
3300032650|Ga0314673_10239757All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata898Open in IMG/M
3300032650|Ga0314673_10425381All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata684Open in IMG/M
3300032650|Ga0314673_10432722All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata678Open in IMG/M
3300032650|Ga0314673_10712144All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata515Open in IMG/M
3300032651|Ga0314685_10516118All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata656Open in IMG/M
3300032651|Ga0314685_10754189All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata520Open in IMG/M
3300032666|Ga0314678_10404344All Organisms → cellular organisms → Eukaryota → Sar617Open in IMG/M
3300032666|Ga0314678_10462112All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata572Open in IMG/M
3300032707|Ga0314687_10375419All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata785Open in IMG/M
3300032707|Ga0314687_10386398All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata774Open in IMG/M
3300032707|Ga0314687_10541651All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata649Open in IMG/M
3300032707|Ga0314687_10747079All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata542Open in IMG/M
3300032707|Ga0314687_10849590All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata503Open in IMG/M
3300032708|Ga0314669_10459173All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata700Open in IMG/M
3300032708|Ga0314669_10603747Not Available604Open in IMG/M
3300032708|Ga0314669_10662259All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata573Open in IMG/M
3300032709|Ga0314672_1206992All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata736Open in IMG/M
3300032711|Ga0314681_10460622Not Available713Open in IMG/M
3300032713|Ga0314690_10556433Not Available566Open in IMG/M
3300032714|Ga0314686_10361504All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata723Open in IMG/M
3300032727|Ga0314693_10310607All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata848Open in IMG/M
3300032727|Ga0314693_10716361Not Available538Open in IMG/M
3300032728|Ga0314696_10310819All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata812Open in IMG/M
3300032730|Ga0314699_10316392Not Available702Open in IMG/M
3300032730|Ga0314699_10373068Not Available643Open in IMG/M
3300032732|Ga0314711_10318123All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata806Open in IMG/M
3300032732|Ga0314711_10423314All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata688Open in IMG/M
3300032732|Ga0314711_10441606All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata672Open in IMG/M
3300032733|Ga0314714_10479050All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata698Open in IMG/M
3300032733|Ga0314714_10708833All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata549Open in IMG/M
3300032734|Ga0314706_10558375All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata548Open in IMG/M
3300032744|Ga0314705_10457721All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata686Open in IMG/M
3300032744|Ga0314705_10457891All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata686Open in IMG/M
3300032744|Ga0314705_10469293All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata676Open in IMG/M
3300032748|Ga0314713_10424042All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata564Open in IMG/M
3300032750|Ga0314708_10596390All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata525Open in IMG/M
3300032752|Ga0314700_10455496Not Available680Open in IMG/M
3300032755|Ga0314709_10449792All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata792Open in IMG/M
3300032755|Ga0314709_10904529All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata511Open in IMG/M
3300033572|Ga0307390_10439304Not Available801Open in IMG/M
3300033572|Ga0307390_10701313All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata635Open in IMG/M
3300033572|Ga0307390_10704601Not Available633Open in IMG/M
3300033572|Ga0307390_10814505Not Available589Open in IMG/M
3300033572|Ga0307390_10891340All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata562Open in IMG/M
3300033572|Ga0307390_10905199All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata558Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine45.60%
SeawaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Seawater36.81%
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine7.69%
Polar MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Polar Marine6.04%
SeawaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Seawater3.30%
Coastal WaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Coastal Water0.55%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300009023Planktonic microbial communities from coastal waters of California, USA - Canon-29EnvironmentalOpen in IMG/M
3300009608Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_2Apr14_M1_3um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010981Metatranscriptome of Marine eukaryotic phytoplankton communities from the Antarctic Ocean - ANT-7 (Eukaryote Community Metatranscriptome) (version 4)EnvironmentalOpen in IMG/M
3300010985Metatranscriptome of Marine eukaryotic phytoplankton communities from the Antarctic Ocean - ANT-7 (Eukaryote Community Metatranscriptome) (version 8)EnvironmentalOpen in IMG/M
3300010987Metatranscriptome of Marine eukaryotic phytoplankton communities from the Antarctic Ocean - ANT-7 (Eukaryote Community Metatranscriptome) (version 6)EnvironmentalOpen in IMG/M
3300012413Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Arthur Harbor ice station, Antarctica - RNA6.ICE_1m.20151110 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012416Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Palmer Station, Antarctica after 24hr light incubation - RNA9.A_24.20151111 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012417Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Palmer Station, Antarctica after 72hr light incubation - RNA13.B_72.20151113 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012418Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Palmer Station, Antarctica after 72hr light incubation - RNA12.A_72.20151113 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012419Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Palmer Station, Antarctica after 24hr light incubation - RNA10.B_24.20151111 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012782Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Arthur Harbor ice station, Antarctica - RNA30.ICE_1m.20151125 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012935Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Arthur Harbor ice station, Antarctica - RNA5.ICE_1m.20151110 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300018658Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_070 - TARA_N000000674 (ERX1789517-ERR1719451)EnvironmentalOpen in IMG/M
3300018768Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_138 - TARA_N000003011 (ERX1789448-ERR1719377)EnvironmentalOpen in IMG/M
3300018810Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_128 - TARA_N000002291 (ERX1789538-ERR1719380)EnvironmentalOpen in IMG/M
3300018817Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_038 - TARA_N000000030 (ERX1789390-ERR1719248)EnvironmentalOpen in IMG/M
3300018825Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_081 - TARA_N000001436 (ERX1809755-ERR1740127)EnvironmentalOpen in IMG/M
3300018846Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_092 - TARA_N000001299 (ERX1789404-ERR1719503)EnvironmentalOpen in IMG/M
3300018861Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_152 - TARA_N000002482 (ERX1789410-ERR1719398)EnvironmentalOpen in IMG/M
3300018862Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_102 - TARA_N000001652 (ERX1789608-ERR1719146)EnvironmentalOpen in IMG/M
3300018871Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001026 (ERX1789475-ERR1719345)EnvironmentalOpen in IMG/M
3300018889Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_068 - TARA_N000000728 (ERX1789501-ERR1719269)EnvironmentalOpen in IMG/M
3300018955Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_123 - TARA_N000001972 (ERX1789369-ERR1719393)EnvironmentalOpen in IMG/M
3300021169Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 30m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021345Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 80m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021350Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 40m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021359Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 100m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021878Metatranscriptome of Marine eukaryotic phytoplankton communities from the Antarctic Ocean - ANT-14 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021881Metatranscriptome of Marine eukaryotic phytoplankton communities from the Antarctic Ocean - ANT-10 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021887Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-132M (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021891Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-20M (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021895Metatranscriptome of Marine eukaryotic phytoplankton communities from the Antarctic Ocean - ANT-13 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021901Metatranscriptome of Marine eukaryotic phytoplankton communities from the Antarctic Ocean - ANT-12 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021921Metatranscriptome of marine eukaryotic phytoplankton communities from Norwegian Sea - 10m ARK-5M ARK-5-3 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021928Metatranscriptome of Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Stratiphyt 2011 S9 C1 B7 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021932Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean - 30m ANT-15 Euk ARK-20-1 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021937Marine eukaryotic phytoplankton communities from the South Atlantic Ocean - 30m ANT-15 Euk ARK-20-2 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021942Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-61M (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021943Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-27M (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021954Marine eukaryotic phytoplankton communities from the Norwegian Sea - 10m ARK-5M Euk ARK-5-1 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300028575Metatranscriptome of Marine eukaryotic phytoplankton communities from the Antarctic Ocean - ANT-7 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030653Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-29 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030670Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-23 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030671Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-34 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030699Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-11 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030702Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-14 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030709Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-17 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030786Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_E6_S_0.2 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030859Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_E6_R_5 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030910Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_E5_T_0.2 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030919Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_E6_V_0.2 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030952Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_E4_Q_0.2 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030956Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_E4_T_0.2 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031062Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_S21_0.2 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031063Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_E6_Q_5 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031121Marine microbial communities from the Southern Atlantic ocean transect - DeepDOM_S15_Trap_metaT (Eukaryote Community Metatranscriptome) (version 2)EnvironmentalOpen in IMG/M
3300031126Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_E6_Q_0.2 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031459Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_E5_Q_0.2 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031559Metatranscriptome of marine microbial communities from Western Arctic Ocean, Canada - CB4_937_33.10 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031579Metatranscriptome of marine microbial communities from Western Arctic Ocean, Canada - CB21_1120_Surface (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031710Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-2.R3 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031725Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-1.R1 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031729Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-4.R2 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031734Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-7 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031737Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-3.R1 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031738Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-2.R1 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031739Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-1.R3 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031742Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-5.R3 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031743Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-1.R2 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031750Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-3.R3 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032463Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red4_24May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032470Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red2_24May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032481Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Amb1_26May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032491Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red2_26May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032492Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red3_28May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032517Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red4_24May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032518Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red4_26May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032519Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red3_22May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032520Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Amb1_24May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032521Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red3_22May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032522Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red3_24May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032540Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red3_26May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032615Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red2_24May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032616Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red2_26May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032617Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red4_22May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032650Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red2_22May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032651Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red4_26May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032666Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red3_26May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032707Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red4_22May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032708Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red2_22May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032709Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red2_28May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032711Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red3_24May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032713Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Plim5_22May_sur (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032714Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red4_28May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032727Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Plim5_22May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032728Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Plim7_22May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032730Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Plim7_22May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032732Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Shad11_26May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032733Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Amb12_26May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032734Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Amb9_26May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032744Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Amb9_24May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032748Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Amb12_24May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032750Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Shad10_26May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032752Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Plim7_26May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032755Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Shad10_28May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300033572Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-4.R1 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
Ga0103928_1043187213300009023Coastal WaterAAHEKLAAFYFKNSNLLQNGVQATTTVAPSPEFDDYKSNRNSNMVMNMIQKLTGDAKVIKDNAVNDEQNAVNAYVKLVGESNDSIKAKSRAITDTTEELAETEQAISQNTITRDETMQELESLAATKASLHAQCDFLLKNFDLRQKARISEMDALGEVKAILRGMK*
Ga0115100_1120547913300009608MarineAHAKLAEFYFKDSSFLQQRVPTPAQLAAGVEAAPEMQDYENNGNSNKVMGLIQKVMGEAQVAKDNAVSDEQNAADAYVKLVGESNASIKAKSKAVVDNSEALADTEQSISQATISKGATLRDLETLAASKAELHAQCDFILENFTVRQKARLAEMDALAEVKAILGGMK*
Ga0138316_1050433113300010981MarineAAEDRKQENKEFQSIVADQIRTIEALKAAHAKLAEFYFKNSNLIQTGAHSTATEATTVAPSPEFADYQSNGNSNKVMNLIQKLTGEAQVLKDTAVKDEQNAEDAYVKLVGESNDSIKEKGKAVVDTTEELADTEQAISQATIDKDETLRDMESLAATKGELHAQCDFLLKNFELRQKARAAEMDALAEVKAILGGMK*
Ga0138316_1105683913300010981MarineLEFQKVVADQIRMIGALKAAHEKLGEFYFKHSTLLQKGRGASTATDSTTVAPSPEFADYESNGSSNKVMNLIQKFMGEAQVIKDEATSDEQNAADAYVKLVGESNDSIKAKSRAIADKTEELAGVDQATSNALLAKDQTLQDLEGLAGTKASLHAQCDFLLDNFTARQKARAAEIDALAEVKAILSGMK*
Ga0138326_1036573113300010985MarineLQDLGETKKKVEETIATLNSEIANTRVQMQRAAEDRKLENQEFQKVVADQIRAIGALKAAHAKLSEFYFKDSFVQQGVPSPAEMAAGVKEMPGLRNVESNGNSNKVMNLIQKVMGEAQVAKDEAVSDEQNAANAYVKLVSESNDSIKAKSKAVVDKTEELADTEQAISQATLSKDETLRELESLAATKAELHAQCDFLLKNFDLRQKARAAEIDALAEVKGILS
Ga0138326_1060791613300010985MarineQIRTIGALKAAHAKLAEFYMPNGFIQTAQTPSADAGVSEAPELNKVENNANSNKVMNLIQKLTGEAQVIKDTATNDEQNAADAYVKLVGESNDSIKAKSKAVVDKTEELSDTEQAISQATVSKGETLRELESLAQTKAELHAQCDFLLKNFDARQSARSAEIDALNEVKAILSGMK*
Ga0138326_1089560113300010985MarineVQRIVADQIRTIGALKAAHAKLAEFYFKDSLLQQGARTTVTDATTVAPSPEFEDYENNSNSNKIMNMIQKLQGEAKVIKDNAVSDEQNAADAYVKLVGESNDSIKAKSKEVVDKTEELANTEQAISQATIDKDETLRDLESLASTKAELHAQCDFLLKNFDLRQKARAAELDALAEVKAILGGMK*
Ga0138324_1015762413300010987MarineLVRVGEERRGEIVDAWRQFQKVVADQIRMIGALKAAHEKLGEFYFKHSTLLQKGRGASTATDSTTVAPSPEFADYESNGSSNKVMNLIQKFMGEAQVIKDEATSDEQNAADAYVKLVGESNDSIKAKSRAIADKTEELAGVDQATSNALLAKDQTLQDLEGLAGTKASLHAQCDFLLDNFTARQKARAAEIDALAEVKAILSGMK*
Ga0138324_1064556613300010987MarineEETIATLNSEIANTRVQMQRAAEDRKAENKEFQTVVADQIRAIGALKAAHAKLSEFYFKNSFVQQGVPSPAEMAAGVKEMPGLRDVESNGNSNKVMNLIQKVMGESQVAKDEAVSDEQNAANAYVKLVSESNDSIKAKSKAVVDKTEELADTEQAISQATLSKDETLRELEALAATK
Ga0138258_100733223300012413Polar MarineLDAQKKKLEDTIDALKADIANTQVQMQRASEDRKAENMEFQKIVADQIRTIGALKAAHDKLGEFYFKNSNFLQQGSPADAGVAPSPEFEDYKSNGNSNKIMNLIQKLTGEAGVIKDNAVSDEQNAATAYVKLIGESNDSIKAKGKAITDKVGELASTEQAISQGTISKDETLRDLESLAATKGELHAQCDFLLKNFTLRQKARAAEMEALAEVKAILGGMK*
Ga0138259_174220923300012416Polar MarineLKAAHAKLGEFYFKDSFLQKGARTMDTPAPSPEFKDYKSNGSSNKVMNLIQKFMGEAQVMKDNAVSDEQNASNAYVKLVGESNDSIKAKSREVVDTTEELADTEQGISQATISKGETLRELESLAATKGELHAQCDFLLKNFELRQKARAAEMDALAEVRAILGGMK*
Ga0138262_103836313300012417Polar MarineVEMADEVKHKDFCVKELNDNQVDEEKKQAKFDNLEAEIQDLGGKKTKLQDTIAALKHDIADSQTQMQRASEDRKQQNKDFQVIVADQIRTIGALKAAHAKLAEFYFKGSFLQKQTPAADAGVKEAPGFKDYESNGSSNKVMNLIQTVMGEAQVAKDEAVSDEQNASNAYVKLVGESNDSIKAKSRAVTDTTEELADTEQGISQATISKDEALRELESLAATKATLHGQCDFVLKNFSVRQQARSAELDALAEVKAILGGMK*
Ga0138262_134373913300012417Polar MarineAAGVEESPEFEDYKSNGNSNKIMNLIQKLTGEAQVVKDNAVSDEQNAADAYVKLVGESNDAVKAKSRAVVDKNEELANTEQAISQATISKDETLRDLESLAATKGELHAQCDFLLDNFTVRQQARAAELDALAEVKAILGGMK*
Ga0138261_148637713300012418Polar MarineSFLQKQTPAADAGVKEAPGFKDYESNGSSNKVMNLIQTVMGEAQVAKDEAVSDEQNASNAYVKLVGESNDSIKAKSRAVTDTTEELADTEQGISQATISKDEALRELESLAATKATLHGQCDFVLKNFSVRQQARSAELDALAEVKAILGGMK*
Ga0138261_149298913300012418Polar MarineRAKLKVEMADEVKHRDFCVGELNDNKVTEEKRQAKLDNLESKIEDLEAKKKTVEETIAALTADIADTRVQIQRASENRKAENHEFQTIVADQIRTIGALKAAHAKLGEFYFKDAFVQEDGQTPATMAAGVEESPEFEDYKSNGNSNKIMNLIQKLTGEAQVVKDNAVSDEQNAADAYVKLVGESNDAVKAKSRAVVDKNEELANTEQAISQATISKDETLRDLESLAATKGELHAQCDFLLDNFTVRQQARAAELDALAEVKAILGGMK*
Ga0138261_161467413300012418Polar MarineLQKGARTMDTPAPSPEFKDYKSNGSSNKVMNLIQKFMGEAQVMKDNAVSDEQNASNAYVKLVGESNDSIKAKSREVVDTTEELADTEQGISQATISKGETLRELESLAATKGELHAQCDFLLKNFELRQKARAAEMDALAEVRAILGGMK*
Ga0138260_1070823013300012419Polar MarineLGAKKAKLEDTISALNADIANTRVQMQRASEDRKAENQEFQKIVADQITTIGALKAAHAKLGEFYFKDSFLQRGARTMDTPAPSPEFKDYKSNGSSNKVMNLIQKFMGEAQVMKDNAVSDEQNASNAYVKLVGESNDSIKAKSREVVDTTEELADTEQGISQATISKGETLRELESLAATKGELHAQCDFLLKNFELRQKARAAEMD
Ga0138260_1092184613300012419Polar MarineLEAKKKTVEETIAALTADIADTRVQIQRASENRKAENHEFQTIVADQIRTIGALKAAHAKLGEFYFKDAFVQEDGQTPATMAAGVEESPEFEDYKSNGNSNKIMNLIQKLTGEAQVVKDNAVSDEQNAADAYVKLVGESNDAVKAKSRAVVDKNEELANTEQAISQATISKDETLRDLESLAATKGELHAQCDFLLDNFTVRQQARAAELDALAEVKAILGGMK*
Ga0138268_138815013300012782Polar MarineEDRKAENQEFQRIVADQIRTIGALKAAQAKLAEFYFKDSSFLQQKVPTPAQLAAGVEEAPELNAVESNGNSNKVMGMIQKVMGESQVAKDNAVSDEQGAADAYVKLVGESNASIKAKSKAVVDNSEDLADTEQSISQATISKGATLRDLETLAASKGELHAQCDFILE
Ga0138257_134061313300012935Polar MarineDFCVNELHENQVDEEKKQAKFDNLESKIQDLGAKKAKLEDTISALNADIANTRVQMQRASEDRKAENQEFQKIVADQITTIGALKAAHAKLGEFYFKDSFLQRGARTMDTPAPSPEFKDYKSNGSSNKVMNLIQKFMGEAQVMKDNAVSDEQNASNAYVKLVGESNDSIKAKSREVVDTTEELADTEQGISQATISKGETLRELESLSHQGRAACAVRFSAQELRAAAEGPRCRDGRFGRGEGNPRRHEVSVASGAMQTARTVH
Ga0192906_103410913300018658MarineEFQSIVADQIRTIDALKAAHAKLAEFYFKNSNLIQTGAHSTATEATTVAPSPEFADYQSNGNSNKVMNLIQKLTGEAQVLKDTAVKDEQNAEDAYVKLVGESNDSIKEKGKAVVDTTEELADTEQAISQATIDKDETLRDMESLAATKGELHAQCDFLLKNFELRQKARAAEMDALAEVKAILGGMK
Ga0192906_103705713300018658MarineGEFYLPKLIQKGSQAPPPSPEFEDYENNGSGNKVMLLIQKLTGEAQVIKDAAVQDEQNAENAYVKLVGESNDSIKAKSRAMVDTQEELADTEQAISQAKMDRDATLQDLESLGATKASLHSQCDFILKNFDARQKARAAEMDALAEVKGILQGMK
Ga0193503_104896413300018768MarineQRAAEDRKAENQEFQRIVADQIRTIGALKAAHAKLAEFYFKDSLLQQGARTTVTDATTVAPSPEFEDYENNSNSNKIMNMIQKLQGEAKVIKDNAVSDEQNAADAYVKLVGESNDSIKAKSKEVVDKTEELANTEQAISQATIDKDETLRDLESLASTKAELHAQCDFLLKNFDLRQKARAAELDALAEVKAILGGMK
Ga0193422_104237013300018810MarineAKLDNLEAKIEDLGAKKKKLQDTMAGLKSEISDMQVQMQRAAEDRKQENKEFQSIVADQIRTIDALKAAHAKLAEFYFKNSNLIQTGAHSTATEATTVAPSPEFADYQSNGNSNKVMNLIQKLTGEAQALKDTAVKDEQNAEDAYVKLVGESNDSIKEKGKAVVDTTEELADTEQAISQATIDKDETLRDMESLAATKGELHAQCDFLLKNFELRQKARAAEMDALAEVKAILGGMK
Ga0193187_106798613300018817MarineFQTLVADQIRAIGALKAAHAKLSEFYFKNSNFMQKDARTTVTDATTVAPSPEFEDYQSNTNSNKIMNLIQKLTGEAQVIKDNAVNDEQNAVEAYVKLVGESNDSIKAKSQAVTDKVEELASTEQAISQATIAKDETLQDLESLAATKAELHAQCDFLLKNFDLRQKARAAELDALAEVKAILGGMK
Ga0193048_106127213300018825MarineKNSNLIQTGAHSTATEATTVAPSPEFADYQSNGNSNKVMNLIQKLTGEAQVLKDTAVKDEQNAEDAYVKLVGESNDSIKEKGKAVVDTTEELADTEQAISQATIDKDETLRDMESLAATKGELHAQCDFLLKNFELRQKARAAEMDALAEVKAILGGMK
Ga0193253_110415813300018846MarineADIADTKVQMQRASEDRKQENKEFQQIVAGQIQTIGALKAAHAKLAEFYFKDSSFLQQKVPTPAQLAAGVEEAPKLNEVQDNGSSNKVMNLIQKAMSDAQIAKDQATSDEQNASDAYVKLVGESNDSIKAKSKAVVDTSEELADTEQGISQATISKGDTLRELESLAATKGELHSQCDFLLKNFEVRQKARSAELDALAEVKAILGGMK
Ga0193253_112360213300018846MarineEFYFKDSSFLQQKVPTPAQLAAGVEAAPEMQDYENNGNSNKVMGLIQKVMGEAQVTKDNAVSDEQNAADAYVKLVGESNDSIKAKSKAVVDNSEALADTEQSISQATISKGATLRDLETLAASKAELHAQCDFILDNFTVRQKARLAEMDALAEVKAILGGMK
Ga0193072_108834013300018861MarineLQDTMAGLKSEISDMQVQMQRAAEDRKQENKEFQSIVADQIRTIDALKAAHAKLAEFYFKNSNLIQTGAHSTATEATTVAPSPEFADYQSNGNSNKVMNLIQKLTGEAQVLKDTAVKDEQNAEDAYVKLVGESNDSIKEKGKAVVDTTEELADTEQAISQATIDKDETLRDMESLAATKGELHAQCDFLLKNFELRQKA
Ga0193308_106141413300018862MarineDIANTRVEMQRASEDRKMENMEFQTLVADQIRAIGALKAAHAKLSEFYFKNSNFMQKDARTTVTDATTVAPSPEFEDYQSNTNSNKIMNLIQKLTGEAQVIKDNAVNDEQNAVEAYVKLVGESNDSIKAKSQAVTDKVEELASTEQAISQATIAKDETLQDLESLAATKAELHAQCDFLLKNFDLRQKARAAELDALAEVKAIL
Ga0192978_106281813300018871MarineKKGKLEATIAALKADIADTKVQMQRASEDRKAENKEFQQIVAGQIQTIGALKAAHAKLAEFYFKDSFLQQKVPTPAQMAAGVAEAPKLNEVQDNGSSNKVMGLIQKAMSDAQIAKDQAVSDEQNASDAYVKLVGESNDSIKAKSRAVVDTSEELADTEQGISQATISKGDTLRELESLAATKGELHAQCDFLLNNFEVRQKARLAEMDALAEVKAILGGMK
Ga0192901_112920113300018889MarineVEMQRAAEDRKQENLEFQKITADQIRTIEALKAAHEKLAEFYFKNSNFMQKGAQEIPPTTTVAPSPEFEDYKSNRNSNKVMNLIQKLTGEAQVIKDNAVSDEQNAVDAYVKLVTESNAAVKAKTKAVADKMEELADTEQAISETTIAKDQTLKDLEGLAATKADLHAQCDFLL
Ga0193379_1020242013300018955MarineVADQIRTIGALKAAYAKLGEFYFKDSFVQKGSQSTVTPSPSGTSPEFEAYENNGNSNKVMQLIQKVQGEAEVTKQQAIQDEQNAADAYVKLVGESNESIKAKSKAVVDTSEELADTEQAISQATISKDETLQELEALAATKASLHGQCDFILKNFDTRQKARAAEMDALAEVKAILGGMK
Ga0206687_182627313300021169SeawaterQVQMQRASEDRKAENMEFQKIVADQIRTIGALKAAHEKLGEFYFKNSNFLQQGSLSTATTATTVAPSPEFEDYKSNGNSNKIMNLIQKLTGEAQVIKDNAVSDEQNAASAYVKLIGESNDSIKAKGKAITDKVGELASTEQAISQATISKDETLRDLESLAATKGELHAQCDFLLKNFTLRQKARAAEMEALAEVKAILGGMK
Ga0206688_1053020623300021345SeawaterMPTRRKVEDTIAALKADISNTQVQMQRASEDRKQENMEFQRIVADQIRTIGALKAAHEKLAEFYHIDSFLQVKNEPGSANVEAGVEASPEFADYENNGNSNKIMNLIQKLTGEAEVIKDNAVSDEQNAADAYVKLVGESNDSIKAKSKAVVDKTEELASTEQSISQATISKDETLRDLESLAATKGELHAQCDFLLKNFDTRQKARAAELDALAEVKAILGGMK
Ga0206688_1108895313300021345SeawaterQKIVADQIRTIGALKAAHEKLGEFYFKNSNFLQQAGPADKVAPSPEFEDYKSNGNSNKIMNLIQKLTGEAEVIKDNAVSDEQNAATAYVKLIGESNDSIKAKYKAIADKTGELASTEQAISQATISKDETLRDLESLAATKGELHAQCDFLLKNFDLRQKARAAEMEALAEVKAILGGMK
Ga0206692_101673613300021350SeawaterALKAAHAKLAEFYFKDSSFLLQKVPTPAQLAAGVEEAPKLNEVQDNGSSNKVMNLIQKAMSDAQIAKDQATSDEQNASDAYVKLVGESNDSIKAKSKAVVDTSEELADTEQGISQATISKGDTLRELESLAATKGELHSQCDFLLKNFEVRQKARSAELDALAEVKAILGGMK
Ga0206692_137312813300021350SeawaterQEFQKIVADQIRTIGALKAAHAKLSEFYFKDSFLQQGAAAATTVAPSPEFQDYENNGNSNKIMNLIQKLAGEAQVIKDGAIKDEQNAEDAYVKLVGESNDSIKAKSKAVVDKTEELATTEQAISQTTLSKDETLRDLESLAATKAELHAQCDFILKNFDLRQKARAAELDALAEVKAILGGMKA
Ga0206689_1029926813300021359SeawaterQGSLSTATTATTVAPSPEFEDYKSNGNSNKIMNLIQKLTGEAQVIKDNAVSDEQNAASAYVKLIGESNDSIKAKGKAITDKVGELASTEQAISQATISKDETLRDLESLAATKGELHAQCDFLLKNFTLRQKARAAEMEALAEVKAILGGMK
Ga0063121_101933613300021878MarineRKMENMEFQTLVADQIRAIGALKAAHAKLSEFYFKNSNFMQKDARTTVTDATTVAPSPEFEDYQSNTNSNKIMNLIQKLTGEAQVIKDNAVNDEQNAVEAYVKLVGESNDSIKAKSQAVTDKVEELASTEQAISQATIAKDETLQDLESLAATKAELHAQCDFLLKNFDLRQKARAAELDALAEVKAILGGMK
Ga0063117_105749813300021881MarineAKLDGLVAKLEDLANTKKALEDDIAALQHEISETKVEMQRAAEDRKAANMEFQKVVADQIRTIGALKAAHAKLAEFYFKQSLLQNKNKAASKVGDTTTVAPSPEFQDYESNGMSNKVMNLIQTTMSDAQILKDNAVNDEQNAADAYVKLVGESNDAIKAKSRAVADKTEELAATEQATSEALLAKDQT
Ga0063105_105781513300021887MarineDILNTQTEMQRASEDRKAENREFQTIVADQIRTIGALKAAHAKLGEFYFKDAFVQEPDFGAAKAAGVEASPQFEAYESNGNSNKVMNMIQKLQGESQVVKDNAVSDEQNAADAYVKLVGESNESVKAKSKAVVDKTEELSDTEQGISQATISKGETLRELESLAATKG
Ga0063093_105203513300021891MarineIAALKSDIANTRVEMQRASEDRKMENMEFQTLVADQIRAIGALKAAHAKLSEFYFKNSNFMQKDARTTVTDATTVAPSPEFEDYQSNTNSNKIMNLIQKLTGEAQVIKDNAVNDEQNAVEAYVKLVGESNDSIKAKSQAVTDKVEELASTEQAISQATIAKDETLQDLESLAATKAELHAQCDFLLKNFDLRQKARAAELDALAEVKAILGGMK
Ga0063120_102629913300021895MarineRVEMQRASEDRKMENMEFQTLVADQIRAIGALKAAHAKLSEFYFKNSNFMQKDARTTVTDATTVAPSPEFEDYQSNTNSNKIMNLIQKLTGEAQVIKDNAVNDEQNAVEAYVKLVGESNDSIKAKSQAVTDKVEELASTEQAISQATIAKDETLQDLESLAATKAELHAQCDFLLKNFDLRQKARAAELDALAEVKAILGGMK
Ga0063119_104562413300021901MarineEEKKQAKLDSLESELQDLDEHKKKVEDTIAALKSDIANTRVEMQRASEDRKMENMEFQTLVADQIRAIGALKAAHAKLSEFYFKNSNFMQKDARTTVTDATTVAPSPEFEDYQSNTNSNKIMNLIQKLTGEAQVIKDNAVNDEQNAVEAYVKLVGESNDSIKAKSQAVTDKVEELASTEQAISQATIAKDETLQDLESLAATKAELHAQCDFLLKNFDLRQKARAAELDALAE
Ga0063870_108368313300021921MarineTIEALKAAHAKLGEFYFKNSFLQTAAEPVFTPGKDDSPQFADYESNGNSNKVMNLIQKLTGEAQVIKDNAVSDEQNAANAYVKLVGDSNDSIKAKSKAISDKTVELADTEQSISQATISKDQTLRDLESLAATKGELHAQCDFILKNFDARQQARAAELDALGEVKAILSGMK
Ga0063870_110113813300021921MarineESKLQDLDAHKKKVEDTIAALKADILNTQTEMQRASEDRKAENREFQTIVADQIRTIGALKAAHAKLGEFYFKDSFVQEPDFGAAKAAGVEASPQFEAYENNGNSNKVMNMIQKLQGESQVVKDNAVSDEQNAADAYVKLVGESNESVKAKSKAVVDKTEELSDTEQGISQATISKGETLRELESLAATKG
Ga0063134_105999413300021928MarineKNSNFMQKDARTTVTDATTVAPSPEFEDYQSNTNSNKIMNLIQKLTGEAQVIKDNAVNDEQNAVEAYVKLVGESNDSIKAKSQAVTDKVEELASTEQAISQATIAKDETLQDLESLAATKAELHAQCDFLLKNFDLRQKARAAELDALAEVKAILGGMK
Ga0063872_112338813300021932MarineFKNSFLQTAAEPVFTPGKDDSPQFADYESNGNSNKVMNLIQKLTGEAQVIKDNAVSDEQNAANAYVKLVGDSNDSIKAKSKAISDKTVELADTEQSISQATISKDQTLRDLESLAATKGELHAQCDFILKNFDARQQARAAELDALGEVKAILSGMK
Ga0063754_109209613300021937MarineENKVDEEKKQAKLDNLEFKLQDLDAHKKKVEDTIAALKADILNTQTEMQRASEDRKAENREFQTIVADQIRTIGALKAAHAKLGEFYFKDSFVQEPDFGAAKAAGVEASPQFEAYENNGNSNKVMNMIQKLQGESQVVKDNAVSDEQNAADAYVKLVGESNESVKAKSKAVVDKTEELSDTEQGISQATISKGETLRELESLAA
Ga0063098_111094613300021942MarineLHDNQVDEEKKQAKMENLEAQLNDLNAHKKKVEDTITELKADIANTQVQMQRAAEDRKQENIEFQKIVADQIRTIEALKAAHAKLGEFYFKNSFLQTAAEPVFTPGKDDSPQFADYESNGNSNKVMNLIQKLTGEAQVIKDNAVSDEQNAANAYVKLVGDSNDSIKAKSKAISDKTVELADTEQSISQATISKDQTLRDLESLAATKGELHAQCDFILKNFGARQQARAAELDALGEVKAILSGMK
