Basic Information | |
---|---|
Family ID | F031165 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 183 |
Average Sequence Length | 41 residues |
Representative Sequence | SGDIFTVLGMTYADTDLIQIQENVISRAIASLDFNVK |
Number of Associated Samples | 142 |
Number of Associated Scaffolds | 183 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 3.01 % |
% of genes near scaffold ends (potentially truncated) | 67.76 % |
% of genes from short scaffolds (< 2000 bps) | 65.03 % |
Associated GOLD sequencing projects | 127 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.44 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (69.399 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (18.579 % of family members) |
Environment Ontology (ENVO) | Unclassified (23.497 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (53.005 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 44.62% β-sheet: 0.00% Coil/Unstructured: 55.38% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.44 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 183 Family Scaffolds |
---|---|---|
PF03466 | LysR_substrate | 57.38 |
PF03404 | Mo-co_dimer | 9.29 |
PF01645 | Glu_synthase | 3.83 |
PF01493 | GXGXG | 1.64 |
PF00551 | Formyl_trans_N | 1.64 |
PF04898 | Glu_syn_central | 1.09 |
PF12840 | HTH_20 | 1.09 |
PF00254 | FKBP_C | 1.09 |
PF13442 | Cytochrome_CBB3 | 1.09 |
PF13419 | HAD_2 | 0.55 |
PF12704 | MacB_PCD | 0.55 |
PF07804 | HipA_C | 0.55 |
PF07995 | GSDH | 0.55 |
PF01850 | PIN | 0.55 |
PF08327 | AHSA1 | 0.55 |
PF02371 | Transposase_20 | 0.55 |
PF07670 | Gate | 0.55 |
PF00909 | Ammonium_transp | 0.55 |
PF00107 | ADH_zinc_N | 0.55 |
PF01569 | PAP2 | 0.55 |
COG ID | Name | Functional Category | % Frequency in 183 Family Scaffolds |
---|---|---|---|
COG0069 | Glutamate synthase domain 2 | Amino acid transport and metabolism [E] | 3.83 |
COG1304 | FMN-dependent dehydrogenase, includes L-lactate dehydrogenase and type II isopentenyl diphosphate isomerase | Energy production and conversion [C] | 3.83 |
COG0004 | Ammonia channel protein AmtB | Inorganic ion transport and metabolism [P] | 0.55 |
COG2133 | Glucose/arabinose dehydrogenase, beta-propeller fold | Carbohydrate transport and metabolism [G] | 0.55 |
COG3547 | Transposase | Mobilome: prophages, transposons [X] | 0.55 |
COG3550 | Serine/threonine protein kinase HipA, toxin component of the HipAB toxin-antitoxin module | Signal transduction mechanisms [T] | 0.55 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 69.40 % |
Unclassified | root | N/A | 30.60 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300001593|JGI12635J15846_10293084 | All Organisms → cellular organisms → Bacteria | 1021 | Open in IMG/M |
3300001593|JGI12635J15846_10630495 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 621 | Open in IMG/M |
3300004268|Ga0066398_10058071 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 802 | Open in IMG/M |
3300005537|Ga0070730_10658099 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 666 | Open in IMG/M |
3300005541|Ga0070733_10342552 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 991 | Open in IMG/M |
3300005548|Ga0070665_102178406 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 558 | Open in IMG/M |
3300005557|Ga0066704_10215720 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1300 | Open in IMG/M |
3300005569|Ga0066705_10024033 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3190 | Open in IMG/M |
3300005591|Ga0070761_10076325 | All Organisms → cellular organisms → Bacteria | 1906 | Open in IMG/M |
3300005764|Ga0066903_105951645 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 639 | Open in IMG/M |
3300006028|Ga0070717_11382979 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 639 | Open in IMG/M |
3300006176|Ga0070765_100918070 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 828 | Open in IMG/M |
3300007255|Ga0099791_10567438 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 554 | Open in IMG/M |
3300009137|Ga0066709_100313756 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2136 | Open in IMG/M |
3300009524|Ga0116225_1112805 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1255 | Open in IMG/M |
3300009792|Ga0126374_10828878 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 710 | Open in IMG/M |
3300010048|Ga0126373_10928900 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 935 | Open in IMG/M |
3300010048|Ga0126373_13246859 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 506 | Open in IMG/M |
3300010359|Ga0126376_12379204 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 576 | Open in IMG/M |
3300010360|Ga0126372_10542481 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 1102 | Open in IMG/M |
3300010366|Ga0126379_10033072 | All Organisms → cellular organisms → Bacteria | 4069 | Open in IMG/M |
3300010398|Ga0126383_12074748 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 656 | Open in IMG/M |
3300012189|Ga0137388_11985723 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 510 | Open in IMG/M |
3300012202|Ga0137363_10040923 | All Organisms → cellular organisms → Bacteria | 3265 | Open in IMG/M |
3300012203|Ga0137399_11020372 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 696 | Open in IMG/M |
3300012206|Ga0137380_10259146 | All Organisms → cellular organisms → Bacteria | 1566 | Open in IMG/M |
3300012285|Ga0137370_10189195 | All Organisms → cellular organisms → Bacteria | 1204 | Open in IMG/M |
3300012362|Ga0137361_10119544 | All Organisms → cellular organisms → Bacteria | 2320 | Open in IMG/M |
3300012363|Ga0137390_11604776 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 588 | Open in IMG/M |
3300012924|Ga0137413_10854768 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 703 | Open in IMG/M |
3300012929|Ga0137404_11834079 | Not Available | 564 | Open in IMG/M |
3300015051|Ga0137414_1224185 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1685 | Open in IMG/M |
3300015053|Ga0137405_1336295 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 4260 | Open in IMG/M |
3300015168|Ga0167631_1068855 | Not Available | 581 | Open in IMG/M |
3300015241|Ga0137418_10240357 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1542 | Open in IMG/M |
3300016294|Ga0182041_11449618 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 631 | Open in IMG/M |
3300016387|Ga0182040_10342568 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 1156 | Open in IMG/M |
3300016387|Ga0182040_10462070 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 1008 | Open in IMG/M |
3300016387|Ga0182040_11188546 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 641 | Open in IMG/M |
3300016404|Ga0182037_10565704 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 961 | Open in IMG/M |
3300016422|Ga0182039_10425017 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1133 | Open in IMG/M |
3300016422|Ga0182039_12122489 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 518 | Open in IMG/M |
3300016445|Ga0182038_11515758 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 602 | Open in IMG/M |
3300017822|Ga0187802_10003209 | All Organisms → cellular organisms → Bacteria | 4741 | Open in IMG/M |
3300017822|Ga0187802_10049525 | All Organisms → cellular organisms → Bacteria | 1533 | Open in IMG/M |
3300017943|Ga0187819_10742865 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 552 | Open in IMG/M |
3300017975|Ga0187782_11696147 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 500 | Open in IMG/M |
3300017993|Ga0187823_10190802 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 667 | Open in IMG/M |
3300018006|Ga0187804_10199553 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 854 | Open in IMG/M |
3300018007|Ga0187805_10120685 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 1189 | Open in IMG/M |
3300018007|Ga0187805_10283033 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 761 | Open in IMG/M |
3300018015|Ga0187866_1069790 | All Organisms → cellular organisms → Bacteria | 1529 | Open in IMG/M |
3300018017|Ga0187872_10219257 | Not Available | 868 | Open in IMG/M |
3300018024|Ga0187881_10053299 | All Organisms → cellular organisms → Bacteria | 1955 | Open in IMG/M |
3300018024|Ga0187881_10107605 | All Organisms → cellular organisms → Bacteria | 1254 | Open in IMG/M |
3300018026|Ga0187857_10187795 | Not Available | 968 | Open in IMG/M |
3300018468|Ga0066662_11809605 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 639 | Open in IMG/M |
3300020579|Ga0210407_10532308 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 918 | Open in IMG/M |
3300020580|Ga0210403_10653947 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 845 | Open in IMG/M |
3300020581|Ga0210399_10637898 | Not Available | 879 | Open in IMG/M |
3300020581|Ga0210399_11233206 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 592 | Open in IMG/M |
3300020583|Ga0210401_10397857 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 1240 | Open in IMG/M |
3300020583|Ga0210401_10953881 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 716 | Open in IMG/M |
3300021171|Ga0210405_10929911 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 659 | Open in IMG/M |
3300021405|Ga0210387_11742304 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 526 | Open in IMG/M |
3300021420|Ga0210394_10204084 | All Organisms → cellular organisms → Bacteria | 1724 | Open in IMG/M |
3300021420|Ga0210394_10558842 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1006 | Open in IMG/M |
3300021474|Ga0210390_10824151 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 767 | Open in IMG/M |
3300021475|Ga0210392_11170685 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 576 | Open in IMG/M |
3300021559|Ga0210409_10585867 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 983 | Open in IMG/M |
3300021559|Ga0210409_11517075 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 546 | Open in IMG/M |
3300022726|Ga0242654_10367816 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 545 | Open in IMG/M |
3300024330|Ga0137417_1130598 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 825 | Open in IMG/M |
3300026319|Ga0209647_1004499 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 10479 | Open in IMG/M |
3300026320|Ga0209131_1001122 | All Organisms → cellular organisms → Bacteria | 18570 | Open in IMG/M |
3300026333|Ga0209158_1116810 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1002 | Open in IMG/M |
3300026514|Ga0257168_1063078 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 817 | Open in IMG/M |
3300026542|Ga0209805_1138660 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1132 | Open in IMG/M |
3300026551|Ga0209648_10612488 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 598 | Open in IMG/M |
3300027635|Ga0209625_1129318 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 566 | Open in IMG/M |
3300027643|Ga0209076_1196425 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 554 | Open in IMG/M |
3300027648|Ga0209420_1035424 | All Organisms → cellular organisms → Bacteria | 1546 | Open in IMG/M |
3300027681|Ga0208991_1079642 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 986 | Open in IMG/M |
3300027846|Ga0209180_10641037 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 583 | Open in IMG/M |
3300027857|Ga0209166_10340004 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 785 | Open in IMG/M |
3300027867|Ga0209167_10297001 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 873 | Open in IMG/M |
3300027895|Ga0209624_10321442 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae | 1031 | Open in IMG/M |
3300027898|Ga0209067_10578164 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 643 | Open in IMG/M |
3300027903|Ga0209488_11062184 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 556 | Open in IMG/M |
3300027905|Ga0209415_10972180 | Not Available | 568 | Open in IMG/M |
3300028906|Ga0308309_11637011 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 547 | Open in IMG/M |
3300029636|Ga0222749_10584362 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 609 | Open in IMG/M |
3300030058|Ga0302179_10297748 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 710 | Open in IMG/M |
3300030991|Ga0073994_12373729 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 523 | Open in IMG/M |
3300031231|Ga0170824_111795780 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 972 | Open in IMG/M |
3300031231|Ga0170824_121499516 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 734 | Open in IMG/M |
3300031234|Ga0302325_12112787 | All Organisms → cellular organisms → Bacteria | 689 | Open in IMG/M |
3300031561|Ga0318528_10544151 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 623 | Open in IMG/M |
3300031682|Ga0318560_10488925 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 667 | Open in IMG/M |
3300031716|Ga0310813_10270737 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1422 | Open in IMG/M |
3300031719|Ga0306917_10028430 | All Organisms → cellular organisms → Bacteria | 3557 | Open in IMG/M |
3300031719|Ga0306917_11293962 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 564 | Open in IMG/M |
3300031768|Ga0318509_10098218 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1576 | Open in IMG/M |
3300031768|Ga0318509_10198711 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 1115 | Open in IMG/M |
3300031771|Ga0318546_10851974 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 641 | Open in IMG/M |
3300031823|Ga0307478_10881153 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 749 | Open in IMG/M |
3300031879|Ga0306919_10337926 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 1149 | Open in IMG/M |
3300031879|Ga0306919_11039857 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 625 | Open in IMG/M |
3300031890|Ga0306925_11097391 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 804 | Open in IMG/M |
3300031890|Ga0306925_11991464 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 548 | Open in IMG/M |
3300031910|Ga0306923_12368213 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 527 | Open in IMG/M |
3300031912|Ga0306921_12602943 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 522 | Open in IMG/M |
3300031945|Ga0310913_10576171 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 798 | Open in IMG/M |
3300031954|Ga0306926_10740330 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 1189 | Open in IMG/M |
3300031954|Ga0306926_11162054 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 909 | Open in IMG/M |
3300031954|Ga0306926_11949100 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 662 | Open in IMG/M |
3300031954|Ga0306926_11953911 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 661 | Open in IMG/M |
3300031962|Ga0307479_10880411 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 868 | Open in IMG/M |
3300031962|Ga0307479_11660596 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 593 | Open in IMG/M |
3300032001|Ga0306922_10005879 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 11737 | Open in IMG/M |
3300032001|Ga0306922_10366230 | All Organisms → cellular organisms → Bacteria | 1545 | Open in IMG/M |
3300032008|Ga0318562_10697163 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 584 | Open in IMG/M |
3300032205|Ga0307472_100073473 | All Organisms → cellular organisms → Bacteria | 2241 | Open in IMG/M |
3300032205|Ga0307472_100360388 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 1198 | Open in IMG/M |
3300032205|Ga0307472_101993755 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 581 | Open in IMG/M |
3300032261|Ga0306920_101020803 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 1203 | Open in IMG/M |
3300032829|Ga0335070_11495291 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 615 | Open in IMG/M |
3300032954|Ga0335083_10526904 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 985 | Open in IMG/M |
3300032955|Ga0335076_10088569 | All Organisms → cellular organisms → Bacteria | 3028 | Open in IMG/M |
3300032955|Ga0335076_10712025 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 886 | Open in IMG/M |
3300032955|Ga0335076_11239014 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 630 | Open in IMG/M |
3300033158|Ga0335077_10894573 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 895 | Open in IMG/M |
3300033289|Ga0310914_10071731 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2915 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 18.58% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 16.94% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 13.11% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 5.46% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 4.37% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 4.92% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 3.83% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 3.83% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 3.83% |
Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 3.83% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 2.73% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 2.73% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.73% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 2.19% |
Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 1.64% |
Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 1.64% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.09% |
Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.09% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 1.09% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.09% |
Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 0.55% |
Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.55% |
Glacier Forefield Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil | 0.55% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.55% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.55% |
Attine Ant Fungus Gardens | Host-Associated → Fungi → Mycelium → Unclassified → Unclassified → Attine Ant Fungus Gardens | 0.55% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300001593 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 | Environmental | Open in IMG/M |
3300002907 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_40cm | Environmental | Open in IMG/M |
3300002917 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_100cm | Environmental | Open in IMG/M |
3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
3300004268 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 MoBio | Environmental | Open in IMG/M |
3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
3300005537 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 | Environmental | Open in IMG/M |
3300005541 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 | Environmental | Open in IMG/M |
3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Host-Associated | Open in IMG/M |
3300005557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 | Environmental | Open in IMG/M |
3300005569 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 | Environmental | Open in IMG/M |
3300005591 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 | Environmental | Open in IMG/M |
3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
3300005610 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 | Environmental | Open in IMG/M |
3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
3300007255 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 | Environmental | Open in IMG/M |
3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
3300009524 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_c_BC metaG | Environmental | Open in IMG/M |
3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
3300010303 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09182015 | Environmental | Open in IMG/M |
3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
3300012169 | Attine ant fungus gardens microbial communities from North Carolina, USA - TSNC074 MetaG | Host-Associated | Open in IMG/M |
3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
3300012285 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG | Environmental | Open in IMG/M |
3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
3300012924 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300015051 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
3300015053 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
3300015168 | Arctic soil microbial communities from a glacier forefield, Russell Glacier, Kangerlussuaq, Greenland (Sample G4A, Ice margin, adjacent to proglacial lake) | Environmental | Open in IMG/M |
3300015241 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
3300017822 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_2 | Environmental | Open in IMG/M |
3300017943 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4 | Environmental | Open in IMG/M |
3300017975 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
3300017993 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_3 | Environmental | Open in IMG/M |
3300018006 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_4 | Environmental | Open in IMG/M |
3300018007 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_5 | Environmental | Open in IMG/M |
3300018015 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_150 | Environmental | Open in IMG/M |
3300018017 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_40 | Environmental | Open in IMG/M |
3300018024 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_100 | Environmental | Open in IMG/M |
3300018026 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_100 | Environmental | Open in IMG/M |
3300018060 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MG | Environmental | Open in IMG/M |
3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
3300019887 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1c2 | Environmental | Open in IMG/M |
3300020199 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
3300021475 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-O | Environmental | Open in IMG/M |
3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
3300022726 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-30-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300024330 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300026319 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_60cm (SPAdes) | Environmental | Open in IMG/M |
3300026320 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_40cm (SPAdes) | Environmental | Open in IMG/M |
3300026333 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 (SPAdes) | Environmental | Open in IMG/M |
3300026482 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-16-B | Environmental | Open in IMG/M |
3300026514 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DL-13-B | Environmental | Open in IMG/M |
3300026542 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 (SPAdes) | Environmental | Open in IMG/M |
3300026551 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes) | Environmental | Open in IMG/M |
3300027587 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM3_M3 (SPAdes) | Environmental | Open in IMG/M |
3300027629 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M3 (SPAdes) | Environmental | Open in IMG/M |
3300027635 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_M2 (SPAdes) | Environmental | Open in IMG/M |
3300027643 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 (SPAdes) | Environmental | Open in IMG/M |
3300027648 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_O1 (SPAdes) | Environmental | Open in IMG/M |
3300027681 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM3_M2 (SPAdes) | Environmental | Open in IMG/M |
3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027855 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 (SPAdes) | Environmental | Open in IMG/M |
3300027857 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300027867 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300027875 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027895 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O1 (SPAdes) | Environmental | Open in IMG/M |
3300027898 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 (SPAdes) | Environmental | Open in IMG/M |
3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
3300027905 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 (SPAdes) | Environmental | Open in IMG/M |
3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
3300029636 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300030043 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E3_1 | Environmental | Open in IMG/M |
3300030058 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E3_1 | Environmental | Open in IMG/M |
3300030991 | Metatranscriptome of forest soil microbial communities from Montana, USA - Site 5 -Soil GP-1A (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031234 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2 | Environmental | Open in IMG/M |
3300031561 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26 | Environmental | Open in IMG/M |
3300031682 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f22 | Environmental | Open in IMG/M |
3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
3300031716 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3 | Environmental | Open in IMG/M |
3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
3300031748 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f22 | Environmental | Open in IMG/M |
3300031768 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f22 | Environmental | Open in IMG/M |
3300031769 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f24 | Environmental | Open in IMG/M |
3300031771 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19 | Environmental | Open in IMG/M |
3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
3300031945 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082 | Environmental | Open in IMG/M |
3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
3300032008 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f18 | Environmental | Open in IMG/M |
3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
3300032829 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3 | Environmental | Open in IMG/M |
3300032954 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2 | Environmental | Open in IMG/M |
3300032955 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5 | Environmental | Open in IMG/M |
3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
JGI12635J15846_102930842 | 3300001593 | Forest Soil | DVFTVLGMTYADNDLIQIQENVISRSIASLDFNVH* |
JGI12635J15846_106304952 | 3300001593 | Forest Soil | DIFTVLGMTYADSDLIQIQENVIAKAIASLSFDLPEPKK* |
JGI25613J43889_100486921 | 3300002907 | Grasslands Soil | DWSGKLVVISRGKDMLTVLAMTYADSDLIQIQENVVSRTIASLDFNVH* |
JGI25616J43925_103876861 | 3300002917 | Grasslands Soil | WSGTLVVISRSGDIFTVLGMTYADSDLIQIQENVIAKAIGSLSFDLPEAKK* |
Ga0062389_1000597673 | 3300004092 | Bog Forest Soil | TLVVLTRGDEIFTILGMTYADDDLIQIQENVISRAIASLDFSAGSTSAAK* |
Ga0066398_100580712 | 3300004268 | Tropical Forest Soil | VGRGKDALTMLGMTYADSDLIQIQENVIARAIASTDFNVPKYSAEK* |
Ga0070713_1018072022 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | WSGTLVVISRTGDIFTVLGMTYADNDLIQIQENVIAKAINSLSFDLPEVKK* |
Ga0070713_1024600382 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | DWSGTLVVVARGSDIFTALGMTFADNDLIQIQENVIAKTIASLDFNVR* |
Ga0070730_106580992 | 3300005537 | Surface Soil | MLARGKDVFTILGMTSADSDLIQIQENVIAKTIASLQFLSPQ* |
Ga0070733_103425521 | 3300005541 | Surface Soil | LTLLGMTYADSDLIQIQENVIARAIASTSFEVGKITAEK* |
Ga0070665_1021784061 | 3300005548 | Switchgrass Rhizosphere | VLTILGMTYADSDLIQIQENVIARAIASTSFDVPKYAAEK* |
Ga0066704_102157202 | 3300005557 | Soil | GKDMFTVLAMTYADSDLIQIQENVISRAIASLDFSVR* |
Ga0066705_100240333 | 3300005569 | Soil | DMFTVLAMTYADSDLIQIQENVISRAISSLDFSVH* |
Ga0070761_100763251 | 3300005591 | Soil | GTDVFTVLGMTYGEDDLIQIQENVISRSIASMDFNVH* |
Ga0066706_100876641 | 3300005598 | Soil | GKLVVISRGKDMFTVLAMTYADSDLIQIQENVISRAIASLDFSVR* |
Ga0070763_104013581 | 3300005610 | Soil | DWSGTLVVISRGADVLTVLGMTYADNDLIQIQENVINRSIASLDFNIH* |
Ga0070763_107769111 | 3300005610 | Soil | SGTLVVISRGTDVLTVLGMTYADNDLIQIQENVISRSIASLDFSIR* |
Ga0066903_1059516452 | 3300005764 | Tropical Forest Soil | RGEEVFTVLGMTFADTDLIQIQENVISRSIASLNFGVK* |
Ga0070717_113829792 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | EVFTILGMTSADSDLIQIQENVIAKTIASLQFLPPK* |
Ga0070765_1009180701 | 3300006176 | Soil | RGKDVFTILGMTSADSDLIQIQENVIAKTIASLQFLSPQ* |
Ga0070765_1015421911 | 3300006176 | Soil | LVVLSRGGDIFTILGMTYADTDLIQIQENVIAHAIASLDFSPIN* |
Ga0099791_105674382 | 3300007255 | Vadose Zone Soil | GNDVFTILGITYADSDLIQIQENVIAKAIGSLEFTSR* |
Ga0099829_106453711 | 3300009038 | Vadose Zone Soil | SGTLVVISRSGDIFTVLGMTYADNDLIQIQENVIAKAIASLSFDIPDAKK* |
Ga0099830_105827311 | 3300009088 | Vadose Zone Soil | SGTLVVISRSGDIFTVLGMTYADSDLIQIQENVIAKAIASLSLDLPEAKK* |
Ga0099830_109028561 | 3300009088 | Vadose Zone Soil | GTLVVISRSGDIFTVLGMTYADSDLIQIQENVIAKAIGSLSFDVPGAKK* |
Ga0099828_116014292 | 3300009089 | Vadose Zone Soil | SGTLVVISRSGDIFTVLGMTYADSDLIQIQENVIAKAIGSLSFDLPEAKK* |
Ga0066709_1003137563 | 3300009137 | Grasslands Soil | DMFTVLAMTYADSDLIQIQENVISRAIASLDFSVR* |
Ga0116225_11128051 | 3300009524 | Peatlands Soil | IVTVLGMTFADTDLIQIQENVIARAIASLDFSTK* |
Ga0126374_108288781 | 3300009792 | Tropical Forest Soil | NEMLTILGMTFADTDLIQIQENVIARSIASVDFKVN* |
Ga0126373_109289002 | 3300010048 | Tropical Forest Soil | ARGEEVFTVLGMTFADTDLIQIQENVISRSIASLNFGMK* |
Ga0126373_132468592 | 3300010048 | Tropical Forest Soil | LTVVARGEEVFTVLGMTFADTDLIQIQENVISRSIASLNFGMK* |
Ga0134082_102450851 | 3300010303 | Grasslands Soil | KLVVISRGKDMFTVLAMTYADSDLIQIQENVISRAIASLDFSVR* |
Ga0126376_123792041 | 3300010359 | Tropical Forest Soil | DIFTVLGMSYADSDLIQIQETVIAKAIGSLSFDAH* |
Ga0126372_105424811 | 3300010360 | Tropical Forest Soil | MLTVLAMTYADSDLIQIQENVIARSITSLDFAVH* |
Ga0126379_100330723 | 3300010366 | Tropical Forest Soil | DILTVLAMTYADSDLIQIQENVIARSIASLDFSVH* |
Ga0136449_1032937331 | 3300010379 | Peatlands Soil | TLAVIAHNGEIFTVLGMTFADTDLIQIQENVITRAIASLDFSAK* |
Ga0126383_120747482 | 3300010398 | Tropical Forest Soil | SGDIFTVLGMTYADTDLIQIQENVISRAIASLDFNVK* |
Ga0150983_111359141 | 3300011120 | Forest Soil | TLVVISRGTDVLTVLGMTYADNDLIQIQENVISRSIASLDFSIR* |
Ga0150983_114094771 | 3300011120 | Forest Soil | GTLVVVSRGSDILTALGMTYADTDLIQIQENVIAKAIASMDFNVR* |
Ga0153990_11504302 | 3300012169 | Attine Ant Fungus Gardens | WSGILVVISRSGDIFTVLGMTYADSDLIQIQENVIAKAISSLSFDVPEGNK* |
Ga0137388_117320952 | 3300012189 | Vadose Zone Soil | WSGTLVVIARGNDILTALGMTYADTDLIQIQENVISRAITSLDFNVR* |
Ga0137388_119857231 | 3300012189 | Vadose Zone Soil | DMFTVLAMTYADSDLIQIQENVIARAIASLDFSAH* |
Ga0137363_100409233 | 3300012202 | Vadose Zone Soil | GDIFTVLGMTYADSDLIQIQENVIAKAIGSLSFDLPEAKK* |
Ga0137399_110203721 | 3300012203 | Vadose Zone Soil | MFTVLAMTYADSDLIQIQENVIARAIASLDFSAH* |
Ga0137380_102591463 | 3300012206 | Vadose Zone Soil | DVLTLLGMTYADNELIQIQEDVIARAISSTDFDVH* |
Ga0137370_101891951 | 3300012285 | Vadose Zone Soil | LVVIARGKDMFTVLAMTYADSDLIQIQENVISRAISSLDFTVH* |
Ga0137360_100726861 | 3300012361 | Vadose Zone Soil | VISRGGDIFTVLGMTYADSDLIQIQENVIAKAIGSLSFDLPEAKK* |
Ga0137360_100798391 | 3300012361 | Vadose Zone Soil | KADEHEWSGTLVVISRSGDIFTVLGMTYADSDLIQIQENVIAKAIASLSFEVPEIKK* |
Ga0137361_101195441 | 3300012362 | Vadose Zone Soil | DIFTVLGMTYADSDLIQIQENVIAKAIASLSFEVPEIKK* |
Ga0137390_116047762 | 3300012363 | Vadose Zone Soil | DMFTVLAMTYADSDLIQIQENVIARAIASLDFSVH* |
Ga0137358_106787211 | 3300012582 | Vadose Zone Soil | ADEYDWSGTLVVIGRGKDVLTALGMTFADSDLIQIQENVISRSISSLDFSAHN* |
Ga0137413_108547682 | 3300012924 | Vadose Zone Soil | LGMTYADSDLIQIQENVIAKAVASLSFDITEVKK* |
Ga0137416_100241001 | 3300012927 | Vadose Zone Soil | ADEHEWSGTLVVISRSDDIFTVIGTTYADSDLIEIQKNVIAKAIASLSFEVPEIKK* |
Ga0137404_118340791 | 3300012929 | Vadose Zone Soil | DVFTLLGMTYADSDLIQIRENVIAKMIASLQFSTPH* |
Ga0137414_12241851 | 3300015051 | Vadose Zone Soil | MFTVLAMTYADSDLIQIQENVIARAIASLDFNAR* |
Ga0137405_13362954 | 3300015053 | Vadose Zone Soil | MLTVLAMTYADSDLIQIQENVISRSIASLDFNVH* |
Ga0167631_10688552 | 3300015168 | Glacier Forefield Soil | MFSVLGMTYSDTDLIQIQENVIARAIASLEFNSN* |
Ga0137418_102403571 | 3300015241 | Vadose Zone Soil | KDMFTVLAMTYADSDLIQIQENVIARAIASLDFSAH* |
Ga0182041_114496181 | 3300016294 | Soil | VVARGEEVFTVLGMTFADSDLIQIQENVISRSIASLNFAVM |
Ga0182040_103425681 | 3300016387 | Soil | TLTVVARGEEVFTVLGMTFADTDLIQIQENVISRSIASLSFGAK |
Ga0182040_104620701 | 3300016387 | Soil | TLTVVARGEEVFTVLGMTFADTDLIQIQENVISRSIASLSFSAK |
Ga0182040_111885461 | 3300016387 | Soil | RGEEVFTVLGMTFADTDLIQVQENVISRSIASLNFGMK |
Ga0182037_105657042 | 3300016404 | Soil | ARGEEVFTVLGMTFADTDLIQIQENVISRSIASLSFGAK |
Ga0182039_104250171 | 3300016422 | Soil | KNILTVLAMTYADSDLIQIQENVIARSIASLDFSVH |
Ga0182039_121224892 | 3300016422 | Soil | LTVVARGEEVFTVLGMTFADTDLIQIQENVISRSIASLSFSAK |
Ga0182038_115157582 | 3300016445 | Soil | EEVFTVLGMTFADTDLIQIQENVISRSSASLNFGIK |
Ga0187802_100032093 | 3300017822 | Freshwater Sediment | KDVFTVLAMTYADSDLIQIQENVIARSIASLDFTVR |
Ga0187802_100495251 | 3300017822 | Freshwater Sediment | LSVITRDGEFLTVLGMTFGDSYLIQIQENVITRSIASLDFNVK |
Ga0187819_107428652 | 3300017943 | Freshwater Sediment | EFLTLLGMTYAESDLIQIQENVITRAIASVDFNVK |
Ga0187782_116961472 | 3300017975 | Tropical Peatland | LSVVAHNGEYLTVLGMTFADTDLIQIQENVISRAIASLDFK |
Ga0187823_101908021 | 3300017993 | Freshwater Sediment | VVRGKEVFTILGMTSANSDLIQIQENVIAKTIGSLQFISPQ |
Ga0187804_101995532 | 3300018006 | Freshwater Sediment | GTLSVITRDGEFLTVLGMTFGDSDLIQIQENVITRSIASLDFNVK |
Ga0187805_101206852 | 3300018007 | Freshwater Sediment | SHSGEFLTVLGMTYADTDLIQIQENVIARAIASLDFNVN |
Ga0187805_102830331 | 3300018007 | Freshwater Sediment | ELFTILGMTSANSDLIQIQENVIAKAISSLQFFPPQ |
Ga0187866_10697903 | 3300018015 | Peatland | EIFTVLGMTFADTDLIQIQENVIAHAIASLDFSAK |
Ga0187872_102192571 | 3300018017 | Peatland | GADLFTVLGMTYADTDLIQIQENVITRAISSLRFETP |
Ga0187881_100532991 | 3300018024 | Peatland | GGEIFTVLGMTFADTDLIQIQENVTAHAIASLDFSTK |
Ga0187881_101076053 | 3300018024 | Peatland | ADLFTVLGMTYADTDLIQIQENVITRAISSLRFETP |
Ga0187857_101877952 | 3300018026 | Peatland | VTVVSVAHGADLFTVLGMTYADTDLIQIQENVITRAISSLRFETP |
Ga0187765_113112201 | 3300018060 | Tropical Peatland | TALTIARGSDVFTLIGMTYADSDLIQIRENVIAKMLSSLQFTPAGH |
Ga0066662_118096051 | 3300018468 | Grasslands Soil | RGNEIFTILGMTYADSDLIQIQENVISRAIASLEFNVH |
Ga0193729_10992822 | 3300019887 | Soil | GTLLVVSRGEDTFSVLGMTYSDSDLIQIQENVIGRAISSLEFNKN |
Ga0179592_100631753 | 3300020199 | Vadose Zone Soil | WSGTLVVISRSGDIFTVLGMTYADSDLIQIQENVIAKAIASLSFEVPEIKK |
Ga0210407_105323081 | 3300020579 | Soil | KDVFTILGMTSANSDLIQIQENVIAKTIASFQFLPVQ |
Ga0210403_106539472 | 3300020580 | Soil | MLARGKDVFTILGMTSADSDLIQIQENVIAKTIASLQFLSPQ |
Ga0210399_106378982 | 3300020581 | Soil | DIFTVLAMTYADSDLIQIQENVIARAIASLDFSAH |
Ga0210399_112332062 | 3300020581 | Soil | VSRGSDILTALGMTYADTDLIQIQENVIAKAIASLDFNVR |
Ga0210395_107784652 | 3300020582 | Soil | GTLLVISRGDDVFSVLGMTYSDSDLIQIQENVIGRAISSLEFNKN |
Ga0210401_103978572 | 3300020583 | Soil | SEILTVLGMTYADTDLIQIQENVIARSIASLDFTAR |
Ga0210401_109538811 | 3300020583 | Soil | RGGDILTALGMTYADTDLIQIQENVIAKAIASLDFNVR |
Ga0210405_109299112 | 3300021171 | Soil | TMLARGKDVFTILGMTSADSDLIQIQENVIAKTIASLQFLSPQ |
Ga0210408_114702271 | 3300021178 | Soil | FTMLARGKDVFTILGMTSADSDLIQIQENVIAKTIASLQFLSPQ |
Ga0210393_105948482 | 3300021401 | Soil | GTLVVISRGGEIFTVLGMTYADSDLIQIQENVIAKAIGSLSFDLPEAKK |
Ga0210387_117423042 | 3300021405 | Soil | RGNDILTALGMTYADTDLIQIQENVIAKAIASLDFNVR |
Ga0210383_108387422 | 3300021407 | Soil | GTLAVVARNGDVFTVLGMTYADTDLIQIQENVISRAIASIDFNVK |
Ga0210383_109922641 | 3300021407 | Soil | TLVVISRGADVLTVLGMTYADNDLIQIQENVINRSIASLDFNIH |
Ga0210394_102040841 | 3300021420 | Soil | TILGMTYADTDLIQIQENVIARSIASIDFSTGNTSPTK |
Ga0210394_105588421 | 3300021420 | Soil | RGSDVLTMLGMTHADNDLIQIQENVIARAISSTDFNVH |
Ga0210390_108241511 | 3300021474 | Soil | SVVPHGGEFLTVLGMTFADTDLIQIQENVITRAIASLDFNVK |
Ga0210392_111706851 | 3300021475 | Soil | RGNDVFTVLGMTYADNDLIQIQENVISRTIASLDFNVH |
Ga0210409_105858671 | 3300021559 | Soil | NGDVFTVLGMTYADTDLIQIQENVISRAIASIDFNVK |
Ga0210409_115170751 | 3300021559 | Soil | AVVARNGDVITVLGMTYADSDLIQIQENVITRAIASIDFNVK |
Ga0242654_103678161 | 3300022726 | Soil | MLARGKEVFTILGMTSADSDLIQIQENVIAKTIASLQFLSPQ |
Ga0137417_11305981 | 3300024330 | Vadose Zone Soil | GDIFTVLGMTYADSDLIQIQENVIAKAIASLSCFEVPEIKK |
Ga0137417_13001361 | 3300024330 | Vadose Zone Soil | WSGTLVVISRDGDIFTVLGMTYADSDLIQIQENVIAKAIASLSFEVPEIKK |
Ga0207692_100817141 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | SRSGDIFTILGMTYADSDLIQIQENVIAKAIASLSFEIPEAKK |
Ga0207700_115014741 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | WSGTLVVISRTGDIFTVLGMTYADNDLIQIQENVIAKAINSLSFDLPEVKK |
Ga0209647_10044999 | 3300026319 | Grasslands Soil | SGDVFTVLGMTYSDTDLIQIQENVISRAIASIDFNVK |
Ga0209131_100112212 | 3300026320 | Grasslands Soil | VVISRGKDMLTVLAMTYADSDLIQIQENVVSRTIASLDFNVH |
Ga0209158_11168103 | 3300026333 | Soil | RGNDVFTILGITYADSDLIQIQENVIAKAIGSLEFTSR |
Ga0257172_10142201 | 3300026482 | Soil | SRSGDIFTVLGMTYADSDLIQIQENVIAKAIGSLSFDLPEAKK |
Ga0257168_10630781 | 3300026514 | Soil | DIFTVLGMTYADSDLIQIQENVIAKAIGSLNFDIPEVKR |
Ga0209805_11386601 | 3300026542 | Soil | DMFTVLAMTYADSDLIQIQENVIARAIASLVFNAH |
Ga0209648_100554913 | 3300026551 | Grasslands Soil | ANHVFLKLVVVARGKDMFTVLAMTYADSDLIQIQENVIGRAIASLDFNAH |
Ga0209648_106124882 | 3300026551 | Grasslands Soil | KDMFTVLAMTYADSDLIQIQENVIARAIGSLDFSAH |
Ga0209220_10556292 | 3300027587 | Forest Soil | LVVISRSGDIFTVLGMTYADSDLIQIQENVIAKAIASLSFDVPETKK |
Ga0209422_11212901 | 3300027629 | Forest Soil | ISRNGDIFTVLGMTYADSDLIQIQENVIAKAIASLSFDVPEVRK |
Ga0209625_11293182 | 3300027635 | Forest Soil | VSRGDDVFSVLGMTYSDSDLIQIQENVIGRAISSLEFNKN |
Ga0209076_11964251 | 3300027643 | Vadose Zone Soil | SKDMLTVLAMTYADSDLIQIQENVISRSIASLDFNVH |
Ga0209420_10354241 | 3300027648 | Forest Soil | VVSRGSDILTALGMTYADTDLIQIQENVIAKAIASMDFNVR |
Ga0208991_10796421 | 3300027681 | Forest Soil | RGEDIFSVLGMTYSDTDLIQIQENVISRVIASLEFNSN |
Ga0209180_106055822 | 3300027846 | Vadose Zone Soil | VIGRGGDIFTVLGMTYADDDLIQIQENVIAKAIASLSFDVAESKK |
Ga0209180_106410371 | 3300027846 | Vadose Zone Soil | GDIFTVLGMTYADNDLIQIQENVIAKAIASLSFDIPDAKK |
Ga0209693_100451523 | 3300027855 | Soil | LVVVARGSDIFTALGMTFADTDLIQIQENVIAKAIASLDFNVR |
Ga0209166_103400041 | 3300027857 | Surface Soil | GKDTLTVLAMTYADSDLIQIQENVIARSIASLDFNVH |
Ga0209167_102970011 | 3300027867 | Surface Soil | TDVFTVLGMTYADNDLIQIQENVISRSIASLDFSVH |
Ga0209283_104359202 | 3300027875 | Vadose Zone Soil | AVIGRGGDIFTVLGMTYADDDLIQIQENVIAKAIASLSFDVAEAKK |
Ga0209283_107440872 | 3300027875 | Vadose Zone Soil | SGTLVVISRSGDIFTVLGMTYADSDLIQIQENVIAKAIGSLSFDLPEAKK |
Ga0209624_103214422 | 3300027895 | Forest Soil | VVVSRGGDILTALGMTYADTDLIQIQENVIAKAIASLDFNVR |
Ga0209067_105781642 | 3300027898 | Watersheds | RGNDMVSVLGMTYADTDLIQIQENVITRAIGSIDFNVK |
Ga0209488_110621841 | 3300027903 | Vadose Zone Soil | KDVFTVLAMTYADSDLIQIQENVIARAIASLVFNAN |
Ga0209415_109721802 | 3300027905 | Peatlands Soil | TTLARDKELFTILGMTSANSDLIQIQENVIAKAISSLQFFLPQ |
Ga0308309_116370111 | 3300028906 | Soil | SRGTDVLTVLGMTYADNDLIQIQENVISRSIASLDFSVKQ |
Ga0222749_105843622 | 3300029636 | Soil | DIFTVLGMTYADSDLIQIQENVIAKAIGSLSFDVPEAKR |
Ga0302306_100779911 | 3300030043 | Palsa | SGTLAVMARNSDIFTVLGMTYADTDLIQIQENVIAKAITSLDFSVR |
Ga0302179_102977481 | 3300030058 | Palsa | LVVLTRAADTFTILGMTFAESDLIQIQENVISRAIASLKFSAQ |
Ga0073994_123737291 | 3300030991 | Soil | MTYADSDLIQIQENVIAKAIASLSFDLPEAKKGTN |
Ga0170824_1117957801 | 3300031231 | Forest Soil | SGDVFTVLGMTYADTDLIQIQENVISRAIASIDFNVK |
Ga0170824_1214995161 | 3300031231 | Forest Soil | TLARDKDVFTILGMTSANSDLIQIQENVIAKTIASFQFLPVQ |
Ga0302325_121127872 | 3300031234 | Palsa | RGSDIFTILAMTYANSDLIQIQENVLAKMIASVRFDGPP |
Ga0318528_105441511 | 3300031561 | Soil | GDIFTVLGMTFADTDLIQIQENVITRSIASLDFSAK |
Ga0318560_104889252 | 3300031682 | Soil | SKDILTVLAMTYANSDLIQIQENVIARSIASLDFSVQ |
Ga0307476_112255891 | 3300031715 | Hardwood Forest Soil | TLVVISHGTDVFAVLGMTYADNDLIQIQENVISRSIASLDFSVH |
Ga0310813_102707372 | 3300031716 | Soil | VVIARGNDIFTALGMTYADNDLIQIQENVIAKAIASLDFTAR |
Ga0306917_100284301 | 3300031719 | Soil | EEVFTVLGMTFADTDLIQIQENVISRSIASLSFGAK |
Ga0306917_112939621 | 3300031719 | Soil | DVLTLLGMTYADSDLIQIQENVIARTIASVSFDVQKLSAEK |
Ga0318492_106488141 | 3300031748 | Soil | DWSGTLTVVARGEEVFTVLGMTFADTDLIQIQENVISRSIASLNFGVK |
Ga0318509_100982183 | 3300031768 | Soil | EVFTVLGMTFADTDLIQIQENVISRAIASLSFGAK |
Ga0318509_101987112 | 3300031768 | Soil | PGEVFTVLGMTFADTDLIQIQENVISRSIASLEFGVK |
Ga0318526_101543792 | 3300031769 | Soil | DWSGTLTVVARGEEVFTVLGMTFADSDLIQIQENVISRSIASLNFGMK |
Ga0318546_108519743 | 3300031771 | Soil | DWSGTLTVVARGEEVFTVLGMTFADTDLIQIQENVISRSIASLNFGMK |
Ga0307478_108811532 | 3300031823 | Hardwood Forest Soil | VVARNGDVFTVLGMTYADTDLIQIQENVISRAIASLDFNVK |
Ga0306919_103379261 | 3300031879 | Soil | KDVLTMLGMTYADSDLIQIQENVIARAIASMSFDVQKLAAQK |
Ga0306919_110398571 | 3300031879 | Soil | SGTLTVVARGEEVFTVLGMTFADTDLIQIQENVISRSIASLNFGMK |
Ga0306925_110973911 | 3300031890 | Soil | TVVARGEEVFTVLGMTFADTDLIQIQENVISRSIASLNFGMK |
Ga0306925_119914642 | 3300031890 | Soil | ARGEEVFTVLGMTFADTDLIQIQENVISRSIASLNFGVK |
Ga0306923_123682131 | 3300031910 | Soil | EEVFTVLGMTFADTDLIQIQENVISRSIASLSFSAK |
Ga0306921_126029431 | 3300031912 | Soil | VARGEEVFTVLGMTFADTDLIQIQENVISRSIASLNFGVK |
Ga0310913_105761711 | 3300031945 | Soil | EEVFTVLGMTFADTDLIQIQENVISRSIASLNFGMK |
Ga0306926_107403301 | 3300031954 | Soil | GTLTVVARGEEVFTVLGMTFADTDLIQIQENVISRSIASLSFSAK |
Ga0306926_111620543 | 3300031954 | Soil | ARGKNILTVLAMTYADSDLIQIQENVIARSIASLDFSVH |
Ga0306926_119491001 | 3300031954 | Soil | DVFTVLGMTFADTDLIQIQENVIARSIASLDLNAK |
Ga0306926_119539112 | 3300031954 | Soil | EVFTVLGMTFADTDLIQIQENVISRSIASLSFGAK |
Ga0307479_108804112 | 3300031962 | Hardwood Forest Soil | FTVLGMTYADSDLIQIQENVIAKAIGSLSFDVPEAKR |
Ga0307479_116605962 | 3300031962 | Hardwood Forest Soil | SDVLTILGMTYADNDLIQIQENVIARAISSTDFNVH |
Ga0307479_119600691 | 3300031962 | Hardwood Forest Soil | DWSGTLAVVARDGDVFTVLGMTYADTDLIQIQENVISRAIASIDFNMK |
Ga0306922_100058798 | 3300032001 | Soil | TLSVVSHGGEFLTVLGMTFADSDLIQIQENVIARSIASVDFSVK |
Ga0306922_103662303 | 3300032001 | Soil | VLTMLGMTYADSDLIQIQENVIARAIASMSFDVQKLAAQK |
Ga0318562_106971631 | 3300032008 | Soil | KDILTVLAMTYANSDLIQIQENVIARSIASLDFSVQ |
Ga0307472_1000734731 | 3300032205 | Hardwood Forest Soil | GPDVFTVLGMTFADTDLIQIQENVIARSIASLDLNAK |
Ga0307472_1003603881 | 3300032205 | Hardwood Forest Soil | NAVLTILGMTYADNDLIQIQENVIARAISSTDFNVH |
Ga0307472_1008282141 | 3300032205 | Hardwood Forest Soil | LADGPDWSGTLVVISRGADVLTVLGMTYADNDLIQIQENVINRSMASLDFNVH |
Ga0307472_1019937551 | 3300032205 | Hardwood Forest Soil | ARDGEFLTVLGMTFADTDLIQIQENVITRSIASLDFNVK |
Ga0306920_1002368594 | 3300032261 | Soil | WSGTLTVVARGEEVFTVLGMTFADTDLIQIQENVISRSIASLSFGAK |
Ga0306920_1010208032 | 3300032261 | Soil | GEEVFTVLGMTFADTDLIQIQENVISRSIASLSFSAK |
Ga0335078_101342033 | 3300032805 | Soil | DWSGTLVVISRGADVFTVLGMTYADNDLIQIQENVIERTIASLDFSVH |
Ga0335070_114952911 | 3300032829 | Soil | NGEIFTVLGMTYADTDLIQIQENVITRAIASLDFNQK |
Ga0335083_105269042 | 3300032954 | Soil | GTLSVVAHTGEFLTLLGMTSGDSDLIQIQENