| Basic Information | |
|---|---|
| Family ID | F031187 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 183 |
| Average Sequence Length | 43 residues |
| Representative Sequence | MMAGMLTQLPLPLLPAGAAEIAPGVGLVTGEDGGGLVSVHG |
| Number of Associated Samples | 145 |
| Number of Associated Scaffolds | 183 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 92.35 % |
| % of genes near scaffold ends (potentially truncated) | 91.26 % |
| % of genes from short scaffolds (< 2000 bps) | 84.70 % |
| Associated GOLD sequencing projects | 134 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.51 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (58.470 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (22.951 % of family members) |
| Environment Ontology (ENVO) | Unclassified (22.404 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (40.984 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Fibrous | Signal Peptide: | Yes | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 17.39% Coil/Unstructured: 82.61% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.51 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 183 Family Scaffolds |
|---|---|---|
| PF00589 | Phage_integrase | 2.19 |
| PF13518 | HTH_28 | 2.19 |
| PF03050 | DDE_Tnp_IS66 | 1.64 |
| PF13006 | Nterm_IS4 | 1.64 |
| PF13560 | HTH_31 | 1.64 |
| PF12762 | DDE_Tnp_IS1595 | 1.09 |
| PF02899 | Phage_int_SAM_1 | 1.09 |
| PF09924 | LPG_synthase_C | 1.09 |
| PF13683 | rve_3 | 1.09 |
| PF13613 | HTH_Tnp_4 | 1.09 |
| PF00239 | Resolvase | 1.09 |
| PF08388 | GIIM | 1.09 |
| PF02371 | Transposase_20 | 1.09 |
| PF00583 | Acetyltransf_1 | 1.09 |
| PF00196 | GerE | 1.09 |
| PF13561 | adh_short_C2 | 1.09 |
| PF00285 | Citrate_synt | 0.55 |
| PF00561 | Abhydrolase_1 | 0.55 |
| PF02796 | HTH_7 | 0.55 |
| PF14023 | DUF4239 | 0.55 |
| PF07676 | PD40 | 0.55 |
| PF11774 | Lsr2 | 0.55 |
| PF13520 | AA_permease_2 | 0.55 |
| PF13374 | TPR_10 | 0.55 |
| PF02706 | Wzz | 0.55 |
| PF00857 | Isochorismatase | 0.55 |
| PF13440 | Polysacc_synt_3 | 0.55 |
| PF09250 | Prim-Pol | 0.55 |
| PF01527 | HTH_Tnp_1 | 0.55 |
| PF07693 | KAP_NTPase | 0.55 |
| PF03466 | LysR_substrate | 0.55 |
| PF07366 | SnoaL | 0.55 |
| PF04760 | IF2_N | 0.55 |
| PF03061 | 4HBT | 0.55 |
| PF04493 | Endonuclease_5 | 0.55 |
| PF13408 | Zn_ribbon_recom | 0.55 |
| PF13191 | AAA_16 | 0.55 |
| PF13359 | DDE_Tnp_4 | 0.55 |
| PF00078 | RVT_1 | 0.55 |
| PF08751 | TrwC | 0.55 |
| PF00903 | Glyoxalase | 0.55 |
| PF14659 | Phage_int_SAM_3 | 0.55 |
| PF00535 | Glycos_transf_2 | 0.55 |
| PF13546 | DDE_5 | 0.55 |
| PF00676 | E1_dh | 0.55 |
| PF01494 | FAD_binding_3 | 0.55 |
| PF13155 | Toprim_2 | 0.55 |
| PF00872 | Transposase_mut | 0.55 |
| PF00005 | ABC_tran | 0.55 |
| PF03446 | NAD_binding_2 | 0.55 |
| PF01061 | ABC2_membrane | 0.55 |
| PF01638 | HxlR | 0.55 |
| COG ID | Name | Functional Category | % Frequency in 183 Family Scaffolds |
|---|---|---|---|
| COG3436 | Transposase | Mobilome: prophages, transposons [X] | 1.64 |
| COG1961 | Site-specific DNA recombinase SpoIVCA/DNA invertase PinE | Replication, recombination and repair [L] | 1.09 |
| COG4974 | Site-specific recombinase XerD | Replication, recombination and repair [L] | 1.09 |
| COG4973 | Site-specific recombinase XerC | Replication, recombination and repair [L] | 1.09 |
| COG3547 | Transposase | Mobilome: prophages, transposons [X] | 1.09 |
| COG2452 | Predicted site-specific integrase-resolvase | Mobilome: prophages, transposons [X] | 1.09 |
| COG0654 | 2-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductases | Energy production and conversion [C] | 1.09 |
| COG3328 | Transposase (or an inactivated derivative) | Mobilome: prophages, transposons [X] | 0.55 |
| COG0567 | 2-oxoglutarate dehydrogenase complex, dehydrogenase (E1) component, and related enzymes | Energy production and conversion [C] | 0.55 |
| COG0578 | Glycerol-3-phosphate dehydrogenase | Energy production and conversion [C] | 0.55 |
| COG4928 | Predicted P-loop ATPase, KAP-like | General function prediction only [R] | 0.55 |
| COG3944 | Capsular polysaccharide biosynthesis protein YveK | Cell wall/membrane/envelope biogenesis [M] | 0.55 |
| COG3765 | LPS O-antigen chain length determinant protein, WzzB/FepE family | Cell wall/membrane/envelope biogenesis [M] | 0.55 |
| COG0644 | Dehydrogenase (flavoprotein) | Energy production and conversion [C] | 0.55 |
| COG3524 | Capsule polysaccharide export protein KpsE/RkpR | Cell wall/membrane/envelope biogenesis [M] | 0.55 |
| COG1071 | TPP-dependent pyruvate or acetoin dehydrogenase subunit alpha | Energy production and conversion [C] | 0.55 |
| COG3206 | Exopolysaccharide export protein/domain GumC/Wzc1 | Cell wall/membrane/envelope biogenesis [M] | 0.55 |
| COG0665 | Glycine/D-amino acid oxidase (deaminating) | Amino acid transport and metabolism [E] | 0.55 |
| COG0372 | Citrate synthase | Energy production and conversion [C] | 0.55 |
| COG1733 | DNA-binding transcriptional regulator, HxlR family | Transcription [K] | 0.55 |
| COG1535 | Isochorismate hydrolase | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.55 |
| COG1515 | Deoxyinosine 3'-endonuclease (endonuclease V) | Replication, recombination and repair [L] | 0.55 |
| COG1335 | Nicotinamidase-related amidase | Coenzyme transport and metabolism [H] | 0.55 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 59.02 % |
| Unclassified | root | N/A | 40.98 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2170459024|GZRSKLJ01EZNTQ | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 530 | Open in IMG/M |
| 3300001356|JGI12269J14319_10048265 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2571 | Open in IMG/M |
| 3300004479|Ga0062595_101626702 | Not Available | 604 | Open in IMG/M |
| 3300005434|Ga0070709_10073803 | Not Available | 2209 | Open in IMG/M |
| 3300005435|Ga0070714_102051640 | Not Available | 557 | Open in IMG/M |
| 3300005435|Ga0070714_102211427 | Not Available | 535 | Open in IMG/M |
| 3300005439|Ga0070711_101421789 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 604 | Open in IMG/M |
| 3300005445|Ga0070708_102260070 | Not Available | 502 | Open in IMG/M |
| 3300005467|Ga0070706_100297878 | Not Available | 1505 | Open in IMG/M |
| 3300005468|Ga0070707_100029225 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 5248 | Open in IMG/M |
| 3300005558|Ga0066698_10061105 | Not Available | 2405 | Open in IMG/M |
| 3300005610|Ga0070763_10159097 | All Organisms → cellular organisms → Bacteria | 1184 | Open in IMG/M |
| 3300005938|Ga0066795_10193024 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 606 | Open in IMG/M |
| 3300006028|Ga0070717_10040615 | All Organisms → cellular organisms → Bacteria | 3790 | Open in IMG/M |
| 3300006052|Ga0075029_101182271 | Not Available | 533 | Open in IMG/M |
| 3300006175|Ga0070712_100319320 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1262 | Open in IMG/M |
| 3300006175|Ga0070712_101141745 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 677 | Open in IMG/M |
| 3300006175|Ga0070712_101543695 | Not Available | 580 | Open in IMG/M |
| 3300006175|Ga0070712_101729659 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Micromonospora → Micromonospora olivasterospora | 547 | Open in IMG/M |
| 3300006800|Ga0066660_11264419 | Not Available | 578 | Open in IMG/M |
| 3300009029|Ga0066793_10691580 | Not Available | 579 | Open in IMG/M |
| 3300009520|Ga0116214_1070558 | All Organisms → cellular organisms → Bacteria | 1274 | Open in IMG/M |
| 3300009521|Ga0116222_1022230 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2859 | Open in IMG/M |
| 3300009521|Ga0116222_1473090 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 547 | Open in IMG/M |
| 3300009522|Ga0116218_1089541 | Not Available | 1401 | Open in IMG/M |
| 3300009522|Ga0116218_1154555 | All Organisms → cellular organisms → Bacteria | 1041 | Open in IMG/M |
| 3300009522|Ga0116218_1517287 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 532 | Open in IMG/M |
| 3300009525|Ga0116220_10269850 | Not Available | 745 | Open in IMG/M |
| 3300009683|Ga0116224_10175013 | Not Available | 1030 | Open in IMG/M |
| 3300009683|Ga0116224_10393384 | Not Available | 659 | Open in IMG/M |
| 3300009698|Ga0116216_10428808 | Not Available | 801 | Open in IMG/M |
| 3300009700|Ga0116217_10264618 | Not Available | 1113 | Open in IMG/M |
| 3300009824|Ga0116219_10408531 | Not Available | 757 | Open in IMG/M |
| 3300010379|Ga0136449_100167457 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 4263 | Open in IMG/M |
| 3300010379|Ga0136449_100769822 | Not Available | 1598 | Open in IMG/M |
| 3300010379|Ga0136449_100893619 | Not Available | 1449 | Open in IMG/M |
| 3300010379|Ga0136449_101283136 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1144 | Open in IMG/M |
| 3300010379|Ga0136449_101956640 | Not Available | 868 | Open in IMG/M |
| 3300010379|Ga0136449_102280516 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 786 | Open in IMG/M |
| 3300010379|Ga0136449_102402499 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 760 | Open in IMG/M |
| 3300010396|Ga0134126_11558578 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 727 | Open in IMG/M |
| 3300010398|Ga0126383_11587592 | Not Available | 744 | Open in IMG/M |
| 3300011068|Ga0138599_1010147 | Not Available | 832 | Open in IMG/M |
| 3300011270|Ga0137391_11161625 | Not Available | 620 | Open in IMG/M |
| 3300012201|Ga0137365_10361721 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Kribbellaceae → Kribbella → unclassified Kribbella → Kribbella sp. VKM Ac-2573 | 1072 | Open in IMG/M |
| 3300012209|Ga0137379_10336710 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1419 | Open in IMG/M |
| 3300012209|Ga0137379_10407999 | All Organisms → cellular organisms → Bacteria | 1268 | Open in IMG/M |
| 3300012353|Ga0137367_10296287 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae | 1158 | Open in IMG/M |
| 3300012363|Ga0137390_11604617 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 588 | Open in IMG/M |
| 3300012363|Ga0137390_11774462 | Not Available | 549 | Open in IMG/M |
| 3300012925|Ga0137419_11701280 | Not Available | 538 | Open in IMG/M |
| 3300013102|Ga0157371_11516026 | Not Available | 523 | Open in IMG/M |
| 3300015372|Ga0132256_101940680 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 696 | Open in IMG/M |
| 3300015374|Ga0132255_103053286 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 714 | Open in IMG/M |
| 3300016319|Ga0182033_10448438 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura → Actinomadura macrotermitis | 1100 | Open in IMG/M |
| 3300016357|Ga0182032_10420994 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → unclassified Streptomyces → Streptomyces sp. | 1084 | Open in IMG/M |
| 3300016445|Ga0182038_12196425 | Not Available | 500 | Open in IMG/M |
| 3300017821|Ga0187812_1065151 | Not Available | 1215 | Open in IMG/M |
| 3300017821|Ga0187812_1209747 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 622 | Open in IMG/M |
| 3300017926|Ga0187807_1144072 | Not Available | 760 | Open in IMG/M |
| 3300017926|Ga0187807_1321265 | Not Available | 517 | Open in IMG/M |
| 3300017932|Ga0187814_10106081 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1038 | Open in IMG/M |
| 3300017932|Ga0187814_10279829 | All Organisms → cellular organisms → Bacteria | 636 | Open in IMG/M |
| 3300017939|Ga0187775_10022329 | All Organisms → cellular organisms → Bacteria | 1744 | Open in IMG/M |
| 3300017959|Ga0187779_10830275 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 632 | Open in IMG/M |
| 3300017972|Ga0187781_10701856 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 732 | Open in IMG/M |
| 3300017972|Ga0187781_10980415 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 617 | Open in IMG/M |
| 3300017999|Ga0187767_10174176 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura | 662 | Open in IMG/M |
| 3300018006|Ga0187804_10366479 | Not Available | 635 | Open in IMG/M |
| 3300018018|Ga0187886_1136139 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 988 | Open in IMG/M |
| 3300018019|Ga0187874_10167148 | All Organisms → cellular organisms → Bacteria | 924 | Open in IMG/M |
| 3300018025|Ga0187885_10215113 | All Organisms → cellular organisms → Bacteria | 886 | Open in IMG/M |
| 3300018032|Ga0187788_10537871 | Not Available | 510 | Open in IMG/M |
| 3300018035|Ga0187875_10605322 | Not Available | 578 | Open in IMG/M |
| 3300018038|Ga0187855_10380572 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → unclassified Acidimicrobiia → Acidimicrobiia bacterium | 823 | Open in IMG/M |
| 3300018058|Ga0187766_10557942 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 777 | Open in IMG/M |
| 3300018085|Ga0187772_10268664 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1162 | Open in IMG/M |
| 3300018086|Ga0187769_10092487 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 2163 | Open in IMG/M |
| 3300018090|Ga0187770_11771207 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 505 | Open in IMG/M |
| 3300021374|Ga0213881_10069435 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae | 1504 | Open in IMG/M |
| 3300021401|Ga0210393_10316314 | Not Available | 1269 | Open in IMG/M |
| 3300021403|Ga0210397_10058443 | Not Available | 2494 | Open in IMG/M |
| 3300021478|Ga0210402_10015166 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 6587 | Open in IMG/M |
| 3300021559|Ga0210409_10310120 | Not Available | 1421 | Open in IMG/M |
| 3300025898|Ga0207692_10124530 | Not Available | 1448 | Open in IMG/M |
| 3300025906|Ga0207699_10099717 | Not Available | 1841 | Open in IMG/M |
| 3300025910|Ga0207684_10367707 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1237 | Open in IMG/M |
| 3300025915|Ga0207693_10783241 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 735 | Open in IMG/M |
| 3300025915|Ga0207693_10873375 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → unclassified Streptomyces → Streptomyces sp. Ag82_O1-15 | 691 | Open in IMG/M |
| 3300025928|Ga0207700_11519400 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 594 | Open in IMG/M |
| 3300026340|Ga0257162_1012212 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1006 | Open in IMG/M |
| 3300026734|Ga0208211_100071 | Not Available | 2057 | Open in IMG/M |
| 3300027497|Ga0208199_1006165 | Not Available | 2999 | Open in IMG/M |
| 3300027497|Ga0208199_1010080 | Not Available | 2226 | Open in IMG/M |
| 3300027662|Ga0208565_1009350 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 4044 | Open in IMG/M |
| 3300027662|Ga0208565_1116823 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 794 | Open in IMG/M |
| 3300027829|Ga0209773_10474046 | All Organisms → cellular organisms → Bacteria | 516 | Open in IMG/M |
| 3300027842|Ga0209580_10319023 | Not Available | 774 | Open in IMG/M |
| 3300027854|Ga0209517_10109814 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1837 | Open in IMG/M |
| 3300027903|Ga0209488_10788485 | All Organisms → cellular organisms → Bacteria | 674 | Open in IMG/M |
| 3300027903|Ga0209488_11009654 | Not Available | 575 | Open in IMG/M |
| 3300027905|Ga0209415_10221096 | Not Available | 1752 | Open in IMG/M |
| 3300028742|Ga0302220_10272957 | Not Available | 618 | Open in IMG/M |
| 3300028747|Ga0302219_10106374 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1063 | Open in IMG/M |
| 3300028759|Ga0302224_10144247 | Not Available | 931 | Open in IMG/M |
| 3300028775|Ga0302231_10044436 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1877 | Open in IMG/M |
| 3300028801|Ga0302226_10397094 | Not Available | 577 | Open in IMG/M |
| 3300028884|Ga0307308_10218916 | Not Available | 912 | Open in IMG/M |
| 3300029943|Ga0311340_10196543 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2038 | Open in IMG/M |
| 3300029943|Ga0311340_11505627 | Not Available | 527 | Open in IMG/M |
| 3300029944|Ga0311352_10248456 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1497 | Open in IMG/M |
| 3300029999|Ga0311339_10063520 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 4822 | Open in IMG/M |
| 3300029999|Ga0311339_10166404 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2559 | Open in IMG/M |
| 3300030007|Ga0311338_10017322 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 10542 | Open in IMG/M |
| 3300030007|Ga0311338_11438316 | Not Available | 639 | Open in IMG/M |
| 3300030043|Ga0302306_10154824 | Not Available | 884 | Open in IMG/M |
| 3300030056|Ga0302181_10065214 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1874 | Open in IMG/M |
| 3300030058|Ga0302179_10302205 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 705 | Open in IMG/M |
| 3300030399|Ga0311353_10131803 | All Organisms → Viruses → Predicted Viral | 2401 | Open in IMG/M |
| 3300030490|Ga0302184_10439646 | Not Available | 502 | Open in IMG/M |
| 3300030494|Ga0310037_10030668 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2588 | Open in IMG/M |
| 3300030578|Ga0210275_10314978 | Not Available | 550 | Open in IMG/M |
| 3300030659|Ga0316363_10026635 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 3025 | Open in IMG/M |
| 3300030707|Ga0310038_10493766 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 518 | Open in IMG/M |
| 3300031234|Ga0302325_10004061 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 33973 | Open in IMG/M |
| 3300031236|Ga0302324_100090579 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae | 5230 | Open in IMG/M |
| 3300031236|Ga0302324_100095182 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 5071 | Open in IMG/M |
| 3300031446|Ga0170820_11894831 | Not Available | 925 | Open in IMG/M |
| 3300031474|Ga0170818_104851504 | Not Available | 506 | Open in IMG/M |
| 3300031525|Ga0302326_12757457 | Not Available | 608 | Open in IMG/M |
| 3300031543|Ga0318516_10499422 | Not Available | 698 | Open in IMG/M |
| 3300031561|Ga0318528_10162127 | Not Available | 1193 | Open in IMG/M |
| 3300031561|Ga0318528_10225453 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Nonomuraea → Nonomuraea solani | 1004 | Open in IMG/M |
| 3300031564|Ga0318573_10170001 | Not Available | 1149 | Open in IMG/M |
| 3300031572|Ga0318515_10589415 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Actinoplanes → unclassified Actinoplanes → Actinoplanes sp. TBRC 11911 | 591 | Open in IMG/M |
| 3300031640|Ga0318555_10152609 | Not Available | 1237 | Open in IMG/M |
| 3300031668|Ga0318542_10041847 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 2039 | Open in IMG/M |
| 3300031671|Ga0307372_10059600 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 3521 | Open in IMG/M |
| 3300031680|Ga0318574_10048635 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2223 | Open in IMG/M |
| 3300031681|Ga0318572_10681517 | Not Available | 612 | Open in IMG/M |
| 3300031708|Ga0310686_103379933 | All Organisms → cellular organisms → Bacteria | 1408 | Open in IMG/M |
| 3300031708|Ga0310686_107847571 | Not Available | 578 | Open in IMG/M |
| 3300031713|Ga0318496_10772987 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 529 | Open in IMG/M |
| 3300031751|Ga0318494_10887560 | Not Available | 523 | Open in IMG/M |
| 3300031751|Ga0318494_10952902 | Not Available | 504 | Open in IMG/M |
| 3300031769|Ga0318526_10177773 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Thermomonospora → Thermomonospora cellulosilytica | 868 | Open in IMG/M |
| 3300031770|Ga0318521_10496018 | All Organisms → cellular organisms → Bacteria | 733 | Open in IMG/M |
| 3300031771|Ga0318546_10126968 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1700 | Open in IMG/M |
| 3300031777|Ga0318543_10138416 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1065 | Open in IMG/M |
| 3300031777|Ga0318543_10494573 | Not Available | 548 | Open in IMG/M |
| 3300031788|Ga0302319_11901804 | Not Available | 509 | Open in IMG/M |
| 3300031805|Ga0318497_10549644 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 647 | Open in IMG/M |
| 3300031879|Ga0306919_10806676 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Brevibacteriaceae → Spelaeicoccus → Spelaeicoccus albus | 721 | Open in IMG/M |
| 3300031946|Ga0310910_10948014 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 674 | Open in IMG/M |
| 3300031954|Ga0306926_12981122 | Not Available | 506 | Open in IMG/M |
| 3300031959|Ga0318530_10084669 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1244 | Open in IMG/M |
| 3300032010|Ga0318569_10059841 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1666 | Open in IMG/M |
| 3300032025|Ga0318507_10267017 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 743 | Open in IMG/M |