Ga0063098_113904213300021942MarineEFQRILADQIRTIGALKAAHAKLGEFYFKDAFLQEPDFGAAKGAGVEAAPKLQDYESNGNSNKVMNLIQKLTGEAQVIKDNASSDEQNAQNAYVKLVGESNDSIKQKGKAVVDTMEELADTEQGISQATISKGETLRELESLAGTKGELHQQCDFLIKNFELRQKARYAEMDALAEVKAILGGMK
Ga0063094_113150813300021943MarineALTTVTGATTVAPSPEFQDYESNGNSNKIMNLIQKLTGEAQVVKDDAVSDEQNAADAYVKLVGESNDSIKAKSKAVVDKTEELANTEQAISQATISKGETLRDLESLAATKGELHAQCDFLLKNFDLRQKARGAELDALAEVKAILGGMK
Ga0063755_112057513300021954MarineRKQENIEFQKIVADQIRTIEALKAAHAKLGEFYFKNSFLQTAAEPVFTPGKDDSPQFADYESNGNSNKVMNLIQKLTGEAQVIKDNAVSDEQNAANAYVKLVGDSNDSIKAKSKAISDKTVELADTEQSISQATISKDQTLRDLESLAATKGELHAQCDFILKNFDARQQARAAELDALGEVKAIL
Ga0304731_1009303913300028575MarineAAEDRKQENKEFQSIVADQIRTIEALKAAHAKLAEFYFKNSNLIQTGAHSTATEATTVAPSPEFADYQSNGNSNKVMNLIQKLTGEAQVLKDTAVKDEQNAEDAYVKLVGESNDSIKEKGKAVVDTTEELADTEQAISQATIDKDETLRDMESLAATKGELHAQCDFLLKNFELRQKARAAEMDALAEVKAILGGMK
Ga0304731_1009778913300028575MarineEKKQAKLDSLESKLEDLAAHKKKVEDTIAALKQDIANTRVEMQRAAEDRKQENKEFQMIVADQIRTIGALKAAHAKLSEFYFKNAQFVQKAATTVTDATTVAPSPEFEDYKTNGNSNKIMNLIQKLTGEAQVIKDNAVSDEQNAADAYVKLVGESNDSVKAKSKAVVDKTEELADTEQAISQATLSKDETLRELESLAATKAELHAQCDFLLKNFDLRQKARAAELDALAEVKAILGGMK
Ga0304731_1043755213300028575MarineDNLESKLQDLAETKKKVEETIATLNSEIANTRVQMQRAAEDRKLENQEFQKVVADQIRAIGALKAAHAKLSEFYFKDSFVQQGVPSPAEMAAGVKEMPGLRNVESNGNSNKVMNLIQKVMGEAQVAKDEAVSDEQNAANAYVKLVSESNDSIKAKSKAVVDKTEELADTEQAISQATLSKDETLRELESLAATKAELHAQCDFLLKNFDLRQKARAAEIDALAEVKGILS
Ga0304731_1120429913300028575MarineLEFQKVVADQIRMIGALKAAHEKLGEFYFKHSTLLQKGRGASTATDSTTVAPSPEFADYESNGSSNKVMNLIQKFMGEAQVIKDEATSDEQNAADAYVKLVGESNDSIKAKSRAIADKTEELAGVDQATSNALLAKDQTLQDLEGLAGTKASLHAQCDFLLDNFTARQKARAAEIDALAEVKAILSGMK
Ga0307402_1036760413300030653MarineVKHKDFCVNELHENQVDEEKKQAKFDNLESKIQDLGAKKAKLEDTISALNADIANTRVQMQRASEDRKAENQEFQKIVADQITTIGALKAAHAKLGEFYFKDSFLQKGARTMDTPAPSPEFKDYKSNGSSNKVMNLIQKFMGEAQVMKDNAVSDEQNASNAYVKLVGESNDSIKAKSREVVDTTEELADTEQGISQATISKDETLRELESLAATKGELHAQCDFLLKNFELRQKARAAEMDALAEVKAILGGMK
Ga0307402_1057207413300030653MarineADLAQKKKNVEDTIAALKSAISNEQVEMQRASEDRKQANKDFQMVVADQIRTIGALKAAHAKLGEFYFKGSFVQQTPAADAGVKEAPGFADYENNGNSNKVMQMIQKVQGEAELTKDEAVSDEQNAADAYVKLVGESNASVKAKSKAVVDKTEELADTEQAISQATISKGETLRDLESLAATKAELHAQCDFILKNFDARQKARAAEMDALAEVKGIL
Ga0307402_1063647913300030653MarineDTRVQMQRAAEDRKAENLEFQRVVADQIRTIGALKAAHAKLAEFYFKDSLLQTAQTPAADAGVEESPEFADYNNNGNSNKIMNMIQKITGESQVAKDNAVSDEQGAADAYVKLVGESNDSIKAKSKAVVDKTEELATTEQGISQATISKGETLRELESLAATKAELHAQCDFVLENFTVRQQARAAEMDALAEVKAILGGMK
Ga0307402_1069233213300030653MarineLESKLQDLDAHKKKVEDTIAALKADILNTQTEMQRASEDRKAENREFQTIVADQIRTIGALKAAHAKLGEFYFKDAFVQEPDFGAAKAAGVEASPQFEAYESNGNSNKIMNLIQKLQGESQVVKDNAVSDEQNAADAYVKLVGESNESVKAKSKAVVDKTEELSDTEQGISQATISKGETLRELESLAATKGDLHAQC
Ga0307402_1075255913300030653MarineAAHAKLAEFYFKDSSFLQQKVPTPAQLAAGVEEAPELNVVESNGNSNKVMGLIQKVMGETQVAKDNAVSDEQNAADAYVKLVGESNASIKAKSKAVVDNSEDLADTEQSISQATISKGATLRDLETLAASKGELHAQCDFILENFTVRQKARLAEMDALAEVKAILGGMK
Ga0307401_1034508813300030670MarineADLQVQMQRASEDRKAENIEFQRVVADQIRTIEALKAAHAKLAEFYMPDGFLQTAQTPSADAGVAEAPELNKVENNGNSNKVMNLIQKLTGEAQVIRDTATSDEQNAADAYVKLVGESNDSFKAKSRAVMDKTEELSDTEQAISQATVSKGETLRELESLAQTKAELHAQCDFLLQNFGLRKEARTNEIESLKNAKAILSGANFR
Ga0307403_1068269613300030671MarineQGGNLEFQRVVADNIRTIGALKAAHAKLAEFYFKDAFLQTAQTPAADAGVEESPEFADYNNNGNSNKIMNMIQKITGESQVAKDNAVSDEQGAADAYVKLVGESNDSIKAKSKAVVDKTEELATTEQGISQATISKGETLRELESLAATKGELHAQCDFVLENFTVRQQARAAEMDALAEVKAIL
Ga0307403_1077536513300030671MarineKDSALVQIPTQAETGAGVAESPKFADYESNGNSNKVMNLIQKIQGEAGVIKDKAVSDEQNAADAYVKLVGESNTSIKAKSKAMVDKTEELADTEQSTSQATISKDETLRELESLAATKAELHAQCDFLLKNFTLRQKARAAELDALAEVRAILGGMK
Ga0307398_1033371313300030699MarineKDFCVNELHENKVDEEKKSAKLDNLESLLQELDAQKKKLEDTIDALKADIANTQVQMQRASEDRKAENMEFQKIVADQIRTIGALKAAHDKLGEFYFKNSNFLQQGSPADAGVAPSPEFEDYKSNGNSNKIMNLIQKLTGEAGVIKDNAVSDEQNAATAYVKLIGESNDSIKAKGKAITDKVGELASTEQAISQGTISKDETLRDLESLAATKGELHAQCDFLLKNFTLRQKARAAEMEALAEVKAILGGMK
Ga0307398_1062022613300030699MarineKKQAKLDSLESKLGDLASHKKKVEDTMANLKAEIADLQVQMQRASEDRKAENIEFQRVVADQIRTIEALKAAHAKLAEFYMPDGFLQTAQTPSADAGVAEAPELNKVENNGNSNKVMNLIQKLTGEAQVIRDTATSDEQNAADAYVKLVGESNDSVKAKSRAVMDKTEELSDTEQAISQATVSKGETLRELESLAQTK
Ga0307398_1085523013300030699MarineFYFKDFFLQQTPAADAGVKESPEFADYKSNGNSNKVMQMIQKVQGEAEVTKDEAVSDEQNAADAYVKLVGESNASVKAKSKAVVDKTEELADTEQAISQATISKGETLRDLESLAATKAELHAQCDFILKNFDARQKARAAEMDALAEVKGILSGMK
Ga0307399_1064971913300030702MarineYFKDSALAQIPTQAQTTAGVAEDPKFADYENNGNSNKVMLLIQKIQGEASVIKDKAVSDEQNAADAYVKLVGESNASVKAKSKAVVDKTEELADTEQSISQATISKDETLRELESLAATKAELHAQCDFLLKNFDLRQKARAAELDALAEVRAILGGMK
Ga0307400_1079401313300030709MarineDRKAENIEFQRVVADQIRTIEALKAAHAKLAEFYMPDGFLQTAQTPSADAGVAEAPELNKVENNGNSNKVMNLIQKLTGEAQVIRDTATSDEQNAADAYVKLVGESNDSFKAKSRAVMDKTEELSDTEQAISQATVSKGETLRELESLAQTKAELHAQCDFLLKNFEARQKARAAELDALAEVKAILGGMK
Ga0307400_1084200413300030709MarineDQIRTIGALKAAHAKLAEFYFKDSFLQTAQTPAADAGVEESPEFEDYKKGGDSNKIMNLIQKLTGESQVVKDGAVSDEQNAADAYVKLVGESNDAVKAKGKALVDKSEELATTEQGISQATISKGETLRELESLAATKAELHAQCDFVLANFDTRQKARAAEMDALAEVKAILGGMK
Ga0073966_1122121513300030786MarineTGAKTTATDSTTVAPSPEFADYQSNQNSNKVMNLIQKLTGEAQVLKDTAVKDEQNAENAYVKLVGESNDAIKEKSKAIADTTEDLADTEQGISQATIAKDETLRDLESLAATKGELHAQCDFLLKNFDTRQKARAAELDALAEVKAILGGMK
Ga0073966_1163242313300030786MarineEQVQMQRASEDRKQANIEFQKVVADQIRTIGALKAAYAKLGEFYFKDAFIQQTPAADAGVAESPEFKDYKNNANSNKVMQMIQKVQGEAEVTKDEAVSDEQNAADAYVKLVGESNASIKAKSKAVVDKTEELAETEQSISQATISKDETLQDLESLAATKAELHAQCDFILKNFDAR
Ga0073963_1075315413300030859MarineANLKQDIADTQVEMQRAAEDRKAENIEFQKIVADQIRTIGALKAAHAKLGEFYFKNTANLMQKEKQPSGAAKLAAVNNAKQMATKPEFEDYKSNGQSNKVMNLIQKLMGEAQVIKDSAVSDEQNAENAYIKLVTESNAAIKAKTKAIVDKTEELAETEQRISEATIEKDQTLKDLESLAATKAELHVQCDFLLKNFDLRQKARAAELDAIAEVKAILSGMK
Ga0073956_1088285813300030910MarineANLNKEIAETRVEMQRAAEDRKMENKEFQTLVADQIRAIGAMKAAHAKLAEFYFKNSNFLQKGARTTVTDATTVAPSPEFEDYQSNGNSNKVMNLIQKLTGEAEVIKDNAVSDEQNAADAYVKLVGESNDSIKAKSKAVVDKTEELADTEQAISQATIAKDETLRDLESLAATKAELHAQCDFILKNFD
Ga0073970_1139591013300030919MarineHENKVDEEKKQAKLDGLESRLQDLDSHKKKVEDTIANLKAAIADEQVQMQRASEDRKQANLEFQKVVADQIRTIGALKAAYAKLGEFYFKDAFIQQTPAADAGVAESPEFKAYKNNGNSNKVMQMIQKVQGEAEVTKDEAVSDEQNAANAYVKLVGESNESIKAKSKAVVDKTEELAETEQSISQATISKDETLQD
Ga0073938_1123291913300030952MarineDATKKKLEETIAALKADIANTQVQMQRASEDRKQENQEFQKIVADQIRTIGALKAAHEKLGEFYFKNSNFLQEDATTTVAPSPEFEDYKSNGNSNKIMNLIQKLTGEAQVIKDNAVNDEQNAADAYVKLVGESNDSIKAKSKAITDKTEELASTEQAISQATISKDETL
Ga0073938_1168435313300030952MarineLNELAEHKKAVEETIANLKQDIADTQVEMQRAAEDRKAENIEFQKIVADQIRTIGALKAAHEKLAKFYFKDSFVQKANGPAPPPSPEFADYKNNGNSNHVMNLIQKLTGEAEVIKDNAVSDEQNAADAYVKLVGESNGSIKAKSKAVVDKTQELAETEQAISQATIDKGETIRDLE
Ga0073944_1125436413300030956MarineQEFQRVVADQIRTIGALKAAHEKLAKFYFKDSFVQKANGPAPPPSPEFADYKNNGNSNHVMNLIQKLTGEAEVIKDNAVSDEQNAADAYVKLVGESNGSIKAKSKAVVDKTQELAETEQAISQATIDKGETIRDLESLAATKGELHSQCDFILKNFSTRQKARAAELDALAEVKAILRGM
Ga0073989_1318845113300031062MarineQAKLDSLESKLEDLAAHKKKVEDTIAALKQDIANTRVEMQRAAEDRKQENKEFQMIVADQIRTIGALKAAHAKLSEFYFKNAQFVQKAATTVTDATTVAPSPEFEDYKTNGNSNKIMNLIQKLTGEAQVIKDNAVNDEQNAADAYVKLVGESNDSVKAKSKAVVDKTEELADTEQAISQATLSKDETLRDLESLAATKAELH
Ga0073961_1176335213300031063MarineKEFQLLVADQIRAIGAMKAAHEKLAAFYFKNSNFIQKSQKGPAPEAAPEFEDYQSNDKSNKVMNLIQKLTGEAEVIKDNAVSDEQNAQTAYEKLVGESNDSIKAKSQAVVDKTEALAETEQSISQTEIETGDTVRELESLAKTKGELHKQCDFILKNFSLRQQARQAELDALGEVKAILSGMK
Ga0073961_1205306113300031063MarineRTIGALKAAYAKLGEFYFKDAFIQQTPAADAGVAESPEFKAYKNNGNSNKVMQMIQKVQGEAEVTKDEAVSDEQNAANAYVKLVGESNESIKAKSKAVVDKTEELAETEQSISQATISKDETLQDLESLAATKAELHAQCDFILKNFDARQKARQAELDAIAEVKAILQGMK
Ga0138345_1010096513300031121MarineYEIAALKHEIDETKVEMQSATEDRKAANLEFQKVVADQIRMIGALKAAHEKLGEFYFKHSTLLQKGRGASTATDSTTVAPSPEFADYESNGSSNKVMNLIQKFMGEAQVIKDEATSDEQNAADAYVKLVGESNDSIKAKSRAIADKTEELAGVDQATSNALLAKDQTLQDLEGLAGTKASLHAQCDFLLDNFTARQKARAAEMDALAEVK
Ga0138345_1047976913300031121MarineKNSNFLQQGAATTITDATTVAPSPEFEDYKSNGNSNKIMNLIQKLTGEAQVIKDNAVNDEQNAADAYVKLVGESNAVIKAKSKAIVDKTEELASTEQAISQAEVSKGETLRDLESLAATKGELHTQCDFLLKNFDLRQKARAAELDALAEVKAILGGMK
Ga0073962_1200869513300031126MarineADQIRTIGALKAAYAKLGEFYFKDAFIQQTPAADAGVAESPEFKAYKNNGNSNKVMQMIQKVQGEAEVTKDEAVSDEQNAANAYVKLVGESNESIKAKSKAVVDKTEELAETEQSISQATISKDETLQDLESLAATKAELHAQCDFILKNFDARQKARQAELDAIAEVKAILQGMK
Ga0073950_1076115313300031459MarineVEMQRAAEDRKQENIEFQKIVADQIRTIGALKAAHEKLAEFYFKNSNFLQKDLPPTTTVAPSPEFQDYESNRNSNKVMNLIQKLTGEAQVIKDNASSDEQNAQDAYVKLVAESNAAIKAKSKAVVDKTEELAETEQAISEATIAKDQTLKDLEVLAATKADLHAQCDYLLKNF
Ga0308135_110720313300031559MarineKADIANTQVQMQRASEDRKAENQEFQKVVADQIRTIGALKAAHEKLGEFYFKGDFLQTTVTDATTVAPSPQFEDYENNSNSNKIMNLIQKLTGEAEVVKDNAVSDEQNAADAYVKLVGESNDSVKAKSKAVVDKTEELADTEQAISQATISKGETLRDLESLAATKG
Ga0308134_112475413300031579MarineTQVQMQRAAEDRKQENREFQKIVADQITTIGALKAAHAKLGEFYFKNSNFMQTDPAPSPEFKDYKSNGNSNKIMNLIQKLTGEAQVLKDNAVSDEQNASNAYVKLVGESNASIKAKSREVVDTTEELANTEQATSQATINQGETLRELESLAATKGELHTQCDFLLKNFEVRQQARSAEMDALAEVKAILGGMK
Ga0307386_1041407813300031710MarineDALKADIANTQVQMQRASEDRKAENMEFQKIVADQIRTIGALKAAHDKLGEFYFKNSNFLQQGSPADAGVAPSPEFEDYKSNGNSNKIMNLIQKLTGEAGVIKDNAVSDEQNAATAYVKLIGESNDSIKAKGKAITDKVGELASTEQAISQGTISKDETLRDLESLAATKGELHAQCDFLLKNFTLRQKARAAEMEALAEVKAILGGMK
Ga0307386_1047423613300031710MarineADQIRTIGALKAAHAKLAEFYFKDSFVQQTPAADAGVKESPEFADYNNNGNSNKVMQMIQKVQGEAEVTKDEAVSDEQNAADAYVKLVGESNASIKAKSKAVVDKTEELADTEQAISQATISKDETLRDLESLAATKAELHAQCDFILKNFDLRQKARAAELDALAEVKAILNGMK
Ga0307386_1049986513300031710MarineQVQMQRASEDRKAENLEFQRIVADQIRTIGALKAAHEKLAEFYHIDSFLQVKNEPGSANVAAGVEASPEFADYENNGNSNKIMNLIQKLTGESEVIKDNAVSDEQNAADAYVKLVGESNGSIKAKSKAVVDKTEELANTEQSISQATISKDETLRDLESLAATKGELHAQCDFLLKNFDTRQKARAAELDALAEVKAILGGMK
Ga0307386_1073333613300031710MarineAIAALKSEISNEQVQMQRASEDRKQENQEFQTVVADQIRTIGALKAAHAKLGEFYFKDSALAQIPTQAQTTAGVAEDPKFADYENNGNSNKVMLLIQKIQGEAVVIKDKAVSDEQNAADAYVKLVGESNASVKAKSKAVVDKTEELADTEQSISQATISKDETLRELESLAATKAE
Ga0307381_1035314613300031725MarineAHEKLAEFYHIDSFLQVKNEPGSANVAAGVEASPEFADYENNGNSNKIMNLIQKLTGESEVIKDNAVSDEQNAADAYVKLVGESNGSIKAKSKAVVDKTEELANTEQSISQATISKDETLRDLESLAATKGELHAQCDFLLKNFDTRQKARAAELDALAEVKAILGGMK
Ga0307391_1061795613300031729MarineRKQENQEFQTLVADQIRTIGALKAAHAKLAEFYFKDSALVQIPTQAETGAGVAESPKFADYESNGNSNKVMNLIQKIQGEAGVIKDKAVSDEQNAADAYVKLVGESNTSIKAKSKAVVDKTEELADTEQSISQATISKDETLRELESLAATKAELHAQCDFLLKNFTLRQKARAAELDALAEVRAILGGMK
Ga0307391_1071653713300031729MarineDLDAHKKKVEDTIAALQADILNTQTEMQRASEDRKAENREFQTIVADQIRTIGALKAAHAKLGEFYFKDAFVQEPDFGAAKAAGVEASPQFEAYESNGNSNKIMNLIQKLQGESQVVKDNAVSDEQNAADAYVKLVGESNESVKAKSKAVVDKTEELSDTEQSISQATISKGETLRELESLAATKGDLH
Ga0307391_1086320413300031729MarineADQIRTIGALKAAHAKLGEFYFKGSFLQKTAQTPAADAGVAESPEFKAYESNGNSNKVMNLIQKLTGEAQVLKDNAVSDEQNASNAYVKLVGESNDSIKAKGRAVADTTEELADTEQGISQATISKDAALRELETLAATKGELHAQCDFILQNFDLRKEARTNEIESLKNAKA
Ga0307391_1089389013300031729MarineYFKDSFVQAPTQAEQGAGVVESPKFADYENNGNSNKVMNLIQKIQGEAEVIKDKAVSDEQNAADAYVKLVGESNASIKAKSKAVVDKTEELADTEQAISQATISKDETLRELESLAATKAELHAQCDFLLKNFDLRQKARAAELDALAEVRAILGGMK
Ga0307397_1060095813300031734MarineTLATLKSEISNEQVQMQRASEDRKQENQEFQRVVADQIRTVGALKAAHAKLAEFYFKDSALVQIPTQAETGAGVSESPKMADYENNGNSNKVMNLIQKIQGEAEVIKDKAVSDEQNAADAYVKLVGESNASIKAKSKAVVDKTEELADTEQSISQATISKDETLRELESLA
Ga0307387_1078532113300031737MarineLKSEISNEQVQMQRASEDRKQENQEFQTLVADQIRTIGALKAAHAKLAEFYFKDSALVQIPTQAETGAGVAESPKFADYESNGNSNKVMNLIQKIQGEAGVIKDKAVSDEQNAADAYVKLVGESNTSIKAKSKAVVDKTEELADTEQSISQATISKDETLRELESLAATKAELHAQCDFLLKNFTLRQKARAAELDALAE
Ga0307384_1064880713300031738MarineQRASEDRKAANQEFQRVVADQIRTVGALKAAYEKLGKFYFKEDFVQIQGSAPPPAPEFEDYKSNDNSNKVMQLIQKLQGEAEVIKDNAVSDEQNAADAYVKLVGESNASIKAKSRAVVDKTEELADTEQGISQATISKDETLRDLESLAATKGELHAQCDFLLKNFDL
Ga0307383_1059813113300031739MarineTIGALKAAHAKLAEFYFKDSALAQIPTQAQTGAGVAESPKFADYESNGNSNKVMNLIQKIQGEAEVIKDKAVSDEQNAADAYVKLVGESNASIKAKSKAVVDKTEELADTEQSISQATISKDETLRELESLAATKAELHAQCDFLLKNFTLRQKARAAELDALAEVRAILGGMK
Ga0307395_1025379413300031742MarineKKQAKFDNLESSLADLAQKKKNVEDTIAALKSAISNEQVEMQRASEDRKQANKDFQMVVADQIRTIGALKAAYAKLGEFYFKDSFLQQTPAADAGVKESPEFADYKSNGNSNKVMQMIQKVQGEAEVTKDEAVSDEQNAADAYVKLVGESNASVKAKSKAVVDKTEELADTEQAISQATISKGETLRDLESLAATKAELHAQCDFILKNFDARQKARAAEMDALAEVKGILSGMK
Ga0307395_1027540113300031742MarineVDEEKKQAKFDNLESSLADLAQKKKNVEDTIAALKSAISNEQVEMQRASEDRKQANKDFQMVVADQIRTIGALKAAHAKLGEFYFKGSFVQQTPAADAGVKEAPGFADYENNGNSNKVMQMIQKVQGEAELTKDEAVSDEQNAADAYVKLVGESNASVKAKSKAVVDKTEELADTEQAISQATISKGETLRDLESLAATKAELHAQCDFILKNFDARQKARAAEMDALAEVKGILSGMK
Ga0307395_1027677213300031742MarineVDEEKKQAKLDSLESKLGDLASHKKKVEDTMANLKAEIADLQVQMQRASEDRKAENIEFQRVVADQIRTIEALKAAHAKLAEFYFKDSSFLQQKVPTPAQLAAGVEEAPELNAVESNGNSNKVMGMIQKVMGESQVAKDNAVSDEQNAADAYVKLVGESNASVKAKSKAVVDNSEALADTEQSISQATISKGATLRDLETLAATKGELHAQCDFILENFTVRQKARLAEMDALAEVKAIL
Ga0307395_1043019813300031742MarineSQLQDLDSTKKKLEDAIAALKSEISTEQVAMQRASEDRKAANQEFQRVVADQIRTVGALKAAYEKLGKFYFKEDFVQTQASAPPPAPEFEDYSNNGNSNKVMQLIQKLQGEAEVIKDNAVSDEQNAADAYVKLVGESNASLKAKAKAVVDKTEQLADTEQGISQATISKDETLRDLESLAATKGELHAQCD
Ga0307382_1027253713300031743MarineDEVKHKDFCVNELHENKVDEEKKSAKLDNLESLLQELDAQKKKLEDTIDALKADIANTQVQMQRASEDRKAENMEFQKIVADQIRTIGALKAAHDKLGEFYFKNSNFLQQGSPADAGVAPSPEFEDYKSNGNSNKIMNLIQKLTGEAGVIKDNAVSDEQNAATAYVKLIGESNDSIKAKGKAITDKVGELASTEQAISQGTISKDETLRDLESLAATKGELHAQCDFLLKNFTLRQKARAAEMEALAEVKAI
Ga0307382_1044044013300031743MarineQIRTLGALKAAHAKLAEFYFKDSSFLQQKVPTPAQLAAGVEEAPELNVVESNGNSNKVMGLIQKVMGETQVAKDNAVSDEQNAADAYVKLVGESNASIKAKSKAVVDNSEELADTEQSISQATISKGATLRDLETLAASKGELHAQCDFILENFTVRQKARLAEMDALAEVKAILGGMK
Ga0307389_1093076413300031750MarineSSFLQQKVPTPAQLAAGVEEAPELNAVESNGNSNKVMGMIQKVMGESQVAKDNAVSDEQNAADAYVKLVGESNASVKAKSKAVVDNSEALADTEQSISQATISKGATLRDLETLAATKGELHAQCDFILENFTVRQKARLAEMDALAEVKAILGGMK
Ga0314684_1049118713300032463SeawaterEDTIAALKADILNTQTEMQRASEDRKAENREFQTIVADQIRTIGALKAAHAKLGEFYFKDSFVQEPDFGAAKAAGVEASPQFEAYENNGNSNKVMNMIQKLQGESQVVKDNAVSDEQNAADAYVKLVGESNESVKAKSKAVVDKTEELSDTEQGISQATISKGETLRELESLAATKGDLHAQCDFLLKNFAARQGARAAELDALAEVKGILGGMK
Ga0314684_1065689013300032463SeawaterTIATLKKDIAETQVQMQRAAEDRKQENREFQKIVADQITTIGALKAAHAKLGEFYFKNSNFMQTDPAPSPEFKDYKSNGNSNKIMNLIQKLTGEAQVLKDNAVSDEQNASNAYVKLVGESNASIKAKSREVVDTTEELANTEQATSQATINQGETLRELESLAATKGELHTQCDFLLKNFEVRQQARSAEMDALAEVKAIL
Ga0314670_1051618113300032470SeawaterIVADQIRTIGALKAAHAKLGEFYFKDSFVQEPDFGAAKAAGVEASPQFEAYENNGNSNKVMNMIQKLQGESQVVKDNAVSDEQNAADAYVKLVGESNESVKAKSKAVVDKTEELSDTEQGISQATISKGETLRELESLAATKGDLHAQCDFLLKNFAARQGARAAELDALAEVKGILGGM
Ga0314670_1066567313300032470SeawaterAKLAEFYFKDSSFLQQTVPTPAQLAAGVEEAPKLNEVQDNGSSNKVMNLIQKAMSDAQIAKDQATSDEQNASDAYVKLVGESNDSIKAKSKAVVDTSEELADTEQGISQATISKGDTLRELESLAATKGELHSQCDFLLKNFEVRQKARSAELDALAEVKAILGGMK
Ga0314668_1062306113300032481SeawaterDTKVQMQRASEDRKQENKEFQQIVAGQIQTIGALKAAHAKLAEFYFKDSSFLQQTVPTPAQLAAGVEEAPKLNEVQDNGSSNKVMNLIQKAMSDAQIAKDQATSDEQNASDAYVKLVGESNDSIKAKSKAVVDTSEELADTEQGISQATISKGDTLRELESLAATKGELHSQCDFLLKNF
Ga0314675_1061639113300032491SeawaterEMQDYENNGNSNKVMGLIQKVMGEAQVTKDNAASDEQNAADAYVKLVGESNDSIKAKSKAVVDNSEALADTEQSISQATISKGATLRDLETLAASKAELHAQCDFILDNFSVRQKARLAEMDALAEVKAILGGMK
Ga0314679_1025685413300032492SeawaterFCVNELHENKVDEEKKQAKLDNLNAKLEDLAEHKKKVEDTIAALKKDIADTKVPMQRAAEDRKMENQEFQKIVADQIRTIGALKAAHAKLSEFYFKDSLLQQGAAAATTVAPSPEFQDYENNGNSNKIMNLIQKLAGEAQVIKDGAIKDEQNAEDAYVKLVGESNDSIKAKSKAVVDKTEELATTEQAISQTTLSKDETLRDLESLAATKAELHAQCDFILKNFDLRQKARAAELDALAEVKAILGGMKA
Ga0314679_1037324113300032492SeawaterDISDQQVEMQRASEDRKAENQEFQRVVADQIRTIGALKAAHAKLAEFYFKDSSFLQQRVPTPAQLAAGVEAAPEMQDYENNGNSNKVMGLIQKVMGEAQVAKDNAVSDEQNAADAYVKLVGESNASIKAKSKAVVDNSEALADTEQSISQATISKGATLRDLETLAASKAELHAQCDFILENFSVRQKARLAEMDALADLKAILGGMK
Ga0314688_1058931913300032517SeawaterQIVAGQIQTIGALKAAHAKLAEFYFKDSSFLQQTVPTPAQLAAGVEEAPKLNEVQDNGSSNKVMNLIQKAMSDAQIAKDQATSDEQNASDAYVKLVGESNDSIKAKSKAVVDTSEELADTEQGISQATISKGDTLRELESLAATKGELHSQCDFLLKNFEVRQKARSAELDALAEVKAILGGMK
Ga0314688_1063955313300032517SeawaterIGALKAAHAKLGEFYFKDSFVQEPDFGAAKAAGVEASPQFEAYENNGNSNKVMNMIQKLQGESQVVKDNAVSDEQNAADAYVKLVGESNESVKAKSKAVVDKTEELSDTEQGISQATISKGETLRELESLAATKGDLHAQCDFLLKNFAARQGARAAELDALAEVKGILGGMK
Ga0314688_1065998913300032517SeawaterQMQRAAEDRKQENREFQKIVADQITTIGALKAAHTKLGEFYFKNSNFMQTDPAPSPEFKDYKSNGNSNKIMNLIQKLTGEAQVLKDNAVSDEQNASNAYVKLVGESNASIKAKSREVVDTTEELANTEQATSQATINQGETLRELESLAATKGELHTQCDFLLKNFEVRQQARSAEMDALAEVKAIL
Ga0314689_1053423613300032518SeawaterENQEFQRIVADQIRTIGALKAAHAKLAEFYFKDSSFLQQKVPTPAQLAAGVEAAPEMQDYENNGNSNKVMGLIQKVMGEAQVTKDNAVSDEQNAADAYVKLVGESNDSIKAKSKAVVDNSEALADTEQSISQATISKGATLRDLETLAASKAELHAQCDFILDNFSVRQKARLAEMDALAEVKAILGGMK
Ga0314689_1069204513300032518SeawaterDFGAAKAAGVEASPQFEAYENNGNSNKVMNMIQKLQGESQVVKDNAVSDEQNAADAYVKLVGESNESVKAKSKAVVDKTEELSDTEQGISQATISKGETLRELESLAATKGDLHAQCDFLLKNFAARQGARAAELDALAEVKGILGGMK
Ga0314676_1053857813300032519SeawaterEKKQAKLDNLESKLQDLDAHKKKVEDTIAALKADILNTQTEMQRASEDRKAENREFQTIVADQIRTIGALKAAHAKLGEFYFKDSFVQEPDFGAAKAAGVEASPQFEAYENNGNSNKVMNMIQKLQGESQVVKDNAVSDEQNAADAYVKLVGESNESVKAKSKAVVDKTEELSDTEQGISQATISKGETLRELESLAATKGDLHAQCDFLLKNFAARQGARAAELDALAE
Ga0314667_1068015313300032520SeawaterLKKDISDQQVEMQRASEDRKAENQEFQRVVADQIRTIGALKAAHAKLAEFYFKDSSFLQQRVPTPAQLAAGVEAAPEMQDYENNGNSNKVMGLIQKVMGEAQVAKDNAVSDEQNAADAYVKLVGESNASIKAKSKAVVDNSEALADTEQSISQATISKGATLRDLETLAASKAELHAQCDFILENFS
Ga0314667_1071293213300032520SeawaterLAAGVEAAPEMQDYENNGNSNKVMGLIQKVMGEAQVTKDNAVSDEQNAADAYVKLVGESNDSIKAKSKAVVDNSEALADTEQSISQATISKGATLRDLETLAASKAELHAQCDFILDNFSVRQKARLAEMDALAEVKAILGGMK
Ga0314680_1052140813300032521SeawaterEEKKQAKLDSLESKLGDLASHKKKVEDTMANLKAEIADLQVQMQRASEDRKAENIEFQRVVADQIRTIGALKAAHAKLAEFYMPDGFLQTAQTPSADAGVAEAPELNKVESNSNSNKVMNLIQKLTGEAQVIKDTATSDEQNAADAYVKLVGESNDSVKAKSRALMDKTEELSDTEQAISQATVSKGETLRELESLAQTKAELHAQCDFLLKNFEARQKARAAELDALAEVKAILGGMK
Ga0314680_1059208413300032521SeawaterDILNTQTEMQRASEDRKAENREFQTIVADQIRTIGALKAAHAKLGEFYFKDSFVQEPDFGAAKAAGVEASPQFEAYESNGNSNKIMNLIQKLQGESQVIKDNAVSDEQNAADAYVKLVGESNESVKAKSKAVVDKTEELSDTEQGISQATISKGETLRELESLAATKGDLHAQCDFLLKNFAARQGARAAELDALAEVKGILGGMK
Ga0314680_1098489613300032521SeawaterEFYFKDSSFLQQRVPTPTQMAAGVEEAPKLNEVQDNGSSNKVMNLIQKAMSDAQIAKDQATSDEQNASDAYVKLVGESNDSIKAKSKAVVDTSEELADTEQGISQATISKGDTLRELESLAATKGELHSQCDFLLKNFEVRQKARSAELDALAEVKAILGGMK
Ga0314677_1030680813300032522SeawaterVKHKDFCVNELHENKVDEEKKQAKLDNLESKLQDLDAHKKKVEDTIAALKADILNTQTEMQRASEDRKAENREFQTIVADQIRTIGALKAAHAKLGEFYFKDSFVQEPDFGAAKAAGVEASPQFEAYENNGNSNKVMNMIQKLQGESQVVKDNAVSDEQNAADAYVKLVGESNESVKAKSKAVVDKTEELSDTEQGISQATISKGETLRELESLAATKGDLHAQCDFLLKNFAARQGARAAELDALAEVKGILGGMK
Ga0314677_1041651413300032522SeawaterSELQDLGAKKGKLEATIAALKADIADTKVQMQRASEDRKQENKEFQQIVAGQIQTIGALKAAHAKLAEFYFKDSSFLQQTVPTPAQLAAGVEEAPKLNEVQDNGSSNKVMNLIQKAMSDAQIAKDQATSDEQNASDAYVKLVGESNDSIKAKSKAVVDTSEELADTEQGISQATISKGDTLRELESLAATKGELHSQCDFLLKNFEVRQKARSAELDALAEVKAILGGMK
Ga0314677_1054443213300032522SeawaterFYFKDSSFLQQRVPTPAQLAAGVEAAPEMQDYENNGNSNKVMGLIQKVMGEAQVAKDNAVSDEQNAADAYVKLVGESNASIKAKSKAVVDNSEALADTEQSISQATISKGATLRDLETLAASKAELHAQCDFILENFSVRQKARLAEMDALAEVKAILGGMK
Ga0314682_1037914913300032540SeawaterKKLEDTIAALKKSISDEQVEMQRASEDRKAENQEFQRIVADQIRTIGALKAAHAKLAEFYFKDSSFLQQKVPTPAQLAAGVEAAPEMQDYENNGNSNKVMGLIQKVMGEAQVTKDNAASDEQNAADAYVKLVGESNDSIKAKSKAVVDNSEALADTEQSISQATISKGATLRDLETLAASKAELHAQCDFILDNFSVRQKARLAEMDALAEVKAILGGMK
Ga0314682_1038927313300032540SeawaterKHKDFCVNEFHENKVDEEKKQAKLDSLESKLGDLASHKKKVEDTMANLKAEIADLQVQMQRASEDRKAENIEFQRVVADQIRTIGALKAAHAKLAEFYMPDGFLQTAQTPSADAGVAEAPELNKVESNSNSNKVMNLIQKLTGEAQVIKDTATSDEQNAADAYVKLVGESNDSVKAKSRALMDKTEELSDTEQAISQATVSKGETLRELESLAQTKAELHAQCDFLLKNFEARQKARAAELDALAEVKAILGGMK
Ga0314674_1048572313300032615SeawaterVQMQRASEDRKQENKEFQQIVAGQIQTIGALKAAHAKLAEFYFKDSSFLQQTVPTPAQLAAGVEEAPKLNEVQDNGSSNKVMNLIQKAMSDAQIAKDQATSDEQNASDAYVKLVGESNDSIKAKSKAVVDTSEELADTEQGISQATISKGDTLRELESLAATKGELHSQCDFLLKNFEVRQKARSAELDALAEVKAILGGMK
Ga0314674_1062817413300032615SeawaterLKAAHAKLGEFYFKDAFLQEPDFGAAKGAGVEAAPKLQDYESNGNSNKVMNLIQKLTGEAQVIKDNASSDEQNAQNAYVKLVGESNDSIKQKGKAVVDTMEELADTEQGISQATISKGETLRELESLAGTKGELHQQCDFLIKNFELRQKARYAEMDALAEVKAILGGMK
Ga0314671_1045270813300032616SeawaterDILNTQTEMQRASEDRKAENREFQTIVADQIRTIGALKAAHAKLGEFYFKYSFVQEPDFGAAKAAGVEASPQFEAYENNGNSNKVMNMIQKLQGESQVVKDNAVSDEQNAADAYVKLVGESNESVKAKSKAVVDKTEELSDTEQGISQATISKGETLRELESLAATKGDLHAQCDFLLKNFAARQGARAAELDALAEVKGILGGMK
Ga0314683_1082921913300032617SeawaterRVPTPAQLAAGVEAAPEMQDYENNGNSNKVMGLIQKVMGEAQVAKDNAVSDEQNAADAYVKLVGESNASIKAKSKAVVDNSEALADTEQSISQATISKGATLRDLETLAASKAELHAQCDFILENFTVRQKARLAEMDALAEVKAILGGMK
Ga0314673_1023975713300032650SeawaterLQDLDAAKKKLEDTIAALKKSISDEQVEMQRASEDRKAENQEFQRIVADQIRTIGALKAAHAKLAEFYFKDSSFLQQRVPTPAQLAAGVEAAPEMQDYENNGNSNKVMGLIQKVMGEAQVAKDNAVSDEQNAADAYVKLVGESNASIKAKSKAVVDNSEALADTEQSISQATISKGATLRDLETLAASKAELHAQCDFILENFSVRQKARLAEMDALAEVKAILGGMK
Ga0314673_1042538113300032650SeawaterAEIADLQVQMQRASEDRKAENIEFQRVVADQIRTIGALKAAHAKLAEFYMPDGFLQTAQTPSADAGVAEAPELNKVESNSNSNKVMNLIQKLTGEAQVIKDTATSDEQNAADAYVKLVGESNDSVKAKSRALMDKTEELSDTEQAISQATVSKGETLRELESLAQTKAELHAQCDFLLKNFEARQKARAAELDALAEVKAILGGMK
Ga0314673_1043272213300032650SeawaterALKADIADTKVQMQRASEDRKQENKEFQQIVAGQIQTIGALKAAHAKLAEFYFKDSSFLQQTVPTPAQLAAGVEEAPKLNEVQDNGSSNKVMNLIQKAMSDAQIAKDQATSDEQNASDAYVKLVGESNDSIKAKSKAVVDTSEELADTEQGISQATISKGDTLRELESLAATKGELHSQCDFLLKNFEVRQKARSAELDALAEVKAILGGMK
Ga0314673_1071214413300032650SeawaterSNLLQDGVQATTTVAPSPEFEDYKSNRNSNKVMTMIQKLTGDAKVIKDNAVNDEQNAVNAYVKLVGESNDSIKAKSRAIVDTTGELAETEQAISQATLDRDETMRDLESLAATKASLHAQCDFLLKNFPLRQQARASEMDALAEVKAILRGMK
Ga0314685_1051611813300032651SeawaterRKAENQEFQRVVADQIRTIGALKAAHAKLAEFYFKDSSFLQQRVPTPAQLAAGVEAAPEMQDYENNGNSNKVMGLIQKVMGEAQVAKDNAVSDEQNAADAYVKLVGESNASIKAKSKAVVDNSEALADTEQSISQATISKGATLRDLETLAASKAELHAQCDFILENFTVRQKARLAEMDALAEVKAILGGMK
Ga0314685_1075418913300032651SeawaterAAKAAGVEASPQFEAYENNGNSNKVMNMIQKLQGESQVVKDNAVSDEQNAADAYVKLVGESNESVKAKSKAVVDKTEELSDTEQGISQATISKGETLRELESLAATKGDLHAQCDFLLKNFAARQGARAAELDALAEVKGILGGMK
Ga0314678_1040434413300032666SeawaterEFQTIVADQIRTIGALKAAHAKLGEFYFKDSFVQEPDFGAAKAAGVEASPQFEAYENNGNSNKVMNMIQKLQGESQVVKDNAVSDEQNAADAYVKLVGESNESVKAKSKAVVDKTEELSDTEQGISQATISKGETLGNWSLWQPPREIFTPNAISC
Ga0314678_1046211213300032666SeawaterQKVPTPAQLAAGVEAAPEMQDYENNGNSNKVMGLIQKVMGEAQVTKDNAVSDEQNAADAYVKLVGESNASIKAKSKAVVDNSEALADTEQSISQATISKGATLRDLETLAASKAELHAQCDFILDNFSVRQKARLAEMDALAEVKAILGGMK
Ga0314687_1037541913300032707SeawaterDNQVTTEKRQAKLDNLETELQNLGAKKTKLQDTITILKKEIAETQMQMQRAAEDRKMENAEFQRVVADQIQTIDALKAAHEKLGAFYFKNSNLLQDGVQATTTVAPSPEFEDYKSNRNSNKVMTMIQKLTGDAKVIKDNAVNDEQNAVNAYVKLVGESNDSIKAKSRAIVDTTGELAETEQAISQATLARDETMRDLESLAATKASLHAQCDFLLKNFPLRQQARASEMDALAEVKAILRGMK
Ga0314687_1038639813300032707SeawaterVEEERKQAKLDSLESELQDLGAKKGKLEATIAALKVDIADTKVQMQRASEDRKQENKEFQQIVAGQIQTIGALKAAHAKLAEFYFKDSSFLQQTVPTPAQLAAGVEEAPKLNEVQDNGSSNKVMNLIQKAMSDAQIAKDQATSDEQNASDAYVKLVGESNDSIKAKSKAVVDTSEELADTEQGISQATISKGDTLRELESLAATKGELHSQCDFLLKNFEVRQKARSAELDALAEVKAILGGMK
Ga0314687_1054165113300032707SeawaterDTMANLKAEIADLQVQMQRASEDRKAENIEFQRVVADQIRTIGALKAAHAKLAEFYMPDGFLQTAQTPSADAGVAEAPELNKVESNSNSNKVMNLIQKLTGEAQVIKDTATSDEQNAADAYVKLVGESNDSVKAKSRALMDKTEELSDTEQAISQATVSKGETLRELESLAQTKAELHAQCDFLLKNFEARQKARAAELDALAEVKAILGGMK
Ga0314687_1074707913300032707SeawaterKAAHAKLAEFYMPNGFIQTRQTPAADAGVSEAPELNKVENNGNSNKVMNLIQKLTGEAQVIKDQAVSDEQNAADAYVKLVGKSNDSIKAASRAVVDKTTELADTEQAISQATISKGETLRELESLAATKGELHSQCDFTLKNFEARQKARSAEMDALAEVKAILGGMK
Ga0314687_1084959013300032707SeawaterQEPDFGAAKAAGVEASPQFEAYESNGNSNKIMNLIQKLQGESQVIKDNAVSDEQNAADAYVKLVGESNESVKAKSKAVVDKTEELSDTEQGISQATISKGETLRELESLAATKGDLHAQCDFLLKNFAARQGARAAELDALAEVKGILGGMK
Ga0314669_1045917313300032708SeawaterQDLDAHKKKVEDTIAALKADILNTQTEMQRASEDRKAENREFQTIVADQIRTIGALKAAHAKLGEFYFKDSFVQEPDFGAAKAAGVEASPQFEAYENNGNSNKVMNMIQKLQGESQVVKDNAVSDEQNAADAYVKLVGESNESVKAKSKAVVDKTEELSDTEQGISQATISKGETLRELESLAATKGDLHAQCDFLLKNFAARQGARAAELDALAEVKGILGGMK
Ga0314669_1060374713300032708SeawaterKLQDLDAAKKKLEDTIAALKKDISDEQVEMQRASEDRKAENQEFQRIVADQIRTIGALKAAHAKLAEFYFKDSSFLQQKVPTPAQLAAGVEAAPEMQDYENNGNSNKVMGLIQKVMGEAQVTKDNAVSDEQNAADAYVKLVGESNDSIKAKSKAVVDNSEALADTEQSISQATISKGATLRDLETLAASKAELHAQCDFI
Ga0314669_1066225913300032708SeawaterFQRVVADQIRTIGALKAAHAKLAEFYMPDGFLQTAQTPSADAGVAEAPELNKVESNSNSNKVMNLIQKLTGEAQVIKDTATSDEQNAADAYVKLVGESNDSVKAKSRALMDKTEELSDTEQAISQATVSKGETLRELESLAQTKAELHAQCDFLLKNFEARQKARAAELDALAEVKAILGGMK
Ga0314672_120699213300032709SeawaterAKLDSLESELQDLGAKKGKLEATIAALKADIADTKVQMQRASEDRKQENKEFQQIVAGQIQTIGALKAAHAKLAEFYFKDSSFLQQTVPTPAQLAAGVEEAPKLNEVQDNGSSNKVMNLIQKAMSDAQLAKDQATSDEQNASDAYVKLVGESNDSIKAKSKAVVDTSEELADTEQGISQATISKGDTLRELESLAATKGELHSQCDFLLKNFEVRQKARSAELDALAEVKAILGGMK
Ga0314681_1046062213300032711SeawaterLQDLDAAKKKLEDTIAALKKDISDSQVEMQRASEDRKAENQEFQRIVADQIRTIGALKAAHAKLAEFYFKDSSFLQQKVPTPAQLAAGVEAAPEMQDYENNGNSNKVMGLIQKVMGEAQVTKDNAVSDEQNAADAYVKLVGESNDSIKAKSKAVVDNSEALADTEQSISQATISKGATLRDLETLAASKGELHAQCDFILENFTVRQKARLAEMDALAEVKAILGGMK
Ga0314690_1055643313300032713SeawaterTIAALKADIADTKVQMQRASEDRKQENKEFQQIVAGQIQTIGALKAAHAKLAEFYFKDSSFLQQTVPTPAQLAAGVEEAPKLNEVQDNGSSNKVMNLIQKAMSDAQIAKDQATSDEQNASDAYVKLVGESNDSIKAKSKAVVDTSEELADTEQGISQATISKGDTLRELESLAATKGELHSQCDFLLK
Ga0314686_1036150413300032714SeawaterQVDNEKKQAKLDNLEARIQDLGQKKKKLEDTMAALKKDIADTQLQMQRAAEDRKQENKEFQRIVSDQITTIEALKAAHAKLSEFYNKGASLVQSGVKTVATTTVAPSPEFAAYENDGSGNKVMNLIQKLMGEAQVLKDAASKDEQNAQDAYVKLVGESNEGIKEKSKAVTDTIEELADTEQSISQSTIAKDETLRDLESLAATKGELHSQCDFILNNFELRQKARAAEIDAMAEVRGILN
Ga0314693_1031060713300032727SeawaterVTEEKQQAKLNALESKLQDLDAAKKKLEDTIAALKKSISDEQVEMQRASEDRKAENQEFQRIVADQIRTIGALKAAHAKLAEFYFKDSSFLQQKVPTPAQLAAGVEAAPEMQDYENNGNSNKVMGLIQKVMGEAQVTKDNAVSDEQNAADAYVKLVGESNDSIKAKSKAVVDNSEALADTEQSISQATISKGATLRDLETLAASKAELHAQCDFILDNFSVRQKARLAEMDALAEVKAILGGMK
Ga0314693_1071636113300032727SeawaterDTIAALKADILNTQTEMQRASEDRKAENREFQTIVADQIRTIGALKAAHAKLGEFYFKDSFVQEPDFGAAKAAGVEASPQFEAYENNGNSNKVMNMIQKLQGESQVVKDNAVSDEQNAADAYVKLVGESNESVKAKSKAVVDKTEELSDTEQGISQATISKGETLRELESLAATKGDLH
Ga0314696_1031081913300032728SeawaterKLNALESKLQDLDAAKKKLEDTIAALKKDISDQQVEMQRASEDRKAENQEFQRVVADQIRTIGALKAAHAKLAEFYFKDSSFLQQRVPTPAQLAAGVEAAPEMQDYENNGNSNKVMGLIQKVMGEAQVAKDNAVSDEQNAADAYVKLVGESNASIKAKSKAVVDNSEALADTEQSISQATISKGATLRDLETLAASKAELHAQCDFILDNFTVRQKARLAEMDALAEVKAILGGMK
Ga0314699_1031639213300032730SeawaterEVKHKDFCVNELNENKVEEERKQAKLDSLESELQDLGAKKGKLEATIAALKADIADTKVQMQRASEDRKQENKEFQQIVAGQIQTIGALKAAHAKLAEFYFKDSSFLQQTVPTPAQLAAGVEEAPKLNEVQDNGSSNKVMNLIQKAMSDAQIAKDQATSDEQNASDAYVKLVGESNDSIKAKSKAVVDTSEELADTEQGISQATISKGDTLRELESLAATKGELHSQCDFLLK
Ga0314699_1037306813300032730SeawaterAHAKLAEFYFKDSSFLQQRVPTPAQLAAGVEAAPEMQDYENNGNSNKVMGLIQKVMGEAQVAKDNAVSDEQNAADAYVKLVGESNASIKAKSKAVVDNSEALADTEQSISQATISKGATLRDLETLAASKGELHAQCDFILENFTVRQKARLAEMDALAEVKAILGGMK
Ga0314711_1031812313300032732SeawaterDLDAAKKKLEDTIAALKKDISDQQVEMQRASEDRKAENQEFQRVVADQIRTIGALKAAHAKLAEFYFKDSSFLQQRVPTPAQLAAGVEAAPEMQDYENNGNSNKVMGLIQKVMGEAQVAKDNAVSDEQNAADAYVKLVGESNASIKAKSKAVVDNSEALADTEQSISQATISKGATLRDLETLAASKAELHAQCDFILENFSVRQKARLAEMDALAEVKAILGGMK
Ga0314711_1042331413300032732SeawaterEERKQAKLDSLESELQDLGAKKGKLEATIAALKADIADTKVQMQRASEDRKQENEEFQQIVAGQIQTIGALKAAHAKLAEFYFKDSSFLQQTVPTPAQLAAGVEEAPKLNEVQDNGSSNKVMNLIQKAMSDAQIAKDQATSDEQNASDAYVKLVGESNDSIKAKSKAVVDTSEELADTEQGISQATISKGDTLRELESLAATKGELHSQCDFLLKNFEVRQKARSAELD
Ga0314711_1044160613300032732SeawaterTIAALKADILNTQTEMQRASEDRKAENREFQTIVADQIRTIGALKAAHAKLGEFYFKDSFVQEPDFGAAKAAGVEASPQFEAYENNGNSNKVMNMIQKLQGESQVVKDNAVSDEQNAADAYVKLVGESNESVKAKSKAVVDKTEELSDTEQGISQATISKGETLRELESLAATKGDLHAQCDFLLKNFAARQGARAAELDALAEVKGILGGMK
Ga0314714_1047905013300032733SeawaterQRASEDRKAENQEFQRIVADQIRTIGALKAAHAKLAEFYFKDSSFLQQKVPTPAQLAAGVEAAPEMQDYENNGNSNKVMGLIQKVMGEAQVTKDNAVSDEQNAADAYVKLVGESNDSIKAKSKAVVDNSEALADTEQSISQATISKGATLRDLETLAASKAELHAQCDFILENFSVRQKARLAEMDALAEVKAILGGMK
Ga0314714_1070883313300032733SeawaterLKAAHAKLAEFYFKDSSFLQQTVPTPAQLAAGVEEAPKLNEVQDNGSSNKVMNLIQKAMSDAQIAKDQATSDEQNASDAYVKLVGESNDSIKAKSKAVVDTSEELADTEQGISQATISKGDTLRELESLAATKGELHSQCDFLLKNFEVRQKARSAELDALAEVKAILGGMK
Ga0314706_1055837513300032734SeawaterAQLAAGVEAAPEMQDYENNGNSNKVMGLIQKVMGEAQVTKDNAVSDEQNAADAYVKLVGESNDSIKAKSKAVVDNSEALADTEQSISQATISKGATLRDLETLAASKAELHAQCDFILDNFSVRQKARLAEMDALAEVKAILGGMK
Ga0314705_1045772113300032744SeawaterLNTQTEMQRASEDRKAENREFQTIVADQIRTIGALKAAHAKLGEFYFKDSFVQEPDFGAAKAAGVEASPQFEAYENNGNSNKVMNMIQKLQGESQVVKDNAVSDEQNAADAYVKLVGESNESVKAKSKAVVDKTEELSDTEQGISQATISKGETLRELESLAATKGDLHAQCDFLLKNFAARQGARAAELDALAEVKGILGGMK
Ga0314705_1045789113300032744SeawaterRKAENQEFQRVVADQIRTIGALKAAHAKLAEFYFKDSSFLQQRVPTPAQLAAGVEAAPEMQDYENNGNSNKVMGLIQKVMGEAQVAKDNAVSDEQNAADAYVKLVGESNASIKAKSKAVVDNSEALADTEQSISQATISKGATLRDLETLAASKAELHAQCDFILENFSVRQKARLAEMDALAEVKAILGGMK
Ga0314705_1046929313300032744SeawaterAALKKSISDEQVEMQRASEDRKAENQEFQRIVADQIRTIGALKAAHAKLAEFYFKDSSFLQQKVPTPAQLAAGVEAAPEMQDYENNGNSNKVMGLIQKVMGEAQVTKDNAVSDEQNAADAYVKLVGESNDSIKAKSKAVVDNSEALADTEQSISQATISKGATLRDLETLAASKAELHAQCDFILDNFSVRQKARLAEMDALAEVKAILGGMK
Ga0314713_1042404213300032748SeawaterVAGQIQTIGALKAAHAKLAEFYFKDSSFLQQTVPTPAQLAAGVEEAPKLNEVQDNGSSNKVMNLIQKAMSDAQIAKDQATSDEQNASDAYVKLVGESNDSIKAKSKAVVDTSEELADTEQGISQATISKGDTLRELESLAATKGELHSQCDFLLKNFEVRQKARSAELDALAEVKAILGGMK
Ga0314708_1059639013300032750SeawaterAPEMQDYENNGNSNKVMGLIQKVMGEAQVAKDNAVSDEQNAADAYVKLVGESNASIKAKSKAVVDNSEALADTEQSISQATISKGATLRDLETLAASKAELHAQCDFILDNFSVRQKARLAEMDALAEVKAILGGMK
Ga0314700_1045549613300032752SeawaterCVSELHENKADEETKQAKLDSLESQLGDLTSHKKKVEDTIAALKADILNTQTEMQRASEDRKAENREFQTIVADQIRTIGALKAAHAKLGEFYFKDSFVQEPDFGAAKAAGVEASPQFEAYENNGNSNKVMNMIQKLQGESQVVKDNAVSDEQNAADAYVKLVGESNESVKAKSKAVVDKTEELSDTEQGISQATISKGETLRELESLAATKGDLHAQCDFLLKNF
Ga0314709_1044979213300032755SeawaterHKDFCVNELNENKVEEERKQAKLDSLESELQDLGAKKGKLEATIAALKADIADTKVQMQRASEDRKQENKEFQQIVAGQIQTIGALKAAHAKLAEFYFKDSSFLQQTVPTPAQLAAGVEEAPKLNEVQDNGSSNKVMNLIQKAMSDAQIAKDQATSDEQNASDAYVKLVGESNDSIKAKSKAVVDTSEELADTEQGISQATISKGDTLRELESLAATKGELHSQCDFLLKNFEVRQKARSAELDALAEVKAILGGMK
Ga0314709_1090452913300032755SeawaterKMENAEFQRVVADQIQTIDALKAAHEKLGAFYFKNSNLLQDGVQATTTVAPSPEFEDYKSNRNSNKVMTMIQKLTGDAKVIKDNAVNDEQNAVNAYVKLVGESNDSIKAKSRAIVDTTGELAETEQAISQATLDRDETMRDLESLAATKASLHAQCDFLLKNFPLRQQA
Ga0307390_1043930413300033572MarineEKQQAKLNALEQKLEDLDAAKKKLEDSIAALKKDINDEQVQMQRASEDRKAENQEFQRIVADQIRTIGALKAAHAKLAEFYFKDSSFLQQKVPTPAQLAAGVEEAPELNAVESNGNSNKVMGMIQKVMGESQVAKDNAVSDEQNAADAYVKLVGESNASVKAKSKAVVDNSEALADTEQSISQATISKGATLRDLETLAASKGELHAQCDFILENFTVRQKARLAEMDALAEVKAILGGA
Ga0307390_1070131313300033572MarineNTRVQMQRAAEDRKAENLEFQRVVADQIRTIGALKAAHAKLGEFYFKDSLLQTAQTPAADAGVEESPEFADYNNNGNSNKIMNMIQKITGESQVAKDNAVSDEQGAADAYVKLVGESNDSIKAKSKAVVDKTEELATTEQGISQATISKGETLRELESLAATKAELHAQCDFVLENFTTRQKARAAEMDALAEVKAILGGMK
Ga0307390_1070460113300033572MarineGELNDNKVTEEKRQAKLDNLESKIEDLEAKKKTVEETIAALTADIADTRVQIQRASENRKAENHEFQTIVADQIRTIGALKAAHAKLGEFYFKDAFVQEDGQTPATMAAGVEESPEFEDYKSNGNSNKIMNLIQKLTGEAQVVKDNAVSDEQNAADAYVKLVGESNDAVKAKSRAVVDKNEELANTEQAVSQATISKDETLRDLESLAATK
Ga0307390_1081450513300033572MarineDEEKKQAKLDNLEAEIQDLGAKKGKLEDSIAALKHDIADTQTQMQRAAEDRKQENREFQVIVADQIRTIGALKAAHAKLGEFYFKGSFLQKTAQTPAADAGVAEAPEMKAYESNGNSNKVMSLIQKLQGEAEVLKDNAVSDEQNASNAYVKLVGESNDSIKAKGRAVADTTEELADTEQGISQATISKDAALREL
Ga0307390_1089134013300033572MarineEFQTVVADQIRTIGALKAAHAKLGEFYFKDSALAQIPTQAQTTAGVAEDPKFADYENNGNSNKVMLLIQKIQGEAVVIKDKAVSDEQNAADAYVKLVGESNASVKAKSKAVVDKTEELADTEQSISQATISKDETLRELESLAATKAELHAQCDFLLKNFDLRQKARAAELDALAEVRAILGGMK
Ga0307390_1090519913300033572MarineQRASEDRKQANKDFQMVVADQIRTIGALKAAHAKLGEFYFKGSFVQQTPAADAGVKEAPGFADYENNGNSNKVMQMIQKVQGEAELTKDEAVSDEQNAADAYVKLVGESNASVKAKSKAVVDKTEELADTEQAISQATISKGETLRDLESLAATKAELHAQCDFILKNFDARQKARAAEMDALAE


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.