Metagenome Family F031321

Overview

Basic Information

• Family ID: F031321
• Family Type: Metagenome
• Number of Sequences: 182
• Average Sequence Length: 42 residues
• Representative Sequence: MESDLAQTKAKLKEALERVELIHQAVSVDLPCVVEVSLLCF
• Number of Associated Samples: 66
• Number of Associated Scaffolds: 182

Quality Assessment

• Transcriptomic Evidence: No
• Most common taxonomic group: Unclassified
• % of genes with valid RBS motifs: 76.65 %
• % of genes near scaffold ends (potentially truncated): 30.22 %
• % of genes from short scaffolds (< 2000 bps): 91.76 %
• Associated GOLD sequencing projects: 66
• AlphaFold2 3D model prediction: Yes
• 3D model pTM-score: 0.48

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.

Most Common Taxonomy

• Group: Unclassified (96.154 % of family members)
• NCBI Taxonomy ID: N/A
• Taxonomy: N/A

Most Common Ecosystem

• GOLD Ecosystem: Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Miscanthus Phyllosphere (97.253 % of family members)
• Environment Ontology (ENVO): Unclassified (97.253 % of family members)
• Earth Microbiome Project Ontology (EMPO): Host-associated → Plant → Plant surface (97.253 % of family members)

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure

• Classification: Globular
• Signal Peptide: No
• Secondary Structure distribution:
  α-helix: 55.07%
  β-sheet: 0.00%
  Coil/Unstructured: 44.93%

Predicted 3D Structure

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

Gene Neighborhood

Neighboring Pfam domains

Pfam ID	Name	% Frequency in 182 Family Scaffolds
PF03781	FGE-sulfatase	0.55

Neighboring Clusters of Orthologous Genes (COGs)

COG ID	Name	Functional Category	% Frequency in 182 Family Scaffolds
COG1262	Formylglycine-generating enzyme, required for sulfatase activity, contains SUMF1/FGE domain	Posttranslational modification, protein turnover, chaperones [O]	0.55

Phylogeny

NCBI Taxonomy

Level 1

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	96.15 %
All Organisms	root	All Organisms	3.85 %

Level 2

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	96.15 %
cellular organisms	root	All Organisms → cellular organisms	3.85 %

Level 3

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	96.15 %
Eukaryota	superkingdom	All Organisms → cellular organisms → Eukaryota	3.30 %
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	0.55 %

Level 4

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	96.15 %
Viridiplantae	kingdom	All Organisms → cellular organisms → Eukaryota → Viridiplantae	3.30 %
Spirochaetes	phylum	All Organisms → cellular organisms → Bacteria → Spirochaetes	0.55 %

Level 5

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	96.15 %
Streptophyta	phylum	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta	3.30 %
Spirochaetia	class	All Organisms → cellular organisms → Bacteria → Spirochaetes → Spirochaetia	0.55 %

Level 6

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	96.15 %
Streptophytina	subphylum	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina	3.30 %
Spirochaetales	order	All Organisms → cellular organisms → Bacteria → Spirochaetes → Spirochaetia → Spirochaetales	0.55 %

Level 7

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	96.15 %
Embryophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	3.30 %
Treponemataceae	family	All Organisms → cellular organisms → Bacteria → Spirochaetes → Spirochaetia → Spirochaetales → Treponemataceae	0.55 %

Level 8

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	96.15 %
Tracheophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta	2.75 %
Treponema	genus	All Organisms → cellular organisms → Bacteria → Spirochaetes → Spirochaetia → Spirochaetales → Treponemataceae → Treponema	0.55 %

Level 9

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	96.15 %
Euphyllophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta	2.75 %
Treponema primitia	species	All Organisms → cellular organisms → Bacteria → Spirochaetes → Spirochaetia → Spirochaetales → Treponemataceae → Treponema → Treponema primitia	0.55 %

Level 10

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	96.15 %
Spermatophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta	2.75 %
Treponema primitia ZAS-2	strain	All Organisms → cellular organisms → Bacteria → Spirochaetes → Spirochaetia → Spirochaetales → Treponemataceae → Treponema → Treponema primitia → Treponema primitia ZAS-2	0.55 %

Level 11

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	96.15 %
Magnoliopsida	class	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida	2.75 %
Treponema primitia ZAS-2	strain	All Organisms → cellular organisms → Bacteria → Spirochaetes → Spirochaetia → Spirochaetales → Treponemataceae → Treponema → Treponema primitia → Treponema primitia ZAS-2	0.55 %

Level 12

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	96.15 %
Mesangiospermae	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae	2.75 %
Treponema primitia ZAS-2	strain	All Organisms → cellular organisms → Bacteria → Spirochaetes → Spirochaetia → Spirochaetales → Treponemataceae → Treponema → Treponema primitia → Treponema primitia ZAS-2	0.55 %

Level 13

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	96.15 %
Liliopsida	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida	2.75 %
Treponema primitia ZAS-2	strain	All Organisms → cellular organisms → Bacteria → Spirochaetes → Spirochaetia → Spirochaetales → Treponemataceae → Treponema → Treponema primitia → Treponema primitia ZAS-2	0.55 %

Level 14

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	96.15 %
Petrosaviidae	subclass	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae	2.75 %
Treponema primitia ZAS-2	strain	All Organisms → cellular organisms → Bacteria → Spirochaetes → Spirochaetia → Spirochaetales → Treponemataceae → Treponema → Treponema primitia → Treponema primitia ZAS-2	0.55 %

Level 15

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	96.15 %
commelinids	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids	2.75 %
Treponema primitia ZAS-2	strain	All Organisms → cellular organisms → Bacteria → Spirochaetes → Spirochaetia → Spirochaetales → Treponemataceae → Treponema → Treponema primitia → Treponema primitia ZAS-2	0.55 %

Level 16

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	96.15 %
Poales	order	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales	2.75 %
Treponema primitia ZAS-2	strain	All Organisms → cellular organisms → Bacteria → Spirochaetes → Spirochaetia → Spirochaetales → Treponemataceae → Treponema → Treponema primitia → Treponema primitia ZAS-2	0.55 %

Level 17

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	96.15 %
Poaceae	family	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	2.75 %
Treponema primitia ZAS-2	strain	All Organisms → cellular organisms → Bacteria → Spirochaetes → Spirochaetia → Spirochaetales → Treponemataceae → Treponema → Treponema primitia → Treponema primitia ZAS-2	0.55 %

Level 18

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	96.15 %
PACMAD clade	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade	2.75 %
Treponema primitia ZAS-2	strain	All Organisms → cellular organisms → Bacteria → Spirochaetes → Spirochaetia → Spirochaetales → Treponemataceae → Treponema → Treponema primitia → Treponema primitia ZAS-2	0.55 %

Level 19

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	96.15 %
Panicoideae	subfamily	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae	2.75 %
Treponema primitia ZAS-2	strain	All Organisms → cellular organisms → Bacteria → Spirochaetes → Spirochaetia → Spirochaetales → Treponemataceae → Treponema → Treponema primitia → Treponema primitia ZAS-2	0.55 %

Level 20

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	96.15 %
Panicodae	no rank	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae	2.75 %
Treponema primitia ZAS-2	strain	All Organisms → cellular organisms → Bacteria → Spirochaetes → Spirochaetia → Spirochaetales → Treponemataceae → Treponema → Treponema primitia → Treponema primitia ZAS-2	0.55 %

Level 21

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	96.15 %
Paniceae	tribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae	2.75 %
Treponema primitia ZAS-2	strain	All Organisms → cellular organisms → Bacteria → Spirochaetes → Spirochaetia → Spirochaetales → Treponemataceae → Treponema → Treponema primitia → Treponema primitia ZAS-2	0.55 %

Level 22

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	96.15 %
Cenchrinae	subtribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Cenchrinae	2.75 %
Treponema primitia ZAS-2	strain	All Organisms → cellular organisms → Bacteria → Spirochaetes → Spirochaetia → Spirochaetales → Treponemataceae → Treponema → Treponema primitia → Treponema primitia ZAS-2	0.55 %

Level 23

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	96.15 %
Setaria	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Cenchrinae → Setaria	2.75 %
Treponema primitia ZAS-2	strain	All Organisms → cellular organisms → Bacteria → Spirochaetes → Spirochaetia → Spirochaetales → Treponemataceae → Treponema → Treponema primitia → Treponema primitia ZAS-2	0.55 %

Level 24

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	96.15 %
Setaria viridis	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Cenchrinae → Setaria → Setaria viridis	2.75 %
Treponema primitia ZAS-2	strain	All Organisms → cellular organisms → Bacteria → Spirochaetes → Spirochaetia → Spirochaetales → Treponemataceae → Treponema → Treponema primitia → Treponema primitia ZAS-2	0.55 %

Associated Scaffolds

Scaffold	Taxonomy	Length
3300005338|Ga0068868_101760714	Not Available	585
3300011119|Ga0105246_12330757	Not Available	524
3300015267|Ga0182122_1053363	Not Available	549
3300015268|Ga0182154_1051670	Not Available	557
3300015274|Ga0182188_1061984	Not Available	503
3300015275|Ga0182172_1051508	Not Available	567
3300015275|Ga0182172_1073854	Not Available	508
3300015277|Ga0182128_1010507	Not Available	880
3300015277|Ga0182128_1054043	Not Available	564
3300015279|Ga0182174_1046958	Not Available	603
3300015281|Ga0182160_1007002	Not Available	1000
3300015281|Ga0182160_1085231	Not Available	500
3300015283|Ga0182156_1076231	Not Available	525
3300015285|Ga0182186_1017196	Not Available	790
3300015285|Ga0182186_1051194	Not Available	581
3300015286|Ga0182176_1045881	Not Available	613
3300015286|Ga0182176_1059623	Not Available	565
3300015287|Ga0182171_1030053	Not Available	687
3300015287|Ga0182171_1079511	Not Available	519
3300015288|Ga0182173_1065001	Not Available	548
3300015289|Ga0182138_1038055	Not Available	646
3300015291|Ga0182125_1040399	Not Available	646
3300015291|Ga0182125_1067099	Not Available	558
3300015291|Ga0182125_1075022	Not Available	540
3300015292|Ga0182141_1044442	Not Available	628
3300015295|Ga0182175_1059729	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Cenchrinae → Setaria → Setaria viridis	586
3300015295|Ga0182175_1074885	Not Available	548
3300015296|Ga0182157_1101791	Not Available	504
3300015299|Ga0182107_1039648	Not Available	673
3300015299|Ga0182107_1094507	Not Available	519
3300015302|Ga0182143_1021165	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Cenchrinae → Setaria → Setaria viridis	801
3300015302|Ga0182143_1064283	Not Available	584
3300015302|Ga0182143_1093445	Not Available	520
3300015303|Ga0182123_1017458	Not Available	817
3300015303|Ga0182123_1035670	Not Available	674
3300015303|Ga0182123_1042237	Not Available	643
3300015303|Ga0182123_1086026	Not Available	524
3300015304|Ga0182112_1037749	Not Available	683
3300015304|Ga0182112_1073720	Not Available	563
3300015304|Ga0182112_1081255	Not Available	546
3300015305|Ga0182158_1062176	Not Available	590
3300015305|Ga0182158_1072666	Not Available	562
3300015305|Ga0182158_1075181	Not Available	557
3300015305|Ga0182158_1094875	Not Available	518
3300015307|Ga0182144_1016255	Not Available	877
3300015307|Ga0182144_1065982	Not Available	587
3300015314|Ga0182140_1040807	Not Available	691
3300015321|Ga0182127_1031162	Not Available	769
3300015321|Ga0182127_1066247	Not Available	615
3300015321|Ga0182127_1072097	Not Available	599
3300015322|Ga0182110_1024026	Not Available	825
3300015323|Ga0182129_1025274	Not Available	790
3300015323|Ga0182129_1117418	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Cenchrinae → Setaria → Setaria viridis	500
3300015341|Ga0182187_1147229	Not Available	563
3300015341|Ga0182187_1185495	Not Available	517
3300015342|Ga0182109_1073705	Not Available	758
3300015342|Ga0182109_1112202	Not Available	652
3300015342|Ga0182109_1145942	Not Available	592
3300015342|Ga0182109_1191089	Not Available	534
3300015342|Ga0182109_1192867	Not Available	532
3300015343|Ga0182155_1015244	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	1243
3300015343|Ga0182155_1077200	Not Available	740
3300015343|Ga0182155_1077812	Not Available	738
3300015343|Ga0182155_1135350	Not Available	607
3300015343|Ga0182155_1164739	Not Available	565
3300015343|Ga0182155_1178677	Not Available	548
3300015343|Ga0182155_1206631	Not Available	519
3300015344|Ga0182189_1060347	Not Available	819
3300015344|Ga0182189_1061789	Not Available	813
3300015344|Ga0182189_1084748	Not Available	727
3300015344|Ga0182189_1095057	Not Available	698
3300015344|Ga0182189_1148642	Not Available	593
3300015344|Ga0182189_1167659	Not Available	567
3300015344|Ga0182189_1183168	Not Available	548
3300015345|Ga0182111_1161391	Not Available	592
3300015345|Ga0182111_1190732	Not Available	554
3300015345|Ga0182111_1223311	Not Available	521
3300015346|Ga0182139_1040340	Not Available	981
3300015346|Ga0182139_1064922	Not Available	830
3300015346|Ga0182139_1086492	Not Available	748
3300015346|Ga0182139_1135086	Not Available	634
3300015346|Ga0182139_1183291	Not Available	564
3300015346|Ga0182139_1204700	Not Available	540
3300015346|Ga0182139_1233729	Not Available	512
3300015347|Ga0182177_1195221	Not Available	553
3300015347|Ga0182177_1199284	Not Available	548
3300015351|Ga0182161_1088665	Not Available	775
3300015351|Ga0182161_1265961	Not Available	503
3300015355|Ga0182159_1106292	Not Available	837
3300015355|Ga0182159_1132727	Not Available	764
3300015355|Ga0182159_1154754	Not Available	717
3300015355|Ga0182159_1221624	Not Available	615
3300015355|Ga0182159_1228847	Not Available	607
3300015355|Ga0182159_1338919	Not Available	510
3300015361|Ga0182145_1062828	Not Available	733
3300015361|Ga0182145_1074351	Not Available	694
3300015361|Ga0182145_1138268	Not Available	564
3300017404|Ga0182203_1017366	Not Available	1008
3300017404|Ga0182203_1100530	Not Available	591
3300017404|Ga0182203_1125193	Not Available	550
3300017404|Ga0182203_1136356	Not Available	535
3300017407|Ga0182220_1018408	Not Available	815
3300017407|Ga0182220_1105223	Not Available	507
3300017409|Ga0182204_1027539	Not Available	779
3300017409|Ga0182204_1109552	Not Available	516
3300017409|Ga0182204_1114782	Not Available	509
3300017410|Ga0182207_1101947	Not Available	606
3300017410|Ga0182207_1125468	Not Available	565
3300017410|Ga0182207_1156641	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Cenchrinae → Setaria → Setaria viridis	523
3300017410|Ga0182207_1166283	Not Available	512
3300017411|Ga0182208_1024981	Not Available	826
3300017411|Ga0182208_1044232	Not Available	699
3300017411|Ga0182208_1055064	Not Available	656
3300017413|Ga0182222_1046194	Not Available	628
3300017415|Ga0182202_1111501	Not Available	541
3300017415|Ga0182202_1113562	Not Available	538
3300017415|Ga0182202_1122858	Not Available	524
3300017417|Ga0182230_1117482	Not Available	500
3300017420|Ga0182228_1054649	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Cenchrinae → Setaria → Setaria viridis	690
3300017420|Ga0182228_1071695	Not Available	623
3300017424|Ga0182219_1065991	Not Available	636
3300017424|Ga0182219_1116337	Not Available	533
3300017425|Ga0182224_1015756	Not Available	1032
3300017425|Ga0182224_1059499	Not Available	696
3300017425|Ga0182224_1118009	Not Available	562
3300017425|Ga0182224_1139663	Not Available	532
3300017425|Ga0182224_1165487	Not Available	502
3300017427|Ga0182190_1053916	Not Available	735
3300017427|Ga0182190_1065662	Not Available	688
3300017427|Ga0182190_1090420	Not Available	619
3300017430|Ga0182192_1149489	Not Available	529
3300017436|Ga0182209_1071882	Not Available	668
3300017436|Ga0182209_1085796	Not Available	632
3300017436|Ga0182209_1089358	Not Available	624
3300017436|Ga0182209_1095105	Not Available	612
3300017438|Ga0182191_1007698	Not Available	1370
3300017442|Ga0182221_1040158	Not Available	783
3300017442|Ga0182221_1054989	Not Available	713
3300017442|Ga0182221_1068590	Not Available	667
3300017442|Ga0182221_1082405	Not Available	631
3300017442|Ga0182221_1142562	Not Available	532
3300017442|Ga0182221_1161091	Not Available	511
3300017443|Ga0182193_1038255	Not Available	866
3300017443|Ga0182193_1052096	Not Available	786
3300017443|Ga0182193_1069678	Not Available	717
3300017443|Ga0182193_1095697	Not Available	645
3300017443|Ga0182193_1157686	Not Available	544
3300017680|Ga0182233_1109922	Not Available	514
3300017682|Ga0182229_1088164	Not Available	543
3300017683|Ga0182218_1041337	Not Available	749
3300017683|Ga0182218_1064857	Not Available	656
3300017683|Ga0182218_1080784	Not Available	614
3300017683|Ga0182218_1114288	Not Available	552
3300017684|Ga0182225_1029772	Not Available	820
3300017684|Ga0182225_1091574	Not Available	580
3300017684|Ga0182225_1123321	Not Available	529
3300017684|Ga0182225_1140027	Not Available	507
3300017685|Ga0182227_1102494	Not Available	559
3300017690|Ga0182223_1013367	Not Available	919
3300017690|Ga0182223_1015909	Not Available	878
3300017690|Ga0182223_1058297	Not Available	621
3300017690|Ga0182223_1070403	Not Available	589
3300017690|Ga0182223_1074514	Not Available	580
3300017690|Ga0182223_1112986	Not Available	516
3300025899|Ga0207642_10686504	Not Available	644
3300025908|Ga0207643_10589068	All Organisms → cellular organisms → Bacteria → Spirochaetes → Spirochaetia → Spirochaetales → Treponemataceae → Treponema → Treponema primitia → Treponema primitia ZAS-2	715
3300025938|Ga0207704_11781559	Not Available	529

Environmental Properties

Associated Habitat Types

Ecosystem

Habitat	Taxonomy	Distribution
Host-Associated	Host-Associated	100.00%

Class

Habitat	Taxonomy	Distribution
Plants	Host-Associated → Plants	100.00%

Category

Habitat	Taxonomy	Distribution
Phyllosphere	Host-Associated → Plants → Phyllosphere	97.25%
Rhizoplane	Host-Associated → Plants → Rhizoplane	2.20%
Rhizosphere	Host-Associated → Plants → Rhizosphere	0.55%

Type

Habitat	Taxonomy	Distribution
Unclassified	Host-Associated → Plants → Phyllosphere → Unclassified	97.25%
Epiphytes	Host-Associated → Plants → Rhizoplane → Epiphytes	2.20%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified	0.55%

Subtype

Habitat	Taxonomy	Distribution
Unclassified	Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified	97.25%
Unclassified	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified	2.20%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified	0.55%

Habitat

Habitat	Taxonomy	Distribution
Miscanthus Phyllosphere	Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Miscanthus Phyllosphere	97.25%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere	2.20%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	0.55%

Associated Samples

Taxon OID	Sample Name	Habitat Type
3300005338	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2	Host-Associated
3300011119	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG	Host-Associated
3300015267	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_31MAY2016_LD1 MG	Host-Associated
3300015268	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_12JUL2016_LD1 MG	Host-Associated
3300015274	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_22AUG2016_LD1 MG	Host-Associated
3300015275	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_01AUG2016_LD1 MG	Host-Associated
3300015277	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_31MAY2016_LD1 MG	Host-Associated
3300015279	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_01AUG2016_LD1 MG	Host-Associated
3300015281	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_12JUL2016_LD1 MG	Host-Associated
3300015283	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_12JUL2016_LD1 MG	Host-Associated
3300015285	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_22AUG2016_LD1 MG	Host-Associated
3300015286	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_01AUG2016_LD1 MG	Host-Associated
3300015287	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_01AUG2016_LD1 MG	Host-Associated
3300015288	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_01AUG2016_LD1 MG	Host-Associated
3300015289	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_20JUN2016_LD1 MG	Host-Associated
3300015291	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_31MAY2016_LD1 MG	Host-Associated
3300015292	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_20JUN2016_LD1 MG	Host-Associated
3300015295	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_01AUG2016_LD1 MG	Host-Associated
3300015296	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_12JUL2016_LD1 MG	Host-Associated
3300015299	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_09MAY2016_LD1 MG	Host-Associated
3300015300	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_09MAY2016_LD1 MG	Host-Associated
3300015302	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_20JUN2016_LD1 MG	Host-Associated
3300015303	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_31MAY2016_LD1 MG	Host-Associated
3300015304	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_09MAY2016_LD1 MG	Host-Associated
3300015305	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_12JUL2016_LD1 MG	Host-Associated
3300015307	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_20JUN2016_LD1 MG	Host-Associated
3300015314	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_20JUN2016_LD1 MG	Host-Associated
3300015321	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_31MAY2016_LD1 MG	Host-Associated
3300015322	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_09MAY2016_LD1 MG	Host-Associated
3300015323	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_31MAY2016_LD1 MG	Host-Associated
3300015341	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_22AUG2016_LD1 MG	Host-Associated
3300015342	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_09MAY2016_LD1 MG	Host-Associated
3300015343	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_12JUL2016_LD1 MG	Host-Associated
3300015344	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_22AUG2016_LD1 MG	Host-Associated
3300015345	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_09MAY2016_LD1 MG	Host-Associated
3300015346	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_20JUN2016_LD1 MG	Host-Associated
3300015347	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_01AUG2016_LD1 MG	Host-Associated
3300015351	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_12JUL2016_LD1 MG	Host-Associated
3300015355	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_12JUL2016_LD1 MG	Host-Associated
3300015361	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_20JUN2016_LD1 MG	Host-Associated
3300017404	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_12SEP2016_LD1 MG	Host-Associated
3300017407	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_03OCT2016_LD1 MG	Host-Associated
3300017409	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_12SEP2016_LD1 MG	Host-Associated
3300017410	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_12SEP2016_LD1 MG	Host-Associated
3300017411	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_12SEP2016_LD1 MG	Host-Associated
3300017413	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_03OCT2016_LD1 MG	Host-Associated
3300017415	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_12SEP2016_LD1 MG	Host-Associated
3300017417	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_07NOV2016_LD1 MG	Host-Associated
3300017420	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_07NOV2016_LD1 MG	Host-Associated
3300017424	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_03OCT2016_LD1 MG	Host-Associated
3300017425	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_03OCT2016_LD1 MG	Host-Associated
3300017427	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_22AUG2016_LD1 MG	Host-Associated
3300017430	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_22AUG2016_LD1 MG	Host-Associated
3300017436	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_12SEP2016_LD1 MG	Host-Associated
3300017438	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_22AUG2016_LD1 MG	Host-Associated
3300017442	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_03OCT2016_LD1 MG	Host-Associated
3300017443	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_22AUG2016_LD1 MG	Host-Associated
3300017680	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_07NOV2016_LD1 MG	Host-Associated
3300017682	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_07NOV2016_LD1 MG	Host-Associated
3300017683	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_03OCT2016_LD1 MG	Host-Associated
3300017684	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_03OCT2016_LD1 MG	Host-Associated
3300017685	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_07NOV2016_LD1 MG	Host-Associated
3300017690	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_03OCT2016_LD1 MG	Host-Associated
3300025899	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes)	Host-Associated
3300025908	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes)	Host-Associated
3300025938	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes)	Host-Associated

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
Ga0068868_1017607141	3300005338	Miscanthus Rhizosphere	MESDLALTKVRLKEALERVELIHQAMIVDLLCIVEVSFLHSWCCL*
Ga0105246_123307572	3300011119	Miscanthus Rhizosphere	MESDLAQTKAKLKEALERVELIHQVVSVDLPCLAEVSFLHF*
Ga0182122_10533632	3300015267	Miscanthus Phyllosphere	MESDLALTKAKLKEALERVELVYQAVTVDLPRIAEVSFLRSWCCL*
Ga0182154_10516702	3300015268	Miscanthus Phyllosphere	MESNLAQTKSMLEEALERVESIHQVIMVDLPRIIEVSFLCLSLTP*
Ga0182188_10619841	3300015274	Miscanthus Phyllosphere	MESDLAQTKARLEVALERVELIHQAVSVDLLHVAEVSLLCF*
Ga0182172_10515081	3300015275	Miscanthus Phyllosphere	MESDLAQTRARLEGALEQVKVVHQAVMVDLPHVTEV
Ga0182172_10738542	3300015275	Miscanthus Phyllosphere	MESDLALTKARLKEALERVELIHPTMTIDLLGITGVSSLCFWCCP*
Ga0182128_10105073	3300015277	Miscanthus Phyllosphere	LAQAKVKLREALERVELAHREVSVDLSRVTEVSLLCF*
Ga0182128_10540432	3300015277	Miscanthus Phyllosphere	MMEFDLAQTKARLKEALERVESIHQVVTVDLPCVAEVSCLHF*
Ga0182174_10469581	3300015279	Miscanthus Phyllosphere	MLSDLTQAKARLKEALEQVELILQAVIVDLPCIVEVSSLHL*
Ga0182174_10498921	3300015279	Miscanthus Phyllosphere	MESDLAQTRARLEEVLERVKSFHQTVTVDLPRVAEVSPL*
Ga0182160_10070022	3300015281	Miscanthus Phyllosphere	MESDLAQARERLKEALERVKSVHQAIMVDLPRIIEVSFLCF*
Ga0182160_10852312	3300015281	Miscanthus Phyllosphere	LLEERGLSMEFDLAQTKARLKEALERVELIHQVVLVDLPRVAEVSFLCF*
Ga0182156_10762312	3300015283	Miscanthus Phyllosphere	MESNLALTKARLKEALERVELIHQAMSIDLPCIAEVSFLRS*
Ga0182186_10171961	3300015285	Miscanthus Phyllosphere	MEFDLALTKANLKEALVRVELVHQAMIVDLPHVAEVSFLRSWCCL*
Ga0182186_10511942	3300015285	Miscanthus Phyllosphere	MESDLAQTKAKLKEALEQVELVHQVVSVDLPCIIEVSFLCFSICP*
Ga0182176_10458811	3300015286	Miscanthus Phyllosphere	MESDLAQTKAKLKEALEQVELIHQAVSVDLPCVTKVSLLLF*
Ga0182176_10596232	3300015286	Miscanthus Phyllosphere	MESDLAQTKARLKEALERVEFVHQAVMVDLPHVIKVSFLCF*
Ga0182171_10300531	3300015287	Miscanthus Phyllosphere	MESDLTLTKARLKEALEMVELVHQVITVDLPCIVEVSFVHSWCCF*
Ga0182171_10795112	3300015287	Miscanthus Phyllosphere	MESNLAQTKARLKEALERVELIHQAVSVDLPCVAEVSSLCF*
Ga0182173_10650012	3300015288	Miscanthus Phyllosphere	GGRGLAMESDLAQTKARLKEALERVESIHQAVMIDLPRIAEVSFLCF*
Ga0182138_10380551	3300015289	Miscanthus Phyllosphere	QTKVKLKEAMERVELIHQVVSIDLSCITEVSLLCF*
Ga0182125_10403992	3300015291	Miscanthus Phyllosphere	LLEERGLSMESDLAQTKARLKEALEQVELIHQVVSVDLPCVAEVSFLRF*
Ga0182125_10670991	3300015291	Miscanthus Phyllosphere	MMEYDLAQTKARLKEALERVESVHQAVTVDFPRVTEVSFQRF*
Ga0182125_10750221	3300015291	Miscanthus Phyllosphere	MESDLAQTRVKLEEALERVKSVERVVTVDLNRTVEVSFCICP*
Ga0182141_10444423	3300015292	Miscanthus Phyllosphere	LLMESDLAQTKVMLREALERVELVHQVVSVDLPCIAKVSLLCF*
Ga0182175_10572991	3300015295	Miscanthus Phyllosphere	HFLEERGLSMESDLAQTKEKLREALEWVELIHQAVSVNLPCITEVSLLCF*
Ga0182175_10597292	3300015295	Miscanthus Phyllosphere	MESDLALTKARLKEALERVELIHQAMIVDLPHIAEVSSLRFCCYP*
Ga0182175_10748851	3300015295	Miscanthus Phyllosphere	MESDLAQTKVRLKEALEWVELVHQAVLVDLPRVVKVSFLRF*
Ga0182175_10947112	3300015295	Miscanthus Phyllosphere	MESDLAQTRVKLEEALEWVKVIHQAVMVDLPHVIEVSFL
Ga0182157_10986212	3300015296	Miscanthus Phyllosphere	MESDLAQTRTRLEEVLERVKSFYQMVTVDLTHIIEVSPL*
Ga0182157_11017912	3300015296	Miscanthus Phyllosphere	MESDLAQTKARLMEALERIESVHQAVTVDLPRIAEVSFLCF*
Ga0182107_10396482	3300015299	Miscanthus Phyllosphere	MESDLAQTKVKLREALERVELAYQAVSIDLLRIAEVSLLCF*
Ga0182107_10945071	3300015299	Miscanthus Phyllosphere	LLEERGLSMESDLAQTKARLKEALERVELIHQAVSVDLPCVVEVSFLHF*
Ga0182108_10260612	3300015300	Miscanthus Phyllosphere	LLEERGLSMESGLAQTKARLKEALERVELVHQAVTADPPHVVEVSFLCF*
Ga0182143_10211652	3300015302	Miscanthus Phyllosphere	MESDLALTMARLKEALERGELVHQAMTMDLPHLAEVSFLHSWCCL*
Ga0182143_10642831	3300015302	Miscanthus Phyllosphere	DLTQTKARLKAALERVESIHQVVTVDLPHIIEVSFLCI*
Ga0182143_10934451	3300015302	Miscanthus Phyllosphere	MMEFDLAQTKARLKEALEWVELIHYEVLVDLPCVAEVSFLHF*
Ga0182123_10174581	3300015303	Miscanthus Phyllosphere	MESDLAQTKAKLKEALERVELVHQAVSVGLPHVTKVSLLCF*
Ga0182123_10356701	3300015303	Miscanthus Phyllosphere	MESDLSQTKAKLKEALERVELIHQAVSVDLPCVAKVSFLRF*
Ga0182123_10422371	3300015303	Miscanthus Phyllosphere	MMESDLPQTKARLKEAMEQVESIHQAVTVDLPHVANVSFLCFSVRP*
Ga0182123_10860261	3300015303	Miscanthus Phyllosphere	MESDLALTKVRLKEALERVELVHQAMIVDLPRVAEVSSLCFWCCP*
Ga0182112_10377493	3300015304	Miscanthus Phyllosphere	MESDLAQTKAKLKEALERVELVHQAVSVNLPRITE
Ga0182112_10462082	3300015304	Miscanthus Phyllosphere	MESDLAQTKVRLEEALEWVKSVHRTVTVDLPYVAEVSSL*
Ga0182112_10737201	3300015304	Miscanthus Phyllosphere	LTMESNLAQTKARLKEALERVESVHQAVRVDLPHIVEVSFLHF*
