Basic Information | |
---|---|
Family ID | F031268 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 183 |
Average Sequence Length | 42 residues |
Representative Sequence | DADGDGRGELLFRRTSDGGSAYAIYRVTADRLWPLFEGTP |
Number of Associated Samples | 156 |
Number of Associated Scaffolds | 183 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 0.55 % |
% of genes near scaffold ends (potentially truncated) | 99.45 % |
% of genes from short scaffolds (< 2000 bps) | 90.71 % |
Associated GOLD sequencing projects | 144 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.59 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (93.443 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (9.836 % of family members) |
Environment Ontology (ENVO) | Unclassified (22.951 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (45.902 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 35.29% Coil/Unstructured: 64.71% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.59 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 183 Family Scaffolds |
---|---|---|
PF01653 | DNA_ligase_aden | 17.49 |
PF00753 | Lactamase_B | 16.39 |
PF01381 | HTH_3 | 5.46 |
PF01738 | DLH | 4.92 |
PF00156 | Pribosyltran | 2.73 |
PF13537 | GATase_7 | 1.09 |
PF02637 | GatB_Yqey | 1.09 |
PF13366 | PDDEXK_3 | 1.09 |
PF00069 | Pkinase | 1.09 |
PF00005 | ABC_tran | 1.09 |
PF02142 | MGS | 1.09 |
PF05163 | DinB | 1.09 |
PF00117 | GATase | 1.09 |
PF13083 | KH_4 | 0.55 |
PF12704 | MacB_PCD | 0.55 |
PF07719 | TPR_2 | 0.55 |
PF01618 | MotA_ExbB | 0.55 |
PF02517 | Rce1-like | 0.55 |
PF03120 | DNA_ligase_OB | 0.55 |
PF14365 | Neprosin_AP | 0.55 |
PF02934 | GatB_N | 0.55 |
PF07505 | DUF5131 | 0.55 |
PF01980 | TrmO | 0.55 |
PF03544 | TonB_C | 0.55 |
PF02472 | ExbD | 0.55 |
PF05598 | DUF772 | 0.55 |
PF00549 | Ligase_CoA | 0.55 |
PF00232 | Glyco_hydro_1 | 0.55 |
PF02635 | DrsE | 0.55 |
PF00579 | tRNA-synt_1b | 0.55 |
PF00425 | Chorismate_bind | 0.55 |
PF01434 | Peptidase_M41 | 0.55 |
COG ID | Name | Functional Category | % Frequency in 183 Family Scaffolds |
---|---|---|---|
COG0272 | NAD-dependent DNA ligase | Replication, recombination and repair [L] | 18.03 |
COG0515 | Serine/threonine protein kinase | Signal transduction mechanisms [T] | 4.37 |
COG0064 | Asp-tRNAAsn/Glu-tRNAGln amidotransferase B subunit | Translation, ribosomal structure and biogenesis [J] | 1.64 |
COG2511 | Archaeal Glu-tRNAGln amidotransferase subunit E, contains GAD domain | Translation, ribosomal structure and biogenesis [J] | 1.64 |
COG2318 | Bacillithiol/mycothiol S-transferase BstA/DinB, DinB/YfiT family (unrelated to E. coli DinB) | Secondary metabolites biosynthesis, transport and catabolism [Q] | 1.09 |
COG1610 | Uncharacterized conserved protein YqeY, may have tRNA amino acid amidase activity | General function prediction only [R] | 1.09 |
COG4449 | Predicted protease, Abi (CAAX) family | General function prediction only [R] | 0.55 |
COG0045 | Succinyl-CoA synthetase, beta subunit | Energy production and conversion [C] | 0.55 |
COG4422 | Bacteriophage protein gp37 | Mobilome: prophages, transposons [X] | 0.55 |
COG2723 | Beta-glucosidase/6-phospho-beta-glucosidase/beta-galactosidase | Carbohydrate transport and metabolism [G] | 0.55 |
COG1720 | tRNA (Thr-GGU) A37 N6-methylase | Translation, ribosomal structure and biogenesis [J] | 0.55 |
COG1266 | Membrane protease YdiL, CAAX protease family | Posttranslational modification, protein turnover, chaperones [O] | 0.55 |
COG0848 | Biopolymer transport protein ExbD | Intracellular trafficking, secretion, and vesicular transport [U] | 0.55 |
COG0810 | Periplasmic protein TonB, links inner and outer membranes | Cell wall/membrane/envelope biogenesis [M] | 0.55 |
COG0465 | ATP-dependent Zn proteases | Posttranslational modification, protein turnover, chaperones [O] | 0.55 |
COG0180 | Tryptophanyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 0.55 |
COG0162 | Tyrosyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 0.55 |
COG0074 | Succinyl-CoA synthetase, alpha subunit | Energy production and conversion [C] | 0.55 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 93.44 % |
Unclassified | root | N/A | 6.56 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300000364|INPhiseqgaiiFebDRAFT_104134547 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 548 | Open in IMG/M |
3300001593|JGI12635J15846_10095071 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2149 | Open in IMG/M |
3300001593|JGI12635J15846_10404777 | Not Available | 823 | Open in IMG/M |
3300002558|JGI25385J37094_10035902 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1727 | Open in IMG/M |
3300003321|soilH1_10040157 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 6096 | Open in IMG/M |
3300004080|Ga0062385_10507530 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 745 | Open in IMG/M |
3300004080|Ga0062385_11131195 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 532 | Open in IMG/M |
3300004082|Ga0062384_100031714 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 2394 | Open in IMG/M |
3300004082|Ga0062384_100426032 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 861 | Open in IMG/M |
3300004091|Ga0062387_100171163 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1277 | Open in IMG/M |
3300004092|Ga0062389_102451794 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 691 | Open in IMG/M |
3300004092|Ga0062389_103860085 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 563 | Open in IMG/M |
3300004152|Ga0062386_100250351 | All Organisms → cellular organisms → Bacteria | 1404 | Open in IMG/M |
3300004152|Ga0062386_100970107 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 704 | Open in IMG/M |
3300004631|Ga0058899_11324437 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 636 | Open in IMG/M |
3300005179|Ga0066684_10166442 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1408 | Open in IMG/M |
3300005181|Ga0066678_10372702 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 944 | Open in IMG/M |
3300005332|Ga0066388_102441295 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 949 | Open in IMG/M |
3300005355|Ga0070671_100294450 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1381 | Open in IMG/M |
3300005435|Ga0070714_100049422 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3580 | Open in IMG/M |
3300005459|Ga0068867_101157318 | All Organisms → cellular organisms → Bacteria | 709 | Open in IMG/M |
3300005467|Ga0070706_100382054 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1311 | Open in IMG/M |
3300005518|Ga0070699_101445455 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 630 | Open in IMG/M |