| 3300032035|Ga0310911_10662376 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura → Actinomadura macrotermitis | 605 | Open in IMG/M |
| 3300032035|Ga0310911_10738899 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Actinoplanes | 570 | Open in IMG/M |
| 3300032039|Ga0318559_10226917 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 861 | Open in IMG/M |
| 3300032041|Ga0318549_10459271 | All Organisms → cellular organisms → Bacteria | 573 | Open in IMG/M |
| 3300032044|Ga0318558_10142007 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 1151 | Open in IMG/M |
| 3300032054|Ga0318570_10261485 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Brevibacteriaceae → Spelaeicoccus → Spelaeicoccus albus | 785 | Open in IMG/M |
| 3300032055|Ga0318575_10412849 | Not Available | 685 | Open in IMG/M |
| 3300032055|Ga0318575_10415005 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 683 | Open in IMG/M |
| 3300032059|Ga0318533_11287132 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 534 | Open in IMG/M |
| 3300032060|Ga0318505_10484746 | Not Available | 584 | Open in IMG/M |
| 3300032064|Ga0318510_10452702 | Not Available | 551 | Open in IMG/M |
| 3300032067|Ga0318524_10466639 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Actinoplanes | 661 | Open in IMG/M |
| 3300032091|Ga0318577_10194989 | Not Available | 968 | Open in IMG/M |
| 3300032094|Ga0318540_10496887 | Not Available | 589 | Open in IMG/M |
| 3300032160|Ga0311301_10549232 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 1689 | Open in IMG/M |
| 3300032160|Ga0311301_11746087 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 745 | Open in IMG/M |
| 3300032160|Ga0311301_12667526 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 551 | Open in IMG/M |
| 3300032770|Ga0335085_11082338 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 860 | Open in IMG/M |
| 3300032770|Ga0335085_11106627 | All Organisms → cellular organisms → Bacteria | 848 | Open in IMG/M |
| 3300032770|Ga0335085_11589217 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Geodermatophilales → Geodermatophilaceae → Geodermatophilus → Geodermatophilus amargosae | 678 | Open in IMG/M |
| 3300032805|Ga0335078_10035728 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 7377 | Open in IMG/M |
| 3300032829|Ga0335070_11860893 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 544 | Open in IMG/M |
| 3300032895|Ga0335074_11564366 | Not Available | 519 | Open in IMG/M |
| 3300033158|Ga0335077_10307371 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1733 | Open in IMG/M |
| 3300034124|Ga0370483_0349814 | Not Available | 512 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 22.95% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 18.03% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 11.48% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 8.74% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 5.46% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 5.46% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 3.83% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 3.83% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 2.73% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.73% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.64% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 1.09% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.09% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 1.09% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 1.09% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 0.55% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.55% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.55% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 0.55% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grass Soil | 0.55% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.55% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.55% |
| Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 0.55% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 0.55% |
| Prmafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Prmafrost Soil | 0.55% |
| Soil | Environmental → Terrestrial → Soil → Clay → Unclassified → Soil | 0.55% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 0.55% |
| Exposed Rock | Environmental → Terrestrial → Rock-Dwelling (Subaerial Biofilms) → Unclassified → Unclassified → Exposed Rock | 0.55% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.55% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.55% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.55% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2170459024 | Grass soil microbial communities from Rothamsted Park, UK - FD1 (NaCl 300g/L 5ml) | Environmental | Open in IMG/M |
| 3300001356 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 | Environmental | Open in IMG/M |
| 3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
| 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
| 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
| 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
| 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
| 3300005558 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 | Environmental | Open in IMG/M |
| 3300005610 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 | Environmental | Open in IMG/M |
| 3300005938 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 2 DNA2013-191 | Environmental | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006052 | Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013 | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
| 3300009029 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 1 DNA2013-189 | Environmental | Open in IMG/M |
| 3300009520 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_1_NS metaG | Environmental | Open in IMG/M |
| 3300009521 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_9_AC metaG | Environmental | Open in IMG/M |
| 3300009522 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_5_LS metaG | Environmental | Open in IMG/M |
| 3300009525 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_7_NC metaG | Environmental | Open in IMG/M |
| 3300009683 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_b_LC metaG | Environmental | Open in IMG/M |
| 3300009698 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG | Environmental | Open in IMG/M |
| 3300009700 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG | Environmental | Open in IMG/M |
| 3300009824 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaG | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300011068 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 67 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012353 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Host-Associated | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
| 3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
| 3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
| 3300017821 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_2 | Environmental | Open in IMG/M |
| 3300017926 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_2 | Environmental | Open in IMG/M |
| 3300017932 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_4 | Environmental | Open in IMG/M |
| 3300017939 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_10_MG | Environmental | Open in IMG/M |
| 3300017959 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MG | Environmental | Open in IMG/M |
| 3300017972 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300017999 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP10_10_MG | Environmental | Open in IMG/M |
| 3300018006 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_4 | Environmental | Open in IMG/M |
| 3300018018 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_150 | Environmental | Open in IMG/M |
| 3300018019 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_150 | Environmental | Open in IMG/M |
| 3300018025 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_100 | Environmental | Open in IMG/M |
| 3300018032 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_BV01_MP10_20_MG | Environmental | Open in IMG/M |
| 3300018035 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_10 | Environmental | Open in IMG/M |
| 3300018038 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_10 | Environmental | Open in IMG/M |
| 3300018058 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MG | Environmental | Open in IMG/M |
| 3300018085 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018086 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MG | Environmental | Open in IMG/M |
| 3300018090 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300021374 | Barbacenia macrantha exposed rock microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - ER_R08 | Environmental | Open in IMG/M |
| 3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
| 3300021403 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026340 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NR-04-A | Environmental | Open in IMG/M |
| 3300026734 | Forest soil microbial communities from Willamette National Forest, Oregon, USA, amended with Nitrogen - NN393 (SPAdes) | Environmental | Open in IMG/M |
| 3300027497 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_1_NS metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027662 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_2_FS metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027829 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027842 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027854 | Peat soil microbial communities from Weissenstadt, Germany - SII-2010 (SPAdes) | Environmental | Open in IMG/M |
| 3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027905 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 (SPAdes) | Environmental | Open in IMG/M |
| 3300028742 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E1_3 | Environmental | Open in IMG/M |
| 3300028747 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E1_2 | Environmental | Open in IMG/M |
| 3300028759 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E3_1 | Environmental | Open in IMG/M |
| 3300028775 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N2_2 | Environmental | Open in IMG/M |
| 3300028801 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E3_3 | Environmental | Open in IMG/M |
| 3300028884 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_195 | Environmental | Open in IMG/M |
| 3300029943 | I_Palsa_N3 coassembly | Environmental | Open in IMG/M |
| 3300029944 | II_Palsa_E1 coassembly | Environmental | Open in IMG/M |
| 3300029999 | I_Palsa_E3 coassembly | Environmental | Open in IMG/M |
| 3300030007 | I_Palsa_E1 coassembly | Environmental | Open in IMG/M |
| 3300030043 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E3_1 | Environmental | Open in IMG/M |
| 3300030056 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E3_3 | Environmental | Open in IMG/M |
| 3300030058 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E3_1 | Environmental | Open in IMG/M |
| 3300030399 | II_Palsa_E2 coassembly | Environmental | Open in IMG/M |
| 3300030490 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_N3_3 | Environmental | Open in IMG/M |
| 3300030494 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG (v2) | Environmental | Open in IMG/M |
| 3300030578 | Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO105-VCO054SO (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030659 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaG (v2) | Environmental | Open in IMG/M |
| 3300030707 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG (v2) | Environmental | Open in IMG/M |
| 3300031234 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2 | Environmental | Open in IMG/M |
| 3300031236 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1 | Environmental | Open in IMG/M |
| 3300031446 | Fir Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031474 | Fir Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031525 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_3 | Environmental | Open in IMG/M |
| 3300031543 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20 | Environmental | Open in IMG/M |
| 3300031561 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26 | Environmental | Open in IMG/M |
| 3300031564 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21 | Environmental | Open in IMG/M |
| 3300031572 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19 | Environmental | Open in IMG/M |
| 3300031640 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23 | Environmental | Open in IMG/M |
| 3300031668 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f23 | Environmental | Open in IMG/M |
| 3300031671 | Soil microbial communities from Risofladan, Vaasa, Finland - OX-1 | Environmental | Open in IMG/M |
| 3300031680 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22 | Environmental | Open in IMG/M |
| 3300031681 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20 | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031713 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f22 | Environmental | Open in IMG/M |
| 3300031751 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f24 | Environmental | Open in IMG/M |
| 3300031769 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f24 | Environmental | Open in IMG/M |
| 3300031770 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17 | Environmental | Open in IMG/M |
| 3300031771 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19 | Environmental | Open in IMG/M |
| 3300031777 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f24 | Environmental | Open in IMG/M |
| 3300031788 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Bog_T0_2 | Environmental | Open in IMG/M |
| 3300031805 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f23 | Environmental | Open in IMG/M |
| 3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
| 3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300031959 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f24 | Environmental | Open in IMG/M |
| 3300032010 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f22 | Environmental | Open in IMG/M |
| 3300032025 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f20 | Environmental | Open in IMG/M |
| 3300032035 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF170 | Environmental | Open in IMG/M |
| 3300032039 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f21 | Environmental | Open in IMG/M |
| 3300032041 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f22 | Environmental | Open in IMG/M |
| 3300032044 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f20 | Environmental | Open in IMG/M |
| 3300032054 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f23 | Environmental | Open in IMG/M |
| 3300032055 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f23 | Environmental | Open in IMG/M |
| 3300032059 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27 | Environmental | Open in IMG/M |
| 3300032060 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f18 | Environmental | Open in IMG/M |
| 3300032064 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f17 | Environmental | Open in IMG/M |
| 3300032067 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f22 | Environmental | Open in IMG/M |
| 3300032091 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f25 | Environmental | Open in IMG/M |
| 3300032094 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f25 | Environmental | Open in IMG/M |
| 3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
| 3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
| 3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
| 3300032829 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3 | Environmental | Open in IMG/M |
| 3300032895 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.3 | Environmental | Open in IMG/M |
| 3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
| 3300034124 | Peat soil microbial communities from wetlands in Alaska, United States - Goldstream_06D_14 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| FD1_11126230 | 2170459024 | Grass Soil | MMAGMLTQLPLPLLPAGAAEIAPGVGLVTGDGGGLVVVHGLATFAWGRRG |
| JGI12269J14319_100482651 | 3300001356 | Peatlands Soil | MMARMLSQLPLPLLPAGAAEIAPGVGLLAGEDGGLV |
| Ga0062595_1016267021 | 3300004479 | Soil | ARMLSQLPLPLLSGGAAQIAPGVGMLAGEDGGLVTVHGLATFA* |
| Ga0070709_100738032 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | MARMLSQLPLPLLPAGAAEIAPGVGLAAGGDGSGLVTVHGLATFA |
| Ga0070714_1020516402 | 3300005435 | Agricultural Soil | MQWQGRAGLGWMMAGMLTQLPLPLLPAGAAELAPGVGLVTGDD |
| Ga0070714_1022114271 | 3300005435 | Agricultural Soil | MARMLSQLPLPLLPAGAAEIAPGVGLAAGGDGSGLVTVHG |
| Ga0070711_1014217892 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | MMARMLSQLPLPLLSGGAAQIAPGVGMLAGEDGGLVTVHGLATFA* |
| Ga0070708_1022600702 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MMARMLTQAPLPWLPADAEEVAPGVGVQPSGDGGGVAWVRGLATFAWDGGDEAARRLA |
| Ga0070706_1002978781 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | MMARMLSQLPLPLLPPGATEIAPGVGLVMGEEGGLVAVHGLATFAW |
| Ga0070707_1000292255 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | MMAGMLTQLPLPLLPAGAAEIAPGVGLVAGEGGGGLVSVHGLAAFAWDAGDE |
| Ga0066698_100611051 | 3300005558 | Soil | EKINAVTGPGGMGWMMAGMLTQLPLPLLPAGAAEIAPGVGLVTGDDGGLV* |
| Ga0070763_101590971 | 3300005610 | Soil | MMARMLSQLPLPLLPAGAAEIAPGVGLLGGEDGGLVVVHGLA |
| Ga0066795_101930242 | 3300005938 | Soil | MARMLTQVPLPLLPQDAAEIAPGVGVVAGPDGGGVV |
| Ga0070717_100406151 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MARMLTQVPLPLLPGDAAEIAPGVGMVTGPDGSGVMWVHGLATFAW |
| Ga0075029_1011822712 | 3300006052 | Watersheds | MARMLTQVPLPLLPGDAAEIAPGVGMVTGPDGSGVMWVHG |
| Ga0070712_1003193201 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | MARMLSQLPLPLLPPGAAEIAPGVGLLADEDGGS* |
| Ga0070712_1011417451 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | MMARMLSQLPLPLLSGGAAQIAPGVGMLAGEDGGLVTVHGLAT |
| Ga0070712_1015436951 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | MMAGMLTQLPLPLLPAGAAEIAPGVGLVTGAGGGLVSVHGLA |
| Ga0070712_1017296592 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | MARMLSQLPLPLLPAGAAEIAPGVGLAAGGDGSGLVTVHGLATFAWDAGDEAGR |
| Ga0066660_112644191 | 3300006800 | Soil | MARMLSQLPLPLLPSGAAEIAPGVGLAAGGDGSGLVTVHGLATF |
| Ga0066793_106915801 | 3300009029 | Prmafrost Soil | MMARMLTQVPLPLLPHDAAEIAPGVGVVADPDGGGVVWV |
| Ga0116214_10705583 | 3300009520 | Peatlands Soil | MMAGMLTQLPLPLLPAGAAEIAPGVGLLTGDDGGGLVSVHGLA |
| Ga0116222_10222301 | 3300009521 | Peatlands Soil | MMARMLTQVPLPLLPHDAAEIAPGVGVVAGPDGAGV |
| Ga0116222_14730901 | 3300009521 | Peatlands Soil | MMARMLTQVPLPLLPHDAAEIAPGVGVVAGPDGGGVVWVH |
| Ga0116218_10895414 | 3300009522 | Peatlands Soil | MMARMLTQVPLPLLPHDAAEIAPGVGVVAGPDGAGVV |
| Ga0116218_11545551 | 3300009522 | Peatlands Soil | MMARMLTQVPLPLLPQDAAEIAPGVGVVTGPDGGGVVWVHGLATFAWDAGDEA |
| Ga0116218_15172871 | 3300009522 | Peatlands Soil | MMARMLTQVPLPLLPHDAAEIAPGVGVVAGPDGGGVVWV |
| Ga0116220_102698501 | 3300009525 | Peatlands Soil | MMARMLTHVPLPLLPHDAAEMAPGVGVVSGADGSSVVWVHGLAT |
| Ga0116224_101750131 | 3300009683 | Peatlands Soil | MMARMLTQVPLPLLPRDAAEIAPGVGVVAGPDGGGVVWVHGLAT |
| Ga0116224_103933842 | 3300009683 | Peatlands Soil | MLSQLPLPLLLAGAAELAPGVGLLTGDDGGLVTVH |
| Ga0116216_104288081 | 3300009698 | Peatlands Soil | MMAGMLTQLPLPLLPAGAAEIAPGVGLLTGDDGGGLVSVHGLATFA |
| Ga0116217_102646181 | 3300009700 | Peatlands Soil | MMARMLTQVPLPLLPHDAAEIAPGVGVVAGPDGGGV |
| Ga0116219_104085311 | 3300009824 | Peatlands Soil | MMARMLTQLPLPLLPGNAREITAGVCVVDGPDGGGVVWVHGLATFAWDA |
| Ga0136449_1001674571 | 3300010379 | Peatlands Soil | MMGRMLTQVPLPLLPRDAAEIAPGVGVVAGPDGGGVVWVHGLATFAWD |
| Ga0136449_1007698221 | 3300010379 | Peatlands Soil | MMAGMLTQLPLPLLPAGAAELAPGVGLVTGDDGGGLVSVHGLATFA* |
| Ga0136449_1008936192 | 3300010379 | Peatlands Soil | MMARMLIQVPLPLLPGDAAEIAPGVGMVTGPDGSGVMWVHGLATF |
| Ga0136449_1012831361 | 3300010379 | Peatlands Soil | MLSQLPLPLLPAGAAEIAPGVGLLAGEDGGLVAVHGL |
| Ga0136449_1019566401 | 3300010379 | Peatlands Soil | MMTAMLTQVPLPWLPGDAEEIAPGVGVVAGDDGGGVVWVHGLATFAWDGGDEAARRL |
| Ga0136449_1022805161 | 3300010379 | Peatlands Soil | MLSQLPLPLLPARAAEIAPGVGMLAGEDGGLVTVHGLATFAWD |
| Ga0136449_1024024991 | 3300010379 | Peatlands Soil | MMARMLTQVPLPLLPRDAAEIAPGVGVVAGPDGSGVVW |
| Ga0134126_115585782 | 3300010396 | Terrestrial Soil | MMARMLSQLPLPLLPAGAAEIAPGVGLAAGGDGSGLVTVH |
| Ga0126383_115875922 | 3300010398 | Tropical Forest Soil | MMTAMLTQLPLPWLPEGATEIAPGVGLAAGPDGGVVWVHGMA |
| Ga0138599_10101471 | 3300011068 | Peatlands Soil | MMARMLTQVPLPLLPQDAAEIAPGVGVVTGPDGGG |
| Ga0137391_111616251 | 3300011270 | Vadose Zone Soil | MMGRMLNQPVLPLLPEGAAEIAPGVGIVTGTDGGGLVTVQGLATFAW |
| Ga0137365_103617211 | 3300012201 | Vadose Zone Soil | MMARMLTQVPLPLLPHDAAEIAPGVGVVAGPDGGGVVWVHGL |
| Ga0137379_103367101 | 3300012209 | Vadose Zone Soil | MLTQPVLPLLPDGAAEVGPGAGLVTGPDGGGLVMVHGLATF |
| Ga0137379_104079991 | 3300012209 | Vadose Zone Soil | MMTAMLTQLPLPWLPEGATEIAPGVGLAAGPGGGVVW |
| Ga0137367_102962873 | 3300012353 | Vadose Zone Soil | MLSQLPLPLLPAGAAEIAPGVGLLAGEDGGLVAVHGLAAFA |
| Ga0137390_116046172 | 3300012363 | Vadose Zone Soil | MMARMLTQVPLPLLPQGAAEIAPGVGVVAGPDGGGVVWVHGLATFAWDA |
| Ga0137390_117744622 | 3300012363 | Vadose Zone Soil | MMGRMLTQPVLPLLPEGAAEIAPGVGIVTGTDGGGLVTVQGLATFAWDGGD |
| Ga0137419_117012801 | 3300012925 | Vadose Zone Soil | MMGRMLTQPVLPLLPEGAAEIAPGVGIVTGTDGGGLVTVQGLATFAW |
| Ga0157371_115160262 | 3300013102 | Corn Rhizosphere | MLSQLPLPLLSGGAAQIAPGVGMLAGEDGGLVTVHGLATFA* |
| Ga0132256_1019406801 | 3300015372 | Arabidopsis Rhizosphere | MMAGMLTQLPLPLLPAGAAEIAPGVGLVTGEDGGGLVS |
| Ga0132255_1030532861 | 3300015374 | Arabidopsis Rhizosphere | MLSQLPLPLLPAGAAEIAPGVGMLAGGDGGGLVTVH |
| Ga0182033_104484382 | 3300016319 | Soil | MGPGEMGWMMARMLSQLPLPLLPAGAAEIAPGVGLVAGDDGGGLVSVH |
| Ga0182032_104209941 | 3300016357 | Soil | MGWMMAGMLTQLPLPLLPAGAAEIAHGVGLVTGAGGGGLVSVH |
| Ga0182038_121964251 | 3300016445 | Soil | MAGMLSQLPLPLLPAGAAEIAPGVGLVTGAGGGGLVSVHGLATFAWDAGDEA |
| Ga0187812_10651511 | 3300017821 | Freshwater Sediment | MMARLLSQLPLPLLPAGAAEIAPAVGLLAGEEGGLVTVHGLATFAW |
| Ga0187812_12097473 | 3300017821 | Freshwater Sediment | MMAGMLTQLPLPLLPAGAAEIAPGVGLVTGDDGGGLVSVHGLATFAWD |
| Ga0187807_11440721 | 3300017926 | Freshwater Sediment | MARMLTQLPLPLLPGGAREIAPGAGVVDGPDGGGVVWVHGLA |
| Ga0187807_13212651 | 3300017926 | Freshwater Sediment | MMARMLSQLPLPLLPAGAAEIAPGVGLLAGDEGGLVTVHG |
| Ga0187814_101060811 | 3300017932 | Freshwater Sediment | MGWMMAGMLTQLPLPLLPAGAAEIAPGVGLVCGEDGGGLVS |
| Ga0187814_102798291 | 3300017932 | Freshwater Sediment | MGWMMAGMLTQLPLPLLPAGAAEIAPGVALVTGEDG |
| Ga0187775_100223291 | 3300017939 | Tropical Peatland | MMGHVLSQPVLPLLPAGAVEIAPGVGLVTEPDGGGLVVVHGLATFGWD |
| Ga0187779_108302751 | 3300017959 | Tropical Peatland | MAGMLTQVPLPLLPGNAREFVPGVGVVDGPDGGGVVWVHGLATFA |
| Ga0187781_107018562 | 3300017972 | Tropical Peatland | MMARMLSQLPLPLLPAGAAGIAPGVGLLAGDDGGLVIVHGL |
| Ga0187781_109804152 | 3300017972 | Tropical Peatland | MMAGMLTQLPLPLLPAGAAEIAPGVGLVTGEDGGGLVSVHGPGGTR |
| Ga0187767_101741761 | 3300017999 | Tropical Peatland | VILALLVGWMMGRVLAQPVLPFLPAGAMEIAPGVGLVAGADGGGLVSVDGLATFAGDGGDEA |
| Ga0187804_103664791 | 3300018006 | Freshwater Sediment | MARMLTQAPLPLLPRDAAEIAPGVGVVAGPDGGGVVWVHGLATFAWD |
| Ga0187886_11361392 | 3300018018 | Peatland | MMARMLSQLPLPLLPSGAAEIAPGVGFLAGEQGGLVTVHGLATFAWDGG |
| Ga0187874_101671483 | 3300018019 | Peatland | MMARMLSQLPLPLLPAGAAEIAPGVGLLAGEDGGL |
| Ga0187885_102151131 | 3300018025 | Peatland | MMARMLSQLPLPLLPAGAAEIAPGVGLLAGEDGGLVAVHGLAAFAWDAAGGE |
| Ga0187788_105378711 | 3300018032 | Tropical Peatland | MAGMLTQLPLPLLPAGAAEIAPGVGLVAGDGGGGLVSVHG |
| Ga0187875_106053221 | 3300018035 | Peatland | MARMLTQVPLPLLPQDAAEIAPGVGVVAGPDGGGVVWVHGLATFAWDAG |
| Ga0187855_103805721 | 3300018038 | Peatland | VAGSRLTRAVLPWLPGDAAEIAPGVGLLTMPDGGGQ |
| Ga0187766_105579421 | 3300018058 | Tropical Peatland | MMTPMLTQLPLPWLPEAAVEIAPGVGLVTGPDGGVVW |
| Ga0187772_102686642 | 3300018085 | Tropical Peatland | MMARMLSQLPLPLLPPGAAEIAPGVGLVAGEDGGLVTVHGRCRRPTWRG |
| Ga0187769_100924873 | 3300018086 | Tropical Peatland | MMARMLSQLPLPLLPPGAAEIAPGVGLVADEDGGLVTVHGRCRRPTWRG |
| Ga0187770_117712072 | 3300018090 | Tropical Peatland | GWMMARMLSQLPLPLLPPGAAEIAPGVGLVADEDGGLVTVHGRCRRPTWRG |
| Ga0213881_100694351 | 3300021374 | Exposed Rock | MMARMLSQLPLLPAGAAEIAPGGGLAAGDDGGGLVSVHGLARYLIIM |
| Ga0210393_103163142 | 3300021401 | Soil | MGWMMAGMLTQLPLPMLPAGAAEIAPGVGLVTGDDGGGLVSVHG |
| Ga0210397_100584431 | 3300021403 | Soil | MGWMMAGMLTQLPLPLLPAGAAEIVPGVGLVTGDDGGGLVSVHGLATFA |
| Ga0210402_100151669 | 3300021478 | Soil | MQTQVPLPLLPGDAAEIAPGVGMVTGPDGCGVMWVHGLAA |
| Ga0210409_103101201 | 3300021559 | Soil | VARMQTQVPLPLLPGDAAEIAPGVGMVTGPDGCGVMWV |
| Ga0207692_101245301 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | MARMLSQLPLPLLPAGAAEIAPGVGLAAGGDGSGLVTVHGLATFAWDADDEAGRR |
| Ga0207699_100997172 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | MARMLSQLPLPLLPAGAAEIAPGVGLAAGGDGSGLVTVHGLATFAWDAGD |
| Ga0207684_103677072 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MARMLTQVPLPLLPGDAAEIAPGVGMVTGPDGSGVMWVHGLA |
| Ga0207693_107832412 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | MMARMLSQLPLPLLSGGAAQIAPGVGMLAGEDGGLVTVHGLATFA |
| Ga0207693_108733752 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | MARMLSQLPLPLLPAGAAEIAPGVGLAAGGDGSGLVTVHGLATFAWDAGDE |
| Ga0207700_115194002 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | MGWMMAGMLTQLPLPLLPAGAAEIAPGVGLVAGAGGGLVSVHGLA |
| Ga0257162_10122121 | 3300026340 | Soil | MARMLTQVPLPLLPGDAVEIAPGVGMVTGPDGSGVMW |
| Ga0208211_1000712 | 3300026734 | Soil | MGWMMAGMLTQLPLPLLPAGAAEIAPGVGLVTGGGGG |
| Ga0208199_10061651 | 3300027497 | Peatlands Soil | MARMLTQVPLPLLPHDAAEIAPGVGVVAGPDGAGVVWVHGLATFAWDAGDE |
| Ga0208199_10100802 | 3300027497 | Peatlands Soil | MARMLTQVPLPLLPHDAAEIAPGVGVVAGPDGGGVV |
| Ga0208565_10093506 | 3300027662 | Peatlands Soil | MMARMLTQVPLPLLPHDAAEIAPGVGVVAGPDGGGVVWVHG |
| Ga0208565_11168232 | 3300027662 | Peatlands Soil | MGWMMAGMLTQLPLPLLPAGAAEIAPGVGLLTGDDGGGLVSVHGLATFAW |
| Ga0209773_104740462 | 3300027829 | Bog Forest Soil | MMAGMLTQLPLPLLPAGAAELAPGVGLVAAADGGGL |
| Ga0209580_103190232 | 3300027842 | Surface Soil | MGWMMAGMLTQLPLPLLPAGAAEIAPGVGLVAGAGGGGL |
| Ga0209517_101098141 | 3300027854 | Peatlands Soil | MARMLTQVPLPLLPHDAAEIAPGVGVVAGPDGAGV |
| Ga0209488_107884851 | 3300027903 | Vadose Zone Soil | MGWMMAGMLTQLPLPLLPAGAAEIAPGVGLVAGGGGGLVSVHGL |
| Ga0209488_110096542 | 3300027903 | Vadose Zone Soil | MAGMLTQLPLPLLPAGAAEIAPGVGLVTGDDGGLVSVHGLATFAWD |
| Ga0209415_102210962 | 3300027905 | Peatlands Soil | MARMLTQLPLPLLPGNAREITSGVGVVDGPDGGGVVWVHGLA |
| Ga0302220_102729571 | 3300028742 | Palsa | MARMLSQLRLPLVPAAAEIAPGVGLMAGEDGGLLAVHGLATFAWDGRG |
| Ga0302219_101063743 | 3300028747 | Palsa | MMARMLSQLRLPLVPAAAEIAPGVGLMAGEDGGLLAVHGLATFAWDGRG |
| Ga0302224_101442471 | 3300028759 | Palsa | MARMLTQVPLPLLPGDAAEIAPGVGMVTGPDGSGVMWVHGLATFAWDAGDE |
| Ga0302231_100444361 | 3300028775 | Palsa | MMARMLSQLPLPLLPSGAAEIAPGVGFLAGEQGGLVTVHGLATFAW |
| Ga0302226_103970941 | 3300028801 | Palsa | PLVPAAAEIAPGVGLMAGEDGGLLAVHGLATFAWDGRG |
| Ga0307308_102189161 | 3300028884 | Soil | MLTQLPLPLLPAGAAEIAPGVGLVAGDDGGGLVSVHGLATFAWDGGDE |
| Ga0311340_101965431 | 3300029943 | Palsa | MAGMLTQLPLPLLPAGAAEIAPGVGLVAGEGGGGL |
| Ga0311340_115056272 | 3300029943 | Palsa | MARMLSQLPLPLLPPGAAEIAPGVGLLAGEDGGLVVVHGLATFA |
| Ga0311352_102484562 | 3300029944 | Palsa | LPLVPAAAEIAPGVGLMAGEDGGLLAVHGLATFAWDGRG |
| Ga0311339_100635201 | 3300029999 | Palsa | MARMLTQVPLPLLPQDAAEIAPGVGVVAGPDGGGVVWVH |
| Ga0311339_101664045 | 3300029999 | Palsa | MMAGMLTQLPLPLLPAGAAEIAPGVGLVAGEGGGGLVSVHGLATFAWDA |
| Ga0311338_100173221 | 3300030007 | Palsa | MMAGMLTQLPLPLLPAGAAEIAPGVGLVAGEGGGWLVSVH |
| Ga0311338_114383161 | 3300030007 | Palsa | MARMLSQLPLPLLPPGAAEIAPGVAVLAGEDGGLVAVH |
| Ga0302306_101548242 | 3300030043 | Palsa | MARMLTQVPLPLLPQDAAEIAPGVGVVAGPDGGGVVWVHGLATFAW |
| Ga0302181_100652141 | 3300030056 | Palsa | MTRMLTQVPLPLLPHDAAEIAPGVGVVTGPDGGGVVWVHGLATFAWDAGDA |
| Ga0302179_103022051 | 3300030058 | Palsa | KITGLAGWWMMARMLSQLRLPLVPAAAEIAPGVGLMAGEDGGLLAVHGLATFAWDGRG |
| Ga0311353_101318033 | 3300030399 | Palsa | MMARMLRQLPLPLLPSGAAEIAPGVGFLAGEQGGLVT |
| Ga0302184_104396461 | 3300030490 | Palsa | MARMLSQLPLPLLPAGSAEIAPGVGFMAGDEGGLVTVHG |
| Ga0310037_100306683 | 3300030494 | Peatlands Soil | MMARMLSQLPLPLLPAGAAEIAPGVGLLAGEDGGLVAVHGL |
| Ga0210275_103149782 | 3300030578 | Soil | MMARMLSQLPLLLLPAGAAEIAPGVGLLAGDEGGLVTG |
| Ga0316363_100266351 | 3300030659 | Peatlands Soil | MARMLTQVPLPLLPHDAAEIAPGVGVVAGPDGGGVVWVHG |
| Ga0310038_104937661 | 3300030707 | Peatlands Soil | MMARMLTQVPLPLLPHDAAEIAPGVGVVAGPAGGGVVW |
| Ga0302325_100040611 | 3300031234 | Palsa | MMAGMLTQLPLPLLPAGAAEIAPGVGLVAGEGGGGLVSVHGLATFAWDAGDE |
| Ga0302324_10009057911 | 3300031236 | Palsa | MMAGMLTQLPLPLLPAGAAEIAPGVGLVAGEGGGGLVSVHGLA |
| Ga0302324_1000951821 | 3300031236 | Palsa | MMARMLRQLPLPLLPSGAAEIAPGVGFLAGEQGGLVTVHGLATFAWDGGDEAGR |
| Ga0170820_118948311 | 3300031446 | Forest Soil | MARMLTQVPLPLLPGDAAEIAPGVGMVTGPDGSGV |
| Ga0170818_1048515041 | 3300031474 | Forest Soil | MAGMLTQLPLPLLPAGAAEIAPGVGLVTCAGGGGLVS |
| Ga0302326_127574571 | 3300031525 | Palsa | MMARMLSQLPLPLLPAGAAEIAPGVGFMAGDGGGLVTVHGLA |
| Ga0318516_104994221 | 3300031543 | Soil | MMAGMLTQLPLPLLPAGAAQIAPGVGLVTGEGGGGLVSVHGLATFAWDAGDE |
| Ga0318528_101621271 | 3300031561 | Soil | MMAGMLTQLPLPLLPAGAAEIAPGVGLVTGDDGGGLVSVHGLATFAWDAGDE |
| Ga0318528_102254532 | 3300031561 | Soil | MGWMMARMLSQLPLPLLPAGAAEIAPGVGLVAGDD |
| Ga0318573_101700013 | 3300031564 | Soil | MMAGMLTQLPLPLLPAGAAEIAPGVGLVTGEDGGGLVSVHG |
| Ga0318515_105894151 | 3300031572 | Soil | MMAGMLTQLPLPLLPAGAAEIAPGVRLVTGDDGGGLVSV |
| Ga0318555_101526091 | 3300031640 | Soil | MMAPMLSQLPLPLLQAGAAEIAPGVGLLAGEDGGLVAVHGLAAFA |
| Ga0318542_100418473 | 3300031668 | Soil | MGWMMAGMLTQLPLPLLPAGAAEIAHGVGLVTGAGGGGLVSVHGLATFAWDAGDEAGR |
| Ga0307372_100596006 | 3300031671 | Soil | MLTQTPLPLLPGDALEIAPGVGVVTGPDGGGVVVWVHGLATFAWDA |
| Ga0318574_100486355 | 3300031680 | Soil | MAGMLTQLPLPLLPAGAAEIAPGVGLVTGEDGGGLVSVHGLATFA |
| Ga0318572_106815172 | 3300031681 | Soil | MMARMLSQLPLPLLPAGAAEIAPGVGLLAGEDGGLVSVHGLAA |
| Ga0310686_1033799332 | 3300031708 | Soil | MLARMLSQIPLPLLPAGAAEIVAGVGFVTSDDGGLVTVHG |
| Ga0310686_1078475711 | 3300031708 | Soil | MMARMLSQLPVPLLPAGAAEIAPGVGLLAGEDGGLV |
| Ga0318496_107729872 | 3300031713 | Soil | MMARMLSQLPLPLLPAGAAEIAPGVGLVTGDDGGLVSVHG |
| Ga0318494_108875601 | 3300031751 | Soil | MMARMLSQLPLPLLPAGAAEIAPGVGLVTGDDGGLVSV |
| Ga0318494_109529021 | 3300031751 | Soil | MARMLSQLPLPLLPGGAVEIVPGVGMLTGAEGGLVT |
| Ga0318526_101777731 | 3300031769 | Soil | MMARMLGQLPLPLLPAGAAEIAPGVGLVSGGDGGLVVVHG |
| Ga0318521_104960181 | 3300031770 | Soil | MMARMLGQLPLPLLPAGAAEIAPGVGLLAGEDGGLVIVHGLATFAWD |
| Ga0318546_101269682 | 3300031771 | Soil | MGWMMARMLSQLPLPLLPAGAAEIAPGVGLVAGDDGGGLVSVHGLATFAWDAGD |
| Ga0318543_101384162 | 3300031777 | Soil | MAGMLTQLPLPLLPAGAAEIAPGVGLVTGEDGGGLVSVHGLATFAWD |
| Ga0318543_104945731 | 3300031777 | Soil | MARMLSQLPLPLLQAGAAEIAPGVGLLAGEDGGLVA |
| Ga0302319_119018041 | 3300031788 | Bog | MMARMLRQLPLPLLPSGAAEIAPGVGFLAGEQGGLVTVHGLATFAWDGGD |
| Ga0318497_105496442 | 3300031805 | Soil | MMARMLSQLPLPLLPAGAAEIAPGVGLVTGDDGGLVSVHGLATFA |
| Ga0306919_108066762 | 3300031879 | Soil | MMAPMLSQLPLPLLQAGAAEIAPGVGLLAGEDGGLVAVHGLAAF |
| Ga0310910_109480141 | 3300031946 | Soil | MMAGMLTQLPLPLLPAGAAEIAPGVGLVTGAGDGG |
| Ga0306926_129811221 | 3300031954 | Soil | MAGMLTQLPLPLLPAGAAEIAPGVGLVTGDDGGGLVMVH |
| Ga0318530_100846692 | 3300031959 | Soil | MMARMLSQLPLPLLPAGAAEIAPGVGLLAGKDGGLVAVRGLAAFAWDA |
| Ga0318569_100598413 | 3300032010 | Soil | MGWMMAGMLTQLPLPLLPAGAAEIAPGVGLVTGDDGGGLVLVHGLA |
| Ga0318507_102670172 | 3300032025 | Soil | MMARMLSQLPLPLLPAGAAEIAPGVGLLAGEDGRLVAVRGLAAFAWDAGDEA |
| Ga0310911_106623762 | 3300032035 | Soil | MGPGEMGWMMARMLSQLPLPLLPAGAAEIAPGVGLVAGDDGGGLVS |
| Ga0310911_107388992 | 3300032035 | Soil | MAGMLTQLPLPLLPAGAAEIAPGVGLVTGEDGGGLVSVHGLATF |
| Ga0318559_102269171 | 3300032039 | Soil | MMARMLSQLPLPLLPAGAAEIAPGVGLLAGEDGRLVAVHGLAAFAWD |
| Ga0318549_104592712 | 3300032041 | Soil | MAGMLTQLPLPLLPAGAAEIAPGVGLVTGEDGGGLVSVH |
| Ga0318558_101420072 | 3300032044 | Soil | MMARMLGQLPLPLLPAGAAEIAPGVGLVSGGDGGL |
| Ga0318570_102614852 | 3300032054 | Soil | MMARMLSQLPLPLLPAGAAEIAPGVGLLAGKDGGLVAVRGLAAFAWDAG |
| Ga0318575_104128491 | 3300032055 | Soil | MMAPMLSQLPLPLLQAGAAEIAPGVGLLAGEDGRLVAVRGLAAFAWDAGDEAGSPP |
| Ga0318575_104150052 | 3300032055 | Soil | MMAGMLTQLPLPLLPAGAAQIAPGVGLVTGEGGGGL |
| Ga0318533_112871322 | 3300032059 | Soil | MMARMLGQLPLPLLPAGAAEIAPGVGLVSGGDGGLVVVHGLATFAWDAG |
| Ga0318505_104847462 | 3300032060 | Soil | MAGMLTQLPLPLLPAGAAEIAPGVGLVTGAGGGGLVS |
| Ga0318510_104527021 | 3300032064 | Soil | MARMLSQLPLPLLPAGAAEIAPGVGLLAGEDGGLVAVHGLAAFAW |
| Ga0318524_104666391 | 3300032067 | Soil | MAGMLTQLPLPLLPAGAAEIAPGVGLVTGEDGGGLVSVHGLATFAW |
| Ga0318577_101949891 | 3300032091 | Soil | MMGRVLAQPVLPFLPAGAVEIAPGVGLVAGADGGGLVSVHGLA |
| Ga0318540_104968871 | 3300032094 | Soil | MMARMLSQLPLPLLPAGAAEIAPGVGLVAGDDGGGLVSVH |
| Ga0311301_105492323 | 3300032160 | Peatlands Soil | MAGMLTQLPLPLLPGNAREFAPGVGVVDGPDGGGVVWV |
| Ga0311301_117460872 | 3300032160 | Peatlands Soil | MARMLSQLPLPLLPARAAEIAPGVGMLAGEDGGLVTVHG |
| Ga0311301_126675261 | 3300032160 | Peatlands Soil | MLTQVPLPLLPGDAAEIAPGVGVVAGPDGGGVVWV |
| Ga0335085_110823382 | 3300032770 | Soil | MAGMLTQLPLPLLPGSAREFAAGVGVVDGPDGGGVVRVHGLATFAGDEAARRL |
| Ga0335085_111066272 | 3300032770 | Soil | MARMLTQVPLPLLPGDAAEIAPGVGMVTGPDGSGVMWVHGL |
| Ga0335085_115892171 | 3300032770 | Soil | MAGMLTQLPLPLLPAGAAEIAPGVGLVTGAAGGGLVSVHGLATFAWDAQDEAGR |
| Ga0335078_100357286 | 3300032805 | Soil | MMAGMLTQLPLPLLPGGAAEIAPGVGLVTGEDGGGLVSVHGLATFAWDGGDEAGNTGR |
| Ga0335070_118608932 | 3300032829 | Soil | MGWMMAGMLTQLPLPLLPAGAAEIAPGVGLLTGDDGGGLVSV |
| Ga0335074_115643662 | 3300032895 | Soil | MMAGMLTQLPLPLLPAGAAEIVPGVGLVTGDDGGGLVSVHGLATFAWDGG |
| Ga0335077_103073711 | 3300033158 | Soil | MLTQLPLPLLPGGAAEIAPGVGLVTGEDGGGLVSVHGLATFAW |
| Ga0370483_0349814_278_391 | 3300034124 | Untreated Peat Soil | MIARMLTQVPLPLLPRHAAEIAPGVGMVTGPDGSGVM |
| ⦗Top⦘ |