Ga0182112_10812551	3300015304	Miscanthus Phyllosphere	LLMESNLAQTKGMLKEALERVELIHQAVLVDLRHIAEVSFLCF*
Ga0182158_10621761	3300015305	Miscanthus Phyllosphere	LSMESDLTQTKAKLKEAFEWVELVHQAVSVDTPHVIEVGFLHF*
Ga0182158_10726662	3300015305	Miscanthus Phyllosphere	MESDLALTKAKLKEALEKVELIHQAMTVDLPCIAEVSFLRSW
Ga0182158_10751812	3300015305	Miscanthus Phyllosphere	MESDLAQTKAKLKEALERVELVHWAISFDLSCVAEVILLLF*
Ga0182158_10948751	3300015305	Miscanthus Phyllosphere	MESDLALTKTRLKEALERVELIHQAMTVDLPHIVEVSSLCFLCCP*
Ga0182144_10162553	3300015307	Miscanthus Phyllosphere	MESDLTFTKARLKEALERVELIHQAMTVDLLCVVEVSSLRFWCYT*
Ga0182144_10659821	3300015307	Miscanthus Phyllosphere	MESNLALTKARLKEALERVELIHQAMTVDLPRIAGVSS
Ga0182140_10408071	3300015314	Miscanthus Phyllosphere	MESDLTQTKAKLKEALERVELVHQVVSVDLSHVAEACLLFF*
Ga0182127_10311622	3300015321	Miscanthus Phyllosphere	LLEERGLSMEFDLAQTKASLKEALERVELIHLVVSVDLPCIAEVSFLCF*
Ga0182127_10662472	3300015321	Miscanthus Phyllosphere	LEERGLSMESDLAQTKAKLKEALEQVDLIHQVVSVDLPHITEVSFLCF*
Ga0182127_10720971	3300015321	Miscanthus Phyllosphere	MESDLAITKARLKEALERVEFIHQAMTVDLPRIAEVSFVCS*
Ga0182110_10240261	3300015322	Miscanthus Phyllosphere	MESDLAQTKVRLKEALEWVELIHQAVSVDLPRIAEVSSLCF*
Ga0182110_10661632	3300015322	Miscanthus Phyllosphere	TKARLKEALERVEVLHHAMIVDLPRIAEVSSLCFWCCP*
Ga0182129_10252742	3300015323	Miscanthus Phyllosphere	MESDLAQTKAKLKEALERVELIHQAVLVDLLRIIEVSLLCF*
Ga0182129_11174181	3300015323	Miscanthus Phyllosphere	MESDLTETKAKLKEALEQVELIHQEVSVDLPHVIEVSLLCF*
Ga0182187_11472291	3300015341	Miscanthus Phyllosphere	MEADLAQTKAKLREALERVELVHQVVSVDLLHVAEVSLLCF*
Ga0182187_11854951	3300015341	Miscanthus Phyllosphere	MESDLAQTKARLKEALERVELIHQAVIADLPCVAEVSFLCF*
Ga0182109_10737051	3300015342	Miscanthus Phyllosphere	MESDLAQTRARLEEALERVESVDQAVTVDLPHVTEAS
Ga0182109_11122023	3300015342	Miscanthus Phyllosphere	WHFLEERGLSMESDLAQTKVRLKEALERVELIYQVVSVDLPRVVEVSLLCF*
Ga0182109_11459422	3300015342	Miscanthus Phyllosphere	MESDLTLTKARLKDALERVELIHQAMIVDLPCIVEVSSLCFWCCPSL
Ga0182109_11910892	3300015342	Miscanthus Phyllosphere	MESDLAQTKAKLKEALEGVELVHQAVSVNLPCIAEVSFLHF*
Ga0182109_11928671	3300015342	Miscanthus Phyllosphere	GLSMESDHAQTKAKIKEALERVELIHQAVSLDLSRIAKVSLLCF*
Ga0182155_10152441	3300015343	Miscanthus Phyllosphere	MESDLALTKAKLKEALERVELVHQAMTVDLPHVAEVSFLRS*
Ga0182155_10772002	3300015343	Miscanthus Phyllosphere	MESDLALTKARLMEALETVELIHQAMTVDLPCVAEVSFLCSWCCL*
Ga0182155_10778121	3300015343	Miscanthus Phyllosphere	MESDLALTKARLKEALERVELIHQAMTVERPHVAKVSLVRS*
Ga0182155_11353501	3300015343	Miscanthus Phyllosphere	EIGSSMESDLAQTKAKLREALEWVELIHQVVLVDLLHVTKVSLLCS*
Ga0182155_11647391	3300015343	Miscanthus Phyllosphere	MESDLAQTKARLKEALERVESIHQAVMIDLPRIAEVSFLCF*
Ga0182155_11786771	3300015343	Miscanthus Phyllosphere	TKARLKETLKRVELIHQAMTVDLTCIAEVSSLRSWCCL*
Ga0182155_12066313	3300015343	Miscanthus Phyllosphere	ESDLTQTKARLKEALERVKLIHQVVSVDLPHIVLVSFLHF*
Ga0182189_10603471	3300015344	Miscanthus Phyllosphere	MESDLAQTKARLKEALERVESVHQAVMVDLPHVAEVSFLCF*
Ga0182189_10617892	3300015344	Miscanthus Phyllosphere	MESDLAQTKAKLKEALEQVELSHQAISVDLPHVTEVSLLCF*
Ga0182189_10847482	3300015344	Miscanthus Phyllosphere	MESDLAQTKARLKEALERVEFVHQAVTVDLPHIAEVSFLDF*
Ga0182189_10950571	3300015344	Miscanthus Phyllosphere	MESDLAQTKVRLKEALERVELVHQVVTADLQCIVEVSFLCFSCP*
Ga0182189_11486422	3300015344	Miscanthus Phyllosphere	MESDLAQTKARLKEALERVEFVHQAIMVDLPHVIKVSFLCF*
Ga0182189_11676592	3300015344	Miscanthus Phyllosphere	FLEERGLSMESDLTQTKAKLKEAMERVKLIHQGVSVDLPCIIEVSLLCF*
Ga0182189_11831682	3300015344	Miscanthus Phyllosphere	MESDLALTKTRLKEALERVELIHQAMNVDLPRVAEVSFLHS*
Ga0182111_11613911	3300015345	Miscanthus Phyllosphere	MESDLTQTKAKLKEALEWVELVHQAVSVDLPCIAEVSLLCF*
Ga0182111_11907321	3300015345	Miscanthus Phyllosphere	MESDLAQTKARLKEALERVELVHQMVLVDLSCVAEVSFLHF*
Ga0182111_12233111	3300015345	Miscanthus Phyllosphere	MESDLALTKAKLKEALERVELVHQAMTVDLPRIAEVSFLHSWCCL*
Ga0182139_10403402	3300015346	Miscanthus Phyllosphere	MESDLALTKARLKEALERVELVHQAVTVDLPHVAEVSSLHFWCYP*
Ga0182139_10649222	3300015346	Miscanthus Phyllosphere	MESDLALTKVRLKEALERVELIHQAMTVDLPHVAEVSFLRSWCCL*
Ga0182139_10864924	3300015346	Miscanthus Phyllosphere	MESNLTQTKVKLREALERVELAHQAVLVDLPCIAEVSLLWF*
Ga0182139_11350861	3300015346	Miscanthus Phyllosphere	MESGLAQTKVKLREALERVELTHQVVSVDLPRVAEVSLLCF*
Ga0182139_11832911	3300015346	Miscanthus Phyllosphere	MVSDLTHTKARLKEALERVELIHQAMIVDLPRIVEVSSLCF*
Ga0182139_12047001	3300015346	Miscanthus Phyllosphere	ERGLSMESDLAQTKVRLKEALEQVELVHQAVTVDLPHMVEVSSICF*
Ga0182139_12337291	3300015346	Miscanthus Phyllosphere	DLALTKARLKEALERVELIHQAMNVDLPRVAEVSFLHS*
Ga0182177_11952212	3300015347	Miscanthus Phyllosphere	MESDLTLTKVKLKEALERVELVHHAMTIDLPCIIEVSFL
Ga0182177_11992842	3300015347	Miscanthus Phyllosphere	ERGLSMESNLAQTKAKHKEAMEQVDLVHQAVSVDLPRVAEVSLLCF*
Ga0182161_10886653	3300015351	Miscanthus Phyllosphere	MESDLAQTKVKLREALERVELAHQAVLVDLPCIAEVSLLWF*
Ga0182161_11085901	3300015351	Miscanthus Phyllosphere	SDLTLTKARLKEALEKVELIHQAMTVNLPCIIEVRSLCFWCCP*
Ga0182161_12659612	3300015351	Miscanthus Phyllosphere	SMESDVALTKAKLKEALERVGLVHQAMTIDLPCIVEVIFLCSWCCL*
Ga0182159_11062922	3300015355	Miscanthus Phyllosphere	LLEERGLSMESDLAQTKARLKEAFKWVELIHQVVSVDLPRVAEVSFLCF*
Ga0182159_11327273	3300015355	Miscanthus Phyllosphere	MDSDLVQTKVRLMEALEQVELIHQVVSVDLRHITEVSLLCF*
Ga0182159_11547543	3300015355	Miscanthus Phyllosphere	VLSMESDLAQTKVRLKEALERVELAYQAVSIDLSCIAAVSFLCF*
Ga0182159_12216241	3300015355	Miscanthus Phyllosphere	LEERGLSMESDLAQTKARLKEALEQVELIHQVVSVDLPCVAEVSLLCF*
Ga0182159_12288471	3300015355	Miscanthus Phyllosphere	LAQTKARLKEALGRVELIHQAVIANLPCVVEVSFLCF*
Ga0182159_13389191	3300015355	Miscanthus Phyllosphere	QTKARLKEALERIELVHQVVTADLPRITEVSFLHF*
Ga0182145_10628281	3300015361	Miscanthus Phyllosphere	MESDLALTKARIKEALGRVELIHQAMIVDLPYIVEVS
Ga0182145_10743511	3300015361	Miscanthus Phyllosphere	MESDLAQTKARLKEALKQVEFVHQAVTVDLPCITEVSFLHF*
Ga0182145_11382681	3300015361	Miscanthus Phyllosphere	MEFNLVQTRVNLKEALERVESVHQAVMVDLPRVVEVSCLHF*
Ga0182203_10173662	3300017404	Miscanthus Phyllosphere	MESDLALTKERLKEVLERVELIHQAMTVDLPRVIEVSFVHSWCCF
Ga0182203_11005302	3300017404	Miscanthus Phyllosphere	MEFDLAQTKVKLKEALERVELIHQAVSLDLSRIAKVSLLCF
Ga0182203_11129081	3300017404	Miscanthus Phyllosphere	LLEERGLSMESDLTQTKARLKEALERVELVHQAVTVDLPRIIEVSSLCF
Ga0182203_11251931	3300017404	Miscanthus Phyllosphere	MESDLALTKARLKEALERVEIVHQAMTMDLSCVVEVSFGRS
Ga0182203_11363561	3300017404	Miscanthus Phyllosphere	LFEERGLSMESNLAQTKARLKEALERVELIHQAVLVNLPCVTEVSFLRF
Ga0182220_10184082	3300017407	Miscanthus Phyllosphere	MEYDLAQTKARLKEALERVESVHQAVTVDFPRVTEVSFQRF
Ga0182220_11052231	3300017407	Miscanthus Phyllosphere	MESDLALTKAKLKEALERVELIHQAMTVDLPCVVEASFLCS
Ga0182204_10275391	3300017409	Miscanthus Phyllosphere	TKVRLKEALERVELVHRVVTADLQCIVEVSFLCFSCP
Ga0182204_10405681	3300017409	Miscanthus Phyllosphere	MMEFNLAQTRARLEEALERVKVVHQAVMVALPRVA
Ga0182204_11095521	3300017409	Miscanthus Phyllosphere	MESNLAQTKVKLREALERVELTHHVVSINLPCIIKVSRLCF
Ga0182204_11147821	3300017409	Miscanthus Phyllosphere	MESDLAQTKARLMEALERIESVHQAVTVDLPRIAEVSFLCF
Ga0182207_11019472	3300017410	Miscanthus Phyllosphere	MESDLAQTKVRLKEDLERVELIHQAVSVDLLCVAEVSFLHF
Ga0182207_11254681	3300017410	Miscanthus Phyllosphere	MESDLAQTKAKLKEALERVELIHQAVSVDLPCVVEVSLLCF
Ga0182207_11566412	3300017410	Miscanthus Phyllosphere	MESDLTLTKPKLKEALEKVELIHQAMTVDLPCIAKVSFLCSYYCL
Ga0182207_11662832	3300017410	Miscanthus Phyllosphere	LSMESDLTQTKEKLRKALEWVELVHQVVLVGLPCVVEVSLLCF
Ga0182208_10249811	3300017411	Miscanthus Phyllosphere	MESDLALTKERLKEVLKRVELIHQAMIVDLPYIVEVSSLCFLCCP
Ga0182208_10442321	3300017411	Miscanthus Phyllosphere	LALTKTRLKEALHRVELVHQAMIVNLPRVVEVSSLRFCCCP
Ga0182208_10550641	3300017411	Miscanthus Phyllosphere	MESNLALTKARLKEALERVELVHQAMTVDLPRVVEVSSLCFLV
Ga0182222_10461943	3300017413	Miscanthus Phyllosphere	MESDLAETKVRLKEALERVELIHQAVSVDLPCIAEVSFLHF
Ga0182202_11115011	3300017415	Miscanthus Phyllosphere	RGLLMESNLAQTKGMLKEALERVELIHQAVLVDLRHIAEVSFLCF
Ga0182202_11135622	3300017415	Miscanthus Phyllosphere	MESDLAQTKVKLKEALERVELVHQAVSIDLSRVAEVSLLCF
Ga0182202_11228581	3300017415	Miscanthus Phyllosphere	LLEERGLSMESDLAQTKARLKEALERVELVHQMVLVDLSCV
Ga0182230_11174821	3300017417	Miscanthus Phyllosphere	MESDLALTKARLKEALERVELVHQAMTVDLRCIAEVSFLDS
Ga0182228_10546491	3300017420	Miscanthus Phyllosphere	MESDLSLTKARLKEALERVELIHRVMIVDLPRVAEVSFVRSWCC
Ga0182228_10716952	3300017420	Miscanthus Phyllosphere	MESDLAQTKAKLKEALERVELIHQVVSIDRLCVAEVSFLCF
Ga0182219_10659912	3300017424	Miscanthus Phyllosphere	MESDLPQTKAKLKEALERVELIHQAVSVNLPCIAEVGLLHF
Ga0182219_11163371	3300017424	Miscanthus Phyllosphere	MESDLAQTKVRLKEALERVEFTHQAVSVDLPHIVEVSFLCF
Ga0182224_10157563	3300017425	Miscanthus Phyllosphere	MESDLAQTKVKLKVALELVELVHQAISVDLPHVTEVSFLQF
Ga0182224_10594991	3300017425	Miscanthus Phyllosphere	MESDLALTKAKLKEALERVELIHQAVTVDLPCVAEVGSLHFWCYP
Ga0182224_11180091	3300017425	Miscanthus Phyllosphere	MESDLAQTKARLKESLERVESIHQAIMVDLPCVAKVSFLCF
Ga0182224_11396631	3300017425	Miscanthus Phyllosphere	MESDLAQTKARLKEASERVELVHQAVTADLPRVAEVS
Ga0182224_11654871	3300017425	Miscanthus Phyllosphere	MKSDLTQTKAKLKEALEQVELVHQAVSVDLLHAIEVGFLCF
Ga0182190_10539162	3300017427	Miscanthus Phyllosphere	MESDLAQTKARLKEASERVELVHQAVTADLARVAEVSFLHF
Ga0182190_10656621	3300017427	Miscanthus Phyllosphere	MESDLALTKARLKEALERVELIHQAMTVDLTHAVEVSF
Ga0182190_10904202	3300017427	Miscanthus Phyllosphere	MESGLAQTKVKLRDAMERVELIHRAVSVDLLRITKVSFLCF
Ga0182190_11009631	3300017427	Miscanthus Phyllosphere	VLWHFLEERGLSMESNLAQSKAKHKEAMEQVDLVHQAVSVDLPRVAEVSLLC
Ga0182192_11260882	3300017430	Miscanthus Phyllosphere	SDLALSKARLKEALERVELVHQAMTVDLPRVAKVSSLRFLCCP
Ga0182192_11494891	3300017430	Miscanthus Phyllosphere	MESDLAQTSARLEEALEQVKVVHQAVTVDLPHITEVSF
Ga0182209_10718822	3300017436	Miscanthus Phyllosphere	ERGLSMESDLALTKARLKEALERVELVHQAVTVDLPLVAEVGFLSF
Ga0182209_10857962	3300017436	Miscanthus Phyllosphere	MESDLAQTKAKLKEALERVELVHQAVSVDLLLVTEVSLLCS
Ga0182209_10893581	3300017436	Miscanthus Phyllosphere	MEFDLALTKAKLKDALERVELTHQAMTVDLPHVAEVSFLRSWCCL
Ga0182209_10951051	3300017436	Miscanthus Phyllosphere	LLEERGLSIDSDLAQTKVRLKEALERVELAYQAVSIDLSCIAAVSFLCF
Ga0182209_11522011	3300017436	Miscanthus Phyllosphere	MESNLAQTRVKLEDALERVKSIEQAVTIDLPHIAEVGFL
Ga0182191_10076981	3300017438	Miscanthus Phyllosphere	MESDLALTKAKLKEALERVELFYQAMTVDLPRVAEVSFLHSWCCL
Ga0182221_10401582	3300017442	Miscanthus Phyllosphere	MESDLTQTKARLKEALERVELIHQAVLVNLPCVTEVSFLRF
Ga0182221_10549891	3300017442	Miscanthus Phyllosphere	LTNARLKKALEKVELVHQAVTVDLPCVAGVSFLCS
Ga0182221_10685902	3300017442	Miscanthus Phyllosphere	LTQTKARLKEALERVELVHQAVSVDLLRIVEVSFLRFYVCP
Ga0182221_10824051	3300017442	Miscanthus Phyllosphere	SDLAQTKARLKEALERVESVHQVVTVDLPHVAEVSFLCF
Ga0182221_11425621	3300017442	Miscanthus Phyllosphere	MESNLAQTKVKLKEALERVELIHQAASVDLSCIVEVSLM
Ga0182221_11610912	3300017442	Miscanthus Phyllosphere	MESDLAQTKAKLKEALERVEHIHQAVSVDLPCIAEVRFL
Ga0182193_10325472	3300017443	Miscanthus Phyllosphere	HDGEEVVLWHFLEERGLSMDSNLTQTKAKLKDALEQVELIHQVVLVDLLCIAEVTLLCF
Ga0182193_10382552	3300017443	Miscanthus Phyllosphere	MESDLAQTKVRLKEALERVESVHQAVMVDLPHIVEVSFLHF
Ga0182193_10520961	3300017443	Miscanthus Phyllosphere	SRLSMDSDLAQTKVKLKEALERVELAHQAVLVDLPRVAEVSLLCF
Ga0182193_10696782	3300017443	Miscanthus Phyllosphere	MESDLALTKVRLKEALERVELIHQAMTVDLPRIAKLNSLRFWCCP
Ga0182193_10956972	3300017443	Miscanthus Phyllosphere	MESDLAQTKAKVKEALERVELIHQAVSVDLPCVAKVSFLRF
Ga0182193_11576861	3300017443	Miscanthus Phyllosphere	LLEERGLSMESDLAQTKVRLKEALEWVELIHQAVSVDLPRIAEVSFLCF
Ga0182233_11099221	3300017680	Miscanthus Phyllosphere	MESNLTLTKVRLKEALERIELVHQAMTVDLPCIIEVSFLCSWCCI
Ga0182229_10881642	3300017682	Miscanthus Phyllosphere	MESDLTQTKARLKEALEQVELVHQVVTVDLPLVAEVGFLSF
Ga0182218_10413371	3300017683	Miscanthus Phyllosphere	MESDLALAKARLKEALEWVELVHQAMTVDLPRVVEVSFVRSW
Ga0182218_10648572	3300017683	Miscanthus Phyllosphere	MESDLTQTKAKLKEALEWFELVHQAVSVDLPHIAKVSLLCF
Ga0182218_10807841	3300017683	Miscanthus Phyllosphere	MESDLTLTKARLKEAMERVEFVHQAITVDLPRIVGVSFLHSWYCLLFLGI
Ga0182218_11142881	3300017683	Miscanthus Phyllosphere	MESDLGQTKVKLKEALERVELIHQAVSVDLPCVIEVSLLCF
Ga0182225_10297721	3300017684	Miscanthus Phyllosphere	LLEERGLSMESDLTQTKAKLKEALEWVELVHQAVSVDLPCIAEVSLLCF
Ga0182225_10915742	3300017684	Miscanthus Phyllosphere	MESDLALTKAKLKEALERVELFYQAMTVDLPRVVEVSFLHSWCCL
Ga0182225_11233211	3300017684	Miscanthus Phyllosphere	MESDLVLAKAKLKEALERVELVHQAMTIDLPCVIEVSFLCS
Ga0182225_11400271	3300017684	Miscanthus Phyllosphere	MESDLAQTKARLKEALERVESIHQAIMVDLPCVAKVSFLCF
Ga0182227_11024941	3300017685	Miscanthus Phyllosphere	MESDLSQTKAKLKEALEQVELIHHAVSVDLPHIVEVSFLHF
Ga0182223_10133673	3300017690	Miscanthus Phyllosphere	MESDLAQTKMKLREALERVELAHQAVSVDLLRITEVSLLCF
Ga0182223_10159093	3300017690	Miscanthus Phyllosphere	MESDLAQTKVRLKEALEWVELIHQAVTAILPRIVEVSFLHF
Ga0182223_10582971	3300017690	Miscanthus Phyllosphere	MESDLALTKARLKDALERVELIHHTMIVDLPHVEEVS
Ga0182223_10704032	3300017690	Miscanthus Phyllosphere	MESNLAQTKVKLREAMERVELIHQAVSIDLLHIAEVSLLCF
Ga0182223_10706362	3300017690	Miscanthus Phyllosphere	MESDLAQTRVKLEEALERVKSIQQAVSVDLPHVIEVSFLCLSL
Ga0182223_10745141	3300017690	Miscanthus Phyllosphere	MESNLAQIKAKLKEALERVELIHRAVSVDLPCIAEVRLLFF
Ga0182223_11129863	3300017690	Miscanthus Phyllosphere	LVLTKARLKEVLERVELIHQAMIVDLLCIVEVSFLHSWCCL
Ga0207642_106865042	3300025899	Miscanthus Rhizosphere	MESDLAQTKARLEEALERVKLVHQAVTVDLPHIAEVSFLCF
Ga0207643_105890681	3300025908	Miscanthus Rhizosphere	GERLSMESDLAQTKVKLKEALERVELVHQVVSVDLPRITKVSLLCF
Ga0207704_117815592	3300025938	Miscanthus Rhizosphere	MMESDLAQTKARLKEALERVELIHQAMTVDLPCVVEASFLCS