3300005534|Ga0070735_10132319 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1553 | Open in IMG/M |
3300005536|Ga0070697_100262293 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1480 | Open in IMG/M |
3300005542|Ga0070732_10239749 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1085 | Open in IMG/M |
3300005543|Ga0070672_100600685 | All Organisms → cellular organisms → Bacteria | 958 | Open in IMG/M |
3300005557|Ga0066704_10801020 | All Organisms → cellular organisms → Bacteria | 586 | Open in IMG/M |
3300005558|Ga0066698_10792103 | All Organisms → cellular organisms → Bacteria | 615 | Open in IMG/M |
3300005577|Ga0068857_101143897 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 752 | Open in IMG/M |
3300005587|Ga0066654_10896439 | All Organisms → cellular organisms → Bacteria | 509 | Open in IMG/M |
3300005598|Ga0066706_10075245 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 2377 | Open in IMG/M |
3300005719|Ga0068861_101398404 | All Organisms → cellular organisms → Bacteria | 683 | Open in IMG/M |
3300005843|Ga0068860_101587230 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 676 | Open in IMG/M |
3300006028|Ga0070717_10980685 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 769 | Open in IMG/M |
3300006028|Ga0070717_12167674 | All Organisms → cellular organisms → Bacteria | 500 | Open in IMG/M |
3300006041|Ga0075023_100198698 | All Organisms → cellular organisms → Bacteria | 772 | Open in IMG/M |
3300006046|Ga0066652_100719350 | All Organisms → cellular organisms → Bacteria | 951 | Open in IMG/M |
3300006059|Ga0075017_100297746 | Not Available | 1190 | Open in IMG/M |
3300006163|Ga0070715_10878530 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 550 | Open in IMG/M |
3300006173|Ga0070716_100088537 | All Organisms → cellular organisms → Bacteria | 1868 | Open in IMG/M |
3300006174|Ga0075014_100338045 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 804 | Open in IMG/M |
3300006354|Ga0075021_10028337 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3173 | Open in IMG/M |
3300006358|Ga0068871_100449593 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1155 | Open in IMG/M |
3300006806|Ga0079220_11206870 | All Organisms → cellular organisms → Bacteria | 625 | Open in IMG/M |
3300009090|Ga0099827_10648552 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 911 | Open in IMG/M |
3300009098|Ga0105245_10462076 | All Organisms → cellular organisms → Bacteria | 1280 | Open in IMG/M |
3300009098|Ga0105245_11573403 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 709 | Open in IMG/M |
3300009174|Ga0105241_10441753 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1149 | Open in IMG/M |
3300009520|Ga0116214_1234931 | All Organisms → cellular organisms → Bacteria | 694 | Open in IMG/M |
3300009524|Ga0116225_1522358 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 527 | Open in IMG/M |
3300009524|Ga0116225_1553396 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 510 | Open in IMG/M |
3300009525|Ga0116220_10001088 | All Organisms → cellular organisms → Bacteria | 10898 | Open in IMG/M |
3300009525|Ga0116220_10502266 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 550 | Open in IMG/M |
3300009545|Ga0105237_11787743 | All Organisms → cellular organisms → Bacteria | 622 | Open in IMG/M |
3300009551|Ga0105238_13084595 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Syntrophomonadaceae → unclassified Syntrophomonadaceae → Syntrophomonadaceae bacterium | 500 | Open in IMG/M |
3300009553|Ga0105249_11016356 | All Organisms → cellular organisms → Bacteria | 898 | Open in IMG/M |
3300009623|Ga0116133_1022119 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1575 | Open in IMG/M |
3300009634|Ga0116124_1183821 | All Organisms → cellular organisms → Bacteria | 582 | Open in IMG/M |
3300009635|Ga0116117_1147732 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 604 | Open in IMG/M |
3300009764|Ga0116134_1012014 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3694 | Open in IMG/M |
3300009824|Ga0116219_10246196 | All Organisms → cellular organisms → Bacteria | 1016 | Open in IMG/M |
3300010043|Ga0126380_11964802 | All Organisms → cellular organisms → Bacteria | 534 | Open in IMG/M |
3300010358|Ga0126370_10145089 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1722 | Open in IMG/M |
3300010359|Ga0126376_11279147 | All Organisms → cellular organisms → Bacteria | 752 | Open in IMG/M |
3300010371|Ga0134125_10430098 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1464 | Open in IMG/M |
3300010376|Ga0126381_101697105 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 912 | Open in IMG/M |
3300010376|Ga0126381_102670262 | All Organisms → cellular organisms → Bacteria | 714 | Open in IMG/M |
3300010376|Ga0126381_103358366 | All Organisms → cellular organisms → Bacteria | 631 | Open in IMG/M |
3300010379|Ga0136449_102736017 | All Organisms → cellular organisms → Bacteria | 699 | Open in IMG/M |
3300010379|Ga0136449_103920159 | All Organisms → cellular organisms → Bacteria | 557 | Open in IMG/M |
3300010396|Ga0134126_10468812 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1455 | Open in IMG/M |
3300010396|Ga0134126_12201997 | All Organisms → cellular organisms → Bacteria | 601 | Open in IMG/M |
3300010397|Ga0134124_11151310 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 794 | Open in IMG/M |
3300010398|Ga0126383_13324018 | All Organisms → cellular organisms → Bacteria | 525 | Open in IMG/M |
3300010398|Ga0126383_13605937 | All Organisms → cellular organisms → Bacteria | 506 | Open in IMG/M |
3300010401|Ga0134121_12137329 | All Organisms → cellular organisms → Bacteria | 595 | Open in IMG/M |
3300011270|Ga0137391_10856514 | All Organisms → cellular organisms → Bacteria | 746 | Open in IMG/M |
3300012019|Ga0120139_1157053 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 594 | Open in IMG/M |
3300012096|Ga0137389_11054899 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 696 | Open in IMG/M |
3300012200|Ga0137382_10205396 | All Organisms → cellular organisms → Bacteria | 1354 | Open in IMG/M |
3300012208|Ga0137376_10507051 | All Organisms → cellular organisms → Bacteria | 1046 | Open in IMG/M |
3300012208|Ga0137376_10867596 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 776 | Open in IMG/M |
3300012350|Ga0137372_11123552 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 537 | Open in IMG/M |
3300012350|Ga0137372_11203396 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 511 | Open in IMG/M |
3300012361|Ga0137360_11010049 | All Organisms → cellular organisms → Bacteria | 718 | Open in IMG/M |
3300012362|Ga0137361_11753655 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 540 | Open in IMG/M |
3300012582|Ga0137358_10830834 | Not Available | 611 | Open in IMG/M |
3300012685|Ga0137397_10079916 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2377 | Open in IMG/M |
3300012918|Ga0137396_11228268 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 526 | Open in IMG/M |
3300012922|Ga0137394_11133414 | Not Available | 646 | Open in IMG/M |
3300012925|Ga0137419_11647460 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 546 | Open in IMG/M |
3300012929|Ga0137404_10810485 | Not Available | 851 | Open in IMG/M |
3300012948|Ga0126375_11458347 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 583 | Open in IMG/M |
3300012957|Ga0164303_10444449 | All Organisms → cellular organisms → Bacteria | 814 | Open in IMG/M |
3300012985|Ga0164308_11966931 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 545 | Open in IMG/M |
3300013102|Ga0157371_10627409 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 801 | Open in IMG/M |
3300013306|Ga0163162_12950316 | All Organisms → cellular organisms → Bacteria | 547 | Open in IMG/M |
3300014052|Ga0120109_1173155 | All Organisms → cellular organisms → Bacteria | 504 | Open in IMG/M |
3300014200|Ga0181526_10464858 | Not Available | 802 | Open in IMG/M |
3300014200|Ga0181526_10543033 | Not Available | 735 | Open in IMG/M |
3300014638|Ga0181536_10409036 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 605 | Open in IMG/M |
3300014657|Ga0181522_10919756 | Not Available | 540 | Open in IMG/M |
3300015241|Ga0137418_11258776 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 517 | Open in IMG/M |
3300015264|Ga0137403_10764645 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 824 | Open in IMG/M |
3300015373|Ga0132257_100748316 | All Organisms → cellular organisms → Bacteria | 1217 | Open in IMG/M |
3300015373|Ga0132257_102442268 | All Organisms → cellular organisms → Bacteria | 678 | Open in IMG/M |
3300016387|Ga0182040_10817337 | Not Available | 769 | Open in IMG/M |
3300016445|Ga0182038_10601344 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 949 | Open in IMG/M |
3300016445|Ga0182038_11726943 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 564 | Open in IMG/M |
3300017924|Ga0187820_1246433 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 572 | Open in IMG/M |
3300017930|Ga0187825_10272365 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 625 | Open in IMG/M |
3300017933|Ga0187801_10109915 | Not Available | 1051 | Open in IMG/M |
3300017936|Ga0187821_10048617 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1519 | Open in IMG/M |
3300017946|Ga0187879_10264303 | All Organisms → cellular organisms → Bacteria | 958 | Open in IMG/M |
3300017955|Ga0187817_11096584 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 511 | Open in IMG/M |
3300017961|Ga0187778_10588226 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 745 | Open in IMG/M |
3300017995|Ga0187816_10487900 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 554 | Open in IMG/M |
3300017998|Ga0187870_1281766 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 563 | Open in IMG/M |
3300018016|Ga0187880_1494332 | All Organisms → cellular organisms → Bacteria | 500 | Open in IMG/M |
3300018025|Ga0187885_10559211 | All Organisms → cellular organisms → Bacteria | 509 | Open in IMG/M |
3300018042|Ga0187871_10551801 | Not Available | 638 | Open in IMG/M |
3300018043|Ga0187887_10553520 | Not Available | 679 | Open in IMG/M |
3300018046|Ga0187851_10478955 | All Organisms → cellular organisms → Bacteria | 708 | Open in IMG/M |
3300018088|Ga0187771_11828851 | All Organisms → cellular organisms → Bacteria | 516 | Open in IMG/M |
3300018090|Ga0187770_10273130 | All Organisms → cellular organisms → Bacteria | 1312 | Open in IMG/M |
3300018090|Ga0187770_11319729 | All Organisms → cellular organisms → Bacteria | 585 | Open in IMG/M |
3300018431|Ga0066655_10731814 | All Organisms → cellular organisms → Bacteria | 670 | Open in IMG/M |
3300018433|Ga0066667_11155747 | All Organisms → cellular organisms → Bacteria | 672 | Open in IMG/M |
3300018468|Ga0066662_12801382 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 517 | Open in IMG/M |
3300018482|Ga0066669_10774249 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 848 | Open in IMG/M |
3300019996|Ga0193693_1049823 | All Organisms → cellular organisms → Bacteria | 674 | Open in IMG/M |
3300021168|Ga0210406_10458011 | All Organisms → cellular organisms → Bacteria | 1014 | Open in IMG/M |
3300021170|Ga0210400_11422687 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 552 | Open in IMG/M |
3300021178|Ga0210408_11331849 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 543 | Open in IMG/M |
3300021402|Ga0210385_10281783 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1228 | Open in IMG/M |
3300021404|Ga0210389_11539494 | All Organisms → cellular organisms → Bacteria | 505 | Open in IMG/M |
3300021405|Ga0210387_10787773 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 840 | Open in IMG/M |
3300021559|Ga0210409_11115150 | All Organisms → cellular organisms → Bacteria | 664 | Open in IMG/M |
3300025625|Ga0208219_1138189 | All Organisms → cellular organisms → Bacteria | 535 | Open in IMG/M |
3300025910|Ga0207684_10535718 | All Organisms → cellular organisms → Bacteria | 1002 | Open in IMG/M |
3300025914|Ga0207671_10556594 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 914 | Open in IMG/M |
3300025942|Ga0207689_10895718 | All Organisms → cellular organisms → Bacteria | 749 | Open in IMG/M |
3300025944|Ga0207661_11463093 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 626 | Open in IMG/M |
3300025945|Ga0207679_10009563 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 6215 | Open in IMG/M |
3300025945|Ga0207679_12077248 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 516 | Open in IMG/M |
3300026310|Ga0209239_1184369 | All Organisms → cellular organisms → Bacteria | 781 | Open in IMG/M |
3300026317|Ga0209154_1029464 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2528 | Open in IMG/M |
3300026330|Ga0209473_1206903 | All Organisms → cellular organisms → Bacteria | 737 | Open in IMG/M |
3300026497|Ga0257164_1008578 | All Organisms → cellular organisms → Bacteria | 1259 | Open in IMG/M |
3300026537|Ga0209157_1183331 | All Organisms → cellular organisms → Bacteria | 906 | Open in IMG/M |
3300026552|Ga0209577_10336530 | All Organisms → cellular organisms → Bacteria | 1116 | Open in IMG/M |
3300027748|Ga0209689_1211376 | All Organisms → cellular organisms → Bacteria | 839 | Open in IMG/M |
3300027855|Ga0209693_10113686 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1340 | Open in IMG/M |
3300027894|Ga0209068_10046501 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2192 | Open in IMG/M |
3300027898|Ga0209067_10801223 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 550 | Open in IMG/M |
3300027905|Ga0209415_11098289 | All Organisms → cellular organisms → Bacteria | 518 | Open in IMG/M |
3300027986|Ga0209168_10558726 | All Organisms → cellular organisms → Bacteria | 549 | Open in IMG/M |
3300028673|Ga0257175_1053754 | All Organisms → cellular organisms → Bacteria | 742 | Open in IMG/M |
3300029914|Ga0311359_10800730 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 660 | Open in IMG/M |
3300030506|Ga0302194_10362791 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 568 | Open in IMG/M |
3300031231|Ga0170824_100610962 | All Organisms → cellular organisms → Bacteria | 613 | Open in IMG/M |
3300031236|Ga0302324_100038079 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 8923 | Open in IMG/M |
3300031446|Ga0170820_11376949 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 542 | Open in IMG/M |
3300031446|Ga0170820_13741146 | All Organisms → cellular organisms → Bacteria | 544 | Open in IMG/M |
3300031446|Ga0170820_13925061 | All Organisms → cellular organisms → Bacteria | 634 | Open in IMG/M |
3300031446|Ga0170820_14009042 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 749 | Open in IMG/M |
3300031474|Ga0170818_105784822 | All Organisms → cellular organisms → Bacteria | 546 | Open in IMG/M |
3300031474|Ga0170818_107344238 | All Organisms → cellular organisms → Bacteria | 648 | Open in IMG/M |
3300031740|Ga0307468_100052069 | All Organisms → cellular organisms → Bacteria | 2146 | Open in IMG/M |
3300031740|Ga0307468_100823166 | All Organisms → cellular organisms → Bacteria | 795 | Open in IMG/M |
3300031753|Ga0307477_10341793 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1030 | Open in IMG/M |
3300031823|Ga0307478_10509572 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Granulicella → unclassified Granulicella → Granulicella sp. dw_53 | 1003 | Open in IMG/M |
3300031823|Ga0307478_11131381 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 653 | Open in IMG/M |
3300031941|Ga0310912_10344396 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1157 | Open in IMG/M |
3300032064|Ga0318510_10362805 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 612 | Open in IMG/M |
3300032089|Ga0318525_10218570 | All Organisms → cellular organisms → Bacteria | 980 | Open in IMG/M |
3300032160|Ga0311301_10131109 | All Organisms → cellular organisms → Bacteria | 4657 | Open in IMG/M |
3300032205|Ga0307472_100063466 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2373 | Open in IMG/M |
3300032828|Ga0335080_10842197 | All Organisms → cellular organisms → Bacteria | 945 | Open in IMG/M |
3300032892|Ga0335081_12518256 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 531 | Open in IMG/M |
3300033158|Ga0335077_11562591 | All Organisms → cellular organisms → Bacteria | 629 | Open in IMG/M |
3300033402|Ga0326728_10012621 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 18693 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 9.84% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 7.10% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 6.56% |
Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 5.46% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 4.37% |
Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 4.92% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 4.92% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 3.83% |
Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 3.83% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 3.28% |
Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 3.28% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 3.28% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 3.28% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 2.73% |
Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 2.19% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 2.19% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 2.19% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 2.19% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.64% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.64% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.64% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.64% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 1.64% |
Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 1.09% |
Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 1.09% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.09% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.09% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 1.09% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.09% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 1.09% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.55% |
Sugarcane Root And Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Sugarcane Root And Bulk Soil | 0.55% |
Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 0.55% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.55% |
Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 0.55% |
Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.55% |
Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.55% |
Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 0.55% |
Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.55% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.55% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.55% |
Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.55% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.55% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.55% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.55% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.55% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
3300001593 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 | Environmental | Open in IMG/M |
3300002558 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_40cm | Environmental | Open in IMG/M |
3300003321 | Sugarcane bulk soil Sample H1 | Environmental | Open in IMG/M |
3300004080 | Coassembly of ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
3300004082 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3 | Environmental | Open in IMG/M |
3300004091 | Coassembly of ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
3300004152 | Coassembly of ECP12_OM1, ECP12_OM2, ECP12_OM3 | Environmental | Open in IMG/M |
3300004631 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF234 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300005179 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 | Environmental | Open in IMG/M |
3300005181 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 | Environmental | Open in IMG/M |
3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Host-Associated | Open in IMG/M |
3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Host-Associated | Open in IMG/M |
3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
3300005534 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1 | Environmental | Open in IMG/M |
3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
3300005542 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 | Environmental | Open in IMG/M |
3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Host-Associated | Open in IMG/M |
3300005557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 | Environmental | Open in IMG/M |
3300005558 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 | Environmental | Open in IMG/M |
3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Host-Associated | Open in IMG/M |
3300005587 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103 | Environmental | Open in IMG/M |
3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Host-Associated | Open in IMG/M |
3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
3300006041 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014 | Environmental | Open in IMG/M |
3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Environmental | Open in IMG/M |
3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
3300006174 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2014 | Environmental | Open in IMG/M |
3300006354 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 | Environmental | Open in IMG/M |
3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Host-Associated | Open in IMG/M |
3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Host-Associated | Open in IMG/M |
3300009520 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_1_NS metaG | Environmental | Open in IMG/M |
3300009524 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_c_BC metaG | Environmental | Open in IMG/M |
3300009525 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_7_NC metaG | Environmental | Open in IMG/M |
3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Host-Associated | Open in IMG/M |
3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Host-Associated | Open in IMG/M |
3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
3300009623 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_19_10 | Environmental | Open in IMG/M |
3300009634 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_150 | Environmental | Open in IMG/M |
3300009635 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_10 | Environmental | Open in IMG/M |
3300009764 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_19_40 | Environmental | Open in IMG/M |
3300009824 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaG | Environmental | Open in IMG/M |
3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
3300012019 | Permafrost microbial communities from Nunavut, Canada - A7_5cm_12M | Environmental | Open in IMG/M |
3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
3300012350 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaG | Environmental | Open in IMG/M |
3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
3300012985 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MG | Environmental | Open in IMG/M |
3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Host-Associated | Open in IMG/M |
3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
3300014052 | Permafrost microbial communities from Nunavut, Canada - A23_35cm_12M | Environmental | Open in IMG/M |
3300014200 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_30_metaG | Environmental | Open in IMG/M |
3300014638 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_60_metaG | Environmental | Open in IMG/M |
3300014657 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_10_metaG | Environmental | Open in IMG/M |
3300015241 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300015264 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
3300017924 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_5 | Environmental | Open in IMG/M |
3300017930 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_5 | Environmental | Open in IMG/M |
3300017933 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_1 | Environmental | Open in IMG/M |
3300017936 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_1 | Environmental | Open in IMG/M |
3300017946 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_10 | Environmental | Open in IMG/M |
3300017955 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2 | Environmental | Open in IMG/M |
3300017961 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_20_MG | Environmental | Open in IMG/M |
3300017995 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_1 | Environmental | Open in IMG/M |
3300017998 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_150 | Environmental | Open in IMG/M |
3300018016 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_40 | Environmental | Open in IMG/M |
3300018025 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_100 | Environmental | Open in IMG/M |
3300018042 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_10 | Environmental | Open in IMG/M |
3300018043 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_10 | Environmental | Open in IMG/M |
3300018046 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_10 | Environmental | Open in IMG/M |
3300018088 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_10_MG | Environmental | Open in IMG/M |
3300018090 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
3300019996 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3a2 | Environmental | Open in IMG/M |
3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
3300021402 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-O | Environmental | Open in IMG/M |
3300021404 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O | Environmental | Open in IMG/M |
3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
3300025625 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 53-2 shallow-072012 (SPAdes) | Environmental | Open in IMG/M |
3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) | Environmental | Open in IMG/M |
3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026310 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_2_20cm (SPAdes) | Environmental | Open in IMG/M |
3300026317 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 (SPAdes) | Environmental | Open in IMG/M |
3300026330 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 (SPAdes) | Environmental | Open in IMG/M |
3300026497 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - CO-08-B | Environmental | Open in IMG/M |
3300026537 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 (SPAdes) | Environmental | Open in IMG/M |
3300026552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 (SPAdes) | Environmental | Open in IMG/M |
3300027748 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 (SPAdes) | Environmental | Open in IMG/M |
3300027855 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 (SPAdes) | Environmental | Open in IMG/M |
3300027894 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 (SPAdes) | Environmental | Open in IMG/M |
3300027898 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 (SPAdes) | Environmental | Open in IMG/M |
3300027905 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 (SPAdes) | Environmental | Open in IMG/M |
3300027986 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300028673 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NI-69-B | Environmental | Open in IMG/M |
3300029914 | III_Bog_E2 coassembly | Environmental | Open in IMG/M |
3300030506 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_N1_1 | Environmental | Open in IMG/M |
3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031236 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1 | Environmental | Open in IMG/M |
3300031446 | Fir Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031474 | Fir Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
3300032064 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f17 | Environmental | Open in IMG/M |
3300032089 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f23 | Environmental | Open in IMG/M |
3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
3300033402 | Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB31MN | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
INPhiseqgaiiFebDRAFT_1041345472 | 3300000364 | Soil | DGRGEFLFREVSNTGSVWAVYRAGADQLIPLFLGTPSGQ* |
JGI12635J15846_100950711 | 3300001593 | Forest Soil | ADGDGRGELLFRRTSDGGSAYAIYRVTADRLWPLFEGTP* |
JGI12635J15846_104047773 | 3300001593 | Forest Soil | GRGELLFRRTSDNGSAYAIYRVTADGLWPLYEGTP* |
JGI25385J37094_100359021 | 3300002558 | Grasslands Soil | AVDADGDGRGELLFRQVSDAGRAFSIYRVIGDQLYPLFEGTPQ* |
soilH1_100401579 | 3300003321 | Sugarcane Root And Bulk Soil | DGDGRGELLFKQVGDSGTGYSLYRVIGDRLWPLFESKPGA* |
Ga0062385_105075302 | 3300004080 | Bog Forest Soil | IDAVDADGSGRGALLFRRTFDDGSAFAVYRVTADRLWPLFEGTP* |
Ga0062385_111311952 | 3300004080 | Bog Forest Soil | VDADGDGRGELLFRRTFDDGSAYAIYRVTADGLWPLFEPTP* |
Ga0062384_1000317141 | 3300004082 | Bog Forest Soil | VDADGDGRGELLFRRTFDDGSAYAIYRVTADGLWPLFEGTP* |
Ga0062384_1004260321 | 3300004082 | Bog Forest Soil | AVDADGDGRAELLFRRTSDDGSAYAIYRVTADGLWPLFEGTP* |
Ga0062387_1001711633 | 3300004091 | Bog Forest Soil | DAVDVDGDGRAELLFREVSDTSSAFVVYRVIGDQLYPMFQGSL* |
Ga0062389_1024517942 | 3300004092 | Bog Forest Soil | IDAVDADGDGRGELLFRRTFDGGSAYAIYRVTADGLWPLFEGTP* |
Ga0062389_1038600852 | 3300004092 | Bog Forest Soil | IDAVDADGDGRGELLFRRTFDDGSAYAIYRVTADGLWPLFEPTP* |
Ga0062386_1002503511 | 3300004152 | Bog Forest Soil | IDAVDADGDGRGELLFRRTSDGGSAYAIYRVTADRLWPLFEGTP* |
Ga0062386_1009701071 | 3300004152 | Bog Forest Soil | ADGDGRGELLFRRTFDGGSAYAIYRVTADRLWPLFEGTP* |
Ga0058899_113244372 | 3300004631 | Forest Soil | AGPGVRPQDRAVDVDGDGRGELLFRQVSDAGSAFVVYRVIGDRLYPLFQGTLGQ* |
Ga0066684_101664422 | 3300005179 | Soil | YEFIDAVDSDGDGRGELLFRKTQDSGSAFGIYAVIGDRFWTLFEGKPGR* |
Ga0066678_103727021 | 3300005181 | Soil | AKYDLIDAVDADGDGRGELLFRMTSEAGSAFGVYRVIGDRLWPVFEGKPGG* |
Ga0066388_1024412951 | 3300005332 | Tropical Forest Soil | DAVDADGDGRGELLFRMNWDSGSAFSVYRVIGDRLWPLFEGKPGS* |
Ga0070671_1002944501 | 3300005355 | Switchgrass Rhizosphere | ADGDGRGELLFRQVSDGGSAFVLFRVIGDRLWPLFQGTPGS* |
Ga0070714_1000494221 | 3300005435 | Agricultural Soil | VDADGDGRGELLFKQVGDSGTAYSIYRVIGDRLWPLFESKPGS* |
Ga0068867_1011573182 | 3300005459 | Miscanthus Rhizosphere | RCEFVDVVDAEGDGYGELLFRRTYESGRAFSVYRVIGNQLWPLFEGKP* |
Ga0070706_1003820541 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | VDADGDGRGELLFRRTSDGGSAYAIYRVTADRLWPLFEGTP* |
Ga0070699_1014454551 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | AIDADGDGRGELLFRRTTDAGTSFAIYRVTADRLWPLYEGTP* |
Ga0070735_101323193 | 3300005534 | Surface Soil | GDGRGELLFREFTDSGKAFVVYRVGADKLYPLFEGGSGQ* |
Ga0070697_1002622933 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | LIDAIDADGDGRGELLFRRTTDAGTSFAIYRVTADRLRPLYEGTP* |
Ga0070732_102397491 | 3300005542 | Surface Soil | DGDGRGELLFKRISDVGSAWGVYRAGADQLFPLFEGTPSNQ* |
Ga0070672_1006006852 | 3300005543 | Miscanthus Rhizosphere | DAVDADGDGRGELLFRQVGGGGTGYGLYRVIGDRLWPLFESKPGS* |
Ga0066704_108010202 | 3300005557 | Soil | AELLFRLTSEAGSAFAIYSVIGDKLWPLFEGKPGT* |
Ga0066698_107921031 | 3300005558 | Soil | GDLLFRRISDAGSAFAIYRVTSDQLWPLFERTPSGP* |
Ga0068857_1011438972 | 3300005577 | Corn Rhizosphere | GRGELLFRQVSDAGSAFVLYRVIGDRLWPLFQGTPGE* |
Ga0066654_108964391 | 3300005587 | Soil | IPKFEFIDAVDVDGDGRGELLFRIDRESGTAFNVYAVIGDRLWPMFLGKTGG* |
Ga0066706_100752453 | 3300005598 | Soil | DAVDADGNGRGELLFRMIWDNGSAFSVYRVIGDRLWPLFEGKPGA* |
Ga0068861_1013984042 | 3300005719 | Switchgrass Rhizosphere | AVDADGDGRGELLFRQISDAGRAFVIYRVIGDQLWPLYEGAPQ* |
Ga0068860_1015872301 | 3300005843 | Switchgrass Rhizosphere | ELLFRQISDGGSAFVLYRVIGDRLWPLFQGTPGS* |
Ga0070717_109806852 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | IDAVDADGDGRGELLFRRTFDNGSAYSIYRVTADRLWPLYEGTP* |
Ga0070717_121676741 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | DGDGVGELLFKATWDAGSAFTVYRVIGDQLWPLFEGKPGT* |
Ga0075023_1001986981 | 3300006041 | Watersheds | ELLFRRISDAGSAWGVYRAGADQLFPLFEGTPAGR* |
Ga0066652_1007193501 | 3300006046 | Soil | RGELLFRRISDAGSAYDLYRVIGDKLYALYQSTSP* |
Ga0075017_1002977461 | 3300006059 | Watersheds | DAVDADGDGRGELLFRRISDAGSAYGIYRVTADQLWPLYEGTP* |
Ga0070715_108785302 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | GDGRGELLFRQVSDGGSAFVLYRVIGDRLWPLFQGTPGS* |
Ga0070716_1000885371 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | GRGELLFRQTSDAGRAFSIYRVIGDQLYPLFQGTPQ* |
Ga0075014_1003380451 | 3300006174 | Watersheds | VDADGDGRGELLFRRTSDAGSAYGVYRVTADQLWPLYEGAP* |
Ga0075021_100283371 | 3300006354 | Watersheds | IDAVDVDGDGRGEMLFRQVSDAGSAFVVYRVIGDRLYPLFQGMPGR* |
Ga0068871_1004495932 | 3300006358 | Miscanthus Rhizosphere | DSQPRCEFVDVVDAEGDGYGELLFRRSYESGRAFSVYRVIGNQLWSLFDGKP* |
Ga0079220_112068701 | 3300006806 | Agricultural Soil | RGELLFRMSWDNGSAFGVYRVIGDRLWPLFEGKPGT* |
Ga0099827_106485521 | 3300009090 | Vadose Zone Soil | AVDADGDGRGELLLRQISDKGSAFVIYRVIGEQLWALFQGTPE* |
Ga0105245_104620761 | 3300009098 | Miscanthus Rhizosphere | DSQPRCEFVDVVDAEGDGYGELLFRRTYESGRAFSVYRVIGNQLWPLFEGKP* |
Ga0105245_115734031 | 3300009098 | Miscanthus Rhizosphere | DGDGRGELLFRQVSDAGSAFVLYRVIGDRLWPLFQGTPGQ* |
Ga0105241_104417533 | 3300009174 | Corn Rhizosphere | DGDGRGELLFREVSDVGSAYVVYRVTADQLWTLFEGSPR* |
Ga0116214_12349312 | 3300009520 | Peatlands Soil | DADGDGRGELLFRQVSDAGTAFVVYRVIGDQLWPLFQGTPE* |
Ga0116225_15223582 | 3300009524 | Peatlands Soil | AVDADGDGRGELLFRRTFDGGSAYAIYRVTADGLWPLFEGTP* |
Ga0116225_15533961 | 3300009524 | Peatlands Soil | DAVDADGDGRGELLFRRTFDNGSAFAIYRVTADGLWPLIDGTT* |
Ga0116220_100010881 | 3300009525 | Peatlands Soil | DAQHMDVIPRLDLNDAVDVDGDGRAELLFREVSDTGSAFGIYRVIGDRLYPLFQGTL* |
Ga0116220_105022662 | 3300009525 | Peatlands Soil | ADGDGRGELLFRRTFDDGSAYAIYRVTADRLWPLFEGSR* |
Ga0105237_117877432 | 3300009545 | Corn Rhizosphere | DADGDGRGELLFRQVSDSGSAFVLYRVIGDRLWPLFQGTPGQ* |
Ga0105238_130845951 | 3300009551 | Corn Rhizosphere | IDAVDVDGDGRGELLFRTSGDSGTAFNIYAVIGDRLWPIFLGKTGR* |
Ga0105249_110163561 | 3300009553 | Switchgrass Rhizosphere | GDADGDGRGELLFRQVSDAGSAFVLYRVIGDRLWPLFQGTPGQ* |
Ga0116133_10221193 | 3300009623 | Peatland | DADGDGRGELLFRRTFDNGSAYAIYRVTADRLWPLFEPTP* |
Ga0116124_11838212 | 3300009634 | Peatland | DGDGRGELLFRRTSDNGSAYAIYRVTADRLWPLFEGTP* |
Ga0116117_11477321 | 3300009635 | Peatland | GRGELLFRRTYDDGSAYAIYRVTADRLWPLYEGTP* |
Ga0116134_10120141 | 3300009764 | Peatland | IDAVDADGDGRGELLFRRTFDDGSAYAIYRVTADRLWPLFEGSR* |
Ga0116219_102461961 | 3300009824 | Peatlands Soil | AVDADGDGRGELLFRRTFDNGSAYAIYRVTADRLWPLFEPTP* |
Ga0126380_119648022 | 3300010043 | Tropical Forest Soil | AKYEFIDAVDVNGDGRGELLFRTTSDGGSAFSIYAVIGDRLWPLFEGKPGG* |
Ga0126370_101450891 | 3300010358 | Tropical Forest Soil | DGDGRGELLFRETWDSGAAYGVYRVIGDQLWPLFEGKPGT* |
Ga0126376_112791471 | 3300010359 | Tropical Forest Soil | GELLLRMNWDNGSAFSVYRVIGDRLWPLFEGKPGT* |
Ga0134125_104300981 | 3300010371 | Terrestrial Soil | ELLFRQVSDSGSAFVLYRVIGDRLWPLFQGTPGQ* |
Ga0126381_1016971051 | 3300010376 | Tropical Forest Soil | VVDADGDGRGELLFRQISDAGTAYAIYRVTRDRLWPLYEGSPQ* |
Ga0126381_1026702621 | 3300010376 | Tropical Forest Soil | ELLFRESWDSGTAFAVYRVIGDQLWPLFEGKPGT* |
Ga0126381_1033583661 | 3300010376 | Tropical Forest Soil | LLDAVDADGDGVGELLFRESWDSGTAFAVYRVIGDQLWPLFEGKPGT* |
Ga0136449_1027360171 | 3300010379 | Peatlands Soil | GRGELLFRQTSDAGSAFVVYRVIGNQLWALFQGTPQ* |
Ga0136449_1039201591 | 3300010379 | Peatlands Soil | VDADGDGRGELLFRRTFDDGSAYAIYRVTADRLWPLFDPTP* |
Ga0134126_104688123 | 3300010396 | Terrestrial Soil | DADGDGRGELLFRETSDEGRAYSIYRVIGDQLYQLYKSTPQ* |
Ga0134126_122019971 | 3300010396 | Terrestrial Soil | ADGDGRGELLFRQVWDSGSGFAVYRVIGDRLWPLFESKPVS* |
Ga0134124_111513101 | 3300010397 | Terrestrial Soil | EFVDVVDAEGDGYGELLFRRTYESGRAFSVYRVIGNQLWPLFEGKP* |
Ga0126383_133240182 | 3300010398 | Tropical Forest Soil | DAIDADGDGRGELMFRRVYDQGSAYVIYRQIGDQLWPLFEGTPQ* |
Ga0126383_136059371 | 3300010398 | Tropical Forest Soil | PRYDLIDAVDVDGDGVGELLFREGWDSGTAFAVYRVIGDQLWPLFEGKPGT* |
Ga0134121_121373291 | 3300010401 | Terrestrial Soil | VDADGDGRGELLFRKAWDSGTSFAVYRMIGDRLWPLFEGKPGS* |
Ga0137391_108565141 | 3300011270 | Vadose Zone Soil | RGDLLFRRISDAGSAFAIYRVTSDQLWPLFERTPSGP* |
Ga0120139_11570532 | 3300012019 | Permafrost | VTARGDVRVDADGDGRAELLFRLTSDAGSAFAIYSVIGDKLWPLFEGKPGT* |
Ga0137389_110548991 | 3300012096 | Vadose Zone Soil | DADGDGRGELLFRQISDAGSAFAVYRVIGDQLWPLFQGMPGH* |
Ga0137382_102053961 | 3300012200 | Vadose Zone Soil | IDAVDADGNGRGELLFRLTSETGSAFSIYRVIGDKLWPLFEGKPGA* |
Ga0137376_105070511 | 3300012208 | Vadose Zone Soil | KFEFIDAVDVDGDGRGELLFRTSRESGTAFNIYAVIGDRLWPMFLGKTGS* |
Ga0137376_108675961 | 3300012208 | Vadose Zone Soil | RLELIDAVDADGDGRGEFLFREVSATGNTWGVYRAGADQLFPLFQGTPSTQ* |
Ga0137372_111235522 | 3300012350 | Vadose Zone Soil | DGDGRGELLFRRTSDAGSAYGIYRVTADRLWPLYEGAP* |
Ga0137372_112033962 | 3300012350 | Vadose Zone Soil | IDAVDADGDGRGELLFRRTSDAGSAYGIYRVTADRLWPLYEGAP* |
Ga0137360_110100491 | 3300012361 | Vadose Zone Soil | DGDGRGELLFRQVSDAGRAFSIYRVIGDQLYPLFEGTPQ* |
Ga0137361_117536551 | 3300012362 | Vadose Zone Soil | ADGDGRGEFLFREVSNAGSTWAVYRAGADQLFPLFQGTPSGQ* |
Ga0137358_108308341 | 3300012582 | Vadose Zone Soil | DADGDGRGELLFRRTSDGGSAYAIYRVTSDHLWPLFEGTP* |
Ga0137397_100799164 | 3300012685 | Vadose Zone Soil | VDADGDGRGELLFRQVSDSGSAFVLYRVIGDRLWPLFQGTPGQ* |
Ga0137396_112282681 | 3300012918 | Vadose Zone Soil | GRGELLFRRTSDGGSAFAIYRVTSDHLWPLFEGTP* |
Ga0137394_111334142 | 3300012922 | Vadose Zone Soil | DAVDADGDGRGEFLFREVSNTGSVWAVYRAGADQLIPLFQGTPSGQ* |
Ga0137419_116474602 | 3300012925 | Vadose Zone Soil | DGRGELLFRKISDAGTAYGVYRVTADQLWPLFEGAAVGSSSQ* |
Ga0137404_108104852 | 3300012929 | Vadose Zone Soil | GDGRGELLFRRTSNDGSAYAIYRVSSDHLWPLFEGTP* |
Ga0126375_114583472 | 3300012948 | Tropical Forest Soil | VDADGDGRGELLFRQMSDSGHAYVLYRVIGNQLYALYQSDFSQ* |
Ga0164303_104444491 | 3300012957 | Soil | DGRGELLFRQVTDSGSAFVLYRVIGDRLWPLFQGTPGQ* |
Ga0164308_119669311 | 3300012985 | Soil | AVDADGDGRGELLFRRISDAGKSWGVYRAGADQLFPLFEGTPGQ* |
Ga0157371_106274092 | 3300013102 | Corn Rhizosphere | VDVVDAEGDGYGELLFRRTYESGRAFSVYRVIGNQLWPLFEGKP* |
Ga0163162_129503162 | 3300013306 | Switchgrass Rhizosphere | GELLFRQVSDAGSAFVLYRVIGDRLWPLFQGTPGQ* |
Ga0120109_11731551 | 3300014052 | Permafrost | DVDGDGRAELLFRLTSDIGSAYAIYSVIGDRLWPLFEGKPGT* |
Ga0181526_104648582 | 3300014200 | Bog | DADGDGRGELLFRRTFDDGSAYSIYRVTADGLWPLFEGTP* |
Ga0181526_105430332 | 3300014200 | Bog | AVDADGDGRGELLFRRTFEDGSAYAIYRVTADGLWPLFEGTP* |
Ga0181536_104090362 | 3300014638 | Bog | GDGRGELLFRRTFDDGSAYAIYRVTADRLWPLFEGSR* |
Ga0181522_109197561 | 3300014657 | Bog | DADGDGRGELFFRRTFDDGSAYAIYRVTADGLWPLFEGTP* |
Ga0137418_112587761 | 3300015241 | Vadose Zone Soil | VDAEGDGYGELLFRRTYDVGRAFSVYRVIGNQLWPLFEGKP* |
Ga0137403_107646452 | 3300015264 | Vadose Zone Soil | VIDAVDADGDGRGELLFRRTFDSGSAYAIYRVTADGLWPLFEGTP* |
Ga0132257_1007483163 | 3300015373 | Arabidopsis Rhizosphere | VDADGDGYGELLFRRTYDSGRAYSVYRVIGNQLWPLFEGKQ* |
Ga0132257_1024422681 | 3300015373 | Arabidopsis Rhizosphere | GDGRGELLFRRISDVGSAWGVYRAGADQLFPLFEGTPPGQ* |
Ga0182040_108173372 | 3300016387 | Soil | GDGRGELLFRQTSDAGTAFVLYRVIGDTLYALYQGMPTGG |
Ga0182038_106013441 | 3300016445 | Soil | VDGDGRGELLFRKVYDASSAFVVYRVIGDQLYALFDGTPGASSDLVP |
Ga0182038_117269432 | 3300016445 | Soil | AVDADGDGRGDLLFRQISDADVSYVIYRVSPDKLWPLFNSGAPES |
Ga0187820_12464331 | 3300017924 | Freshwater Sediment | DGDGRGELLFRQVSDAGSAFVLYRVIGDQLWPLFQGTPGP |
Ga0187825_102723651 | 3300017930 | Freshwater Sediment | GDGRGELLFRRITDAGNSYGVYRAAADSLFPLFESTPNGH |
Ga0187801_101099152 | 3300017933 | Freshwater Sediment | DGDGRGELLFRETSDAGSAYAIYRVTADQLWPLYEGTP |
Ga0187821_100486173 | 3300017936 | Freshwater Sediment | GDGRGELLFREFTDSGKAFVVYRVGADKLYALFEGGSGQ |
Ga0187879_102643031 | 3300017946 | Peatland | LIDAVDADGDGRGELLFRRTFDEGSAYAIYRVTADRLWPLFEPTP |
Ga0187817_110965841 | 3300017955 | Freshwater Sediment | ADGDGRGELLFRRTFDDGSAYAIYRVSADRLWPLFDPTP |
Ga0187778_105882261 | 3300017961 | Tropical Peatland | VVDADGDGRGELLFRRTFDAGSAYAIYRVTADGLWPLWEPIP |
Ga0187816_104879002 | 3300017995 | Freshwater Sediment | IDAVDADGDGRGELLFRRTFDGGSAYAIYRVTADGLWPLFEGTP |
Ga0187870_12817662 | 3300017998 | Peatland | IDAVDADGDGRGELLFRRTFDDGSAYAIYRVTADRLWPLFEGSR |
Ga0187880_14943321 | 3300018016 | Peatland | DADGDGRGELLFRRTFDDGSAYAIYRVTADRLWPLFEPTP |
Ga0187885_105592111 | 3300018025 | Peatland | LIDAVDADGDGRGELLFRRTFDDGSAYAIYRVTADRLWPLFDPTP |
Ga0187871_105518012 | 3300018042 | Peatland | DGDGRGELLFRRTFDSGTVYAIYRVTADGLWPLFEPTP |
Ga0187887_105535202 | 3300018043 | Peatland | DADGDGRGELLFRQTSDTGSAYAIYRVTADQLWLLYAGTP |
Ga0187851_104789552 | 3300018046 | Peatland | DVDGDGRAELLFREVSDTSSAFVVYRVIGNQLYPLFQGSLGE |
Ga0187771_118288512 | 3300018088 | Tropical Peatland | DANGDGAGELLFRKIFDTGSVYAVYRVIGDQLYPLFEGTLGG |
Ga0187770_102731302 | 3300018090 | Tropical Peatland | GRGELLFRRTFDDGSAYAIYRVSADRLWPLFEPTP |
Ga0187770_113197292 | 3300018090 | Tropical Peatland | VDVDGDGRAELLFRKTYDEGSAFVVYRVIGNQLYPLFDGVPAG |
Ga0066655_107318142 | 3300018431 | Grasslands Soil | RGELLFRMNWDNGSAFGVYRVIGDRLWPLFEGKPGA |
Ga0066667_111557471 | 3300018433 | Grasslands Soil | ADGDGRGELLFRQVSDAGRAFSIYRVIGDQLYPLFEGTPQ |
Ga0066662_128013821 | 3300018468 | Grasslands Soil | DADGDGRGELLFKQISDAGSAFAIYRVLPDRLWSLYEGTPQ |
Ga0066669_107742493 | 3300018482 | Grasslands Soil | DADADGDGRGELLFRMSWDNGSAFSVYRVIGDRLWPLFEGKPAT |
Ga0193693_10498232 | 3300019996 | Soil | GRGELLFRITSENGSAFGVYRLIGDKLWPLFEGKPGK |
Ga0210406_104580111 | 3300021168 | Soil | VDADGDGRGELLFRRASDGGSAYAIYRVTSDHLWPLFEGTP |
Ga0210400_114226871 | 3300021170 | Soil | IPKYEFIDAVDADGDGRGELLFRKTQDSGSAFGIYAVIGDRLWPLFEGKTGK |
Ga0210408_113318492 | 3300021178 | Soil | GRGELLFRQNSDAGTAFVVYRVIGDRLWPLFQGTPGQGIIN |
Ga0210385_102817831 | 3300021402 | Soil | AVDADGDGRGELLFRRTFDDGSTGYSIYRVTADGLWTLFEGTP |
Ga0210389_115394941 | 3300021404 | Soil | VDGDGGGELLFRRVSDTGSGYVVYRVIGNQLWPLYEGPIG |
Ga0210387_107877731 | 3300021405 | Soil | RGELLFREVSEAGTAFVIYRVIGDRLYPLFQGTPG |
Ga0210409_111151502 | 3300021559 | Soil | DVDGDGGGELLFRRVSDTGSGYVVYRVIGNQLWPLYEGPIG |
Ga0208219_11381892 | 3300025625 | Arctic Peat Soil | GDGRGELLFRKVSDTGSGYVVYRVIGNQLWPLFQGAIG |
Ga0207684_105357181 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | DADGDGRGELLFRRTSDGGSAYAIYRVTADRLWPLFEGTP |
Ga0207671_105565943 | 3300025914 | Corn Rhizosphere | DAVDVDGDGRGELLFRSERESGAAFNIYAVIGDRLWPMFLGKAGR |
Ga0207689_108957181 | 3300025942 | Miscanthus Rhizosphere | GELLFKQVGESGTGYALYRVIGDRLWPLFESKPGS |
Ga0207661_114630932 | 3300025944 | Corn Rhizosphere | ADGDGRGELLFRQVSDAGSAFVLYRVIGDRLWPLFQGTPGE |
Ga0207679_100095637 | 3300025945 | Corn Rhizosphere | DGDGRGELLFRQVSDAGSAFVLYRVIGDRLWPLFQGTPGE |
Ga0207679_120772482 | 3300025945 | Corn Rhizosphere | GDGRGELLFRQVSDAGSAFVLYRVIGDRLWPLFQGTPGE |
Ga0209239_11843692 | 3300026310 | Grasslands Soil | DADGDGRGELLFRQVSDAGRAFSIYRVIGDQLYPLFEGTPQ |
Ga0209154_10294644 | 3300026317 | Soil | ADGDGGELLFRQISDKGSAFVIYRVIGEQLWALFQGTPE |
Ga0209473_12069031 | 3300026330 | Soil | KYEFIDAVDSDGDGRGELLFRKTQDSGSAFGIYAVIGDRFWTLFEGKPGR |
Ga0257164_10085782 | 3300026497 | Soil | IDADGDGRGELLFRRTSDAGTSFAIYRVTADRLWPLYEGTP |
Ga0209157_11833312 | 3300026537 | Soil | AVDADGDGRGELLFRQTSDAGRAFSIYRVIGDQLYPLFEGTPQ |
Ga0209577_103365301 | 3300026552 | Soil | DAVDADGDGRGELLFRMNWDNGSAFGVYRVIGDRLWPLFEGKPGA |
Ga0209689_12113762 | 3300027748 | Soil | VDADGDGRGELLFRQVSDAGRAFSIYRVIGDQLYPLFEGTPQ |
Ga0209693_101136861 | 3300027855 | Soil | DAVDVDGDGRGELLFREVSEAGTAFVIYRVIGDRLYPLFQGTPG |
Ga0209068_100465011 | 3300027894 | Watersheds | IDAVDVDGDGRGEMLFRQVSDAGSAFVVYRVIGDRLYPLFQGMPGR |
Ga0209067_108012231 | 3300027898 | Watersheds | VDADGDGRGELLFRRTSDAGSAYAIYRVTSNGLWPLYEGTP |
Ga0209415_110982891 | 3300027905 | Peatlands Soil | GDGRGELLFRRTFDDGSAYAIYRVTADRLWPLFEGSR |
Ga0209168_105587261 | 3300027986 | Surface Soil | DGDGRGELLFRTTQDSGTAFNIYAVIGDRLWPMFEGKPGS |
Ga0257175_10537542 | 3300028673 | Soil | GRGELLFRRISDAGKAFVLYRVVGDRLWPLFEGMPGQ |
Ga0311359_108007302 | 3300029914 | Bog | DGDGRGELLFRRTFDDGSAYAIYRVTADGLWPLFEGTP |
Ga0302194_103627911 | 3300030506 | Bog | VDADGDGRGELLFRRTFDDGSAYAIYRVTADGLWPLFEGTP |
Ga0170824_1006109621 | 3300031231 | Forest Soil | KYEFIDAVDADGDGRAELLFRLTSDAGSAYAIYSVIGDKLWPLFEGKPGT |
Ga0302324_1000380798 | 3300031236 | Palsa | GDGRGELLFRRTFDDGSAYAVYRVTADRLWTLFEGTP |
Ga0170820_113769491 | 3300031446 | Forest Soil | ADGDGRGELLFRQVSDGGSAFVLYRVIGDRLWPLFQGTPGS |
Ga0170820_137411461 | 3300031446 | Forest Soil | ADGDGSGELLFRISSEAGSAFGVYRVIGDRLWPLFEGKPR |
Ga0170820_139250612 | 3300031446 | Forest Soil | VLPKYDFIDVVDVDGDGRGELLFRETWDSGTAFAVYRVIGDRLWPLFEGKPGS |
Ga0170820_140090422 | 3300031446 | Forest Soil | DADGDGRGELLFRLSSDAGSAYAIYSVIGDRLWPLFEGKSGT |
Ga0170818_1057848221 | 3300031474 | Forest Soil | DADGDGSGELLFRISSEAGSAFGVYRVIGDRLWPLFEGKPR |
Ga0170818_1073442382 | 3300031474 | Forest Soil | YEFIDAVDADGDGRAELLFRLTSDAGSAYAIYSVIGDKLWPLFEGKPGT |
Ga0307468_1000520694 | 3300031740 | Hardwood Forest Soil | DAVDADGDGRGELLFRQISAKGSAFVIYRVIGEQLWALFQGTPE |
Ga0307468_1008231661 | 3300031740 | Hardwood Forest Soil | GRGELLFRTSRDSGTAFNIYAVIGDRLWPLFEGKPGK |
Ga0307477_103417931 | 3300031753 | Hardwood Forest Soil | IDAVDVDGDGRGELLFRQVSDAGSAFVVYRVIGDRLYPLFQGAPRS |
Ga0307478_105095721 | 3300031823 | Hardwood Forest Soil | DVDGDGRAELLFREVSDTSSAFVIYRVIGDQLYPLFQGSLGE |
Ga0307478_111313811 | 3300031823 | Hardwood Forest Soil | AVDVDGDGRGELLFRQVSDAGTAFVVYRVIGNQLYALFQGTPGE |
Ga0310912_103443961 | 3300031941 | Soil | PKFQLIDVVDVDGDGRGELLFRKVYDASSAFVVYRVIGDQLYALFDGTPGASSDLVP |
Ga0318510_103628051 | 3300032064 | Soil | GRGELLFRSTSDVGKAWAVYRAGADQLFPLFEGTPPENKPPSE |
Ga0318525_102185701 | 3300032089 | Soil | AVDADGDGRGELLFRSTSDLGKAWAVYRAGADQLFPLFEGTPPENKPPSE |
Ga0311301_101311096 | 3300032160 | Peatlands Soil | DVDGDGRAELLFRQVSDTGSAFVVYRVIGDRLYPLFQGALGQ |
Ga0307472_1000634661 | 3300032205 | Hardwood Forest Soil | IDAVDVDGDGRGELLFRQNSDAGTAFVVYRVIGDRLWPLFQGTPGQGIIN |
Ga0335080_108421972 | 3300032828 | Soil | DGDGRGELLFRRTFDGGSAYAIYRVSADRLWPLFEGTP |
Ga0335081_125182561 | 3300032892 | Soil | LFRKVYDASSAFVVYRVIGDQLYALFDGAPGASSDLVP |
Ga0335077_115625911 | 3300033158 | Soil | GDGRGELLFRRTFDGGSAYAIYRVSADGLWPLWAPMP |
Ga0326728_100126211 | 3300033402 | Peat Soil | GDGRGELLFRRTFDSGSAYAIYRVTADRLWPLFEGTP |
⦗Top⦘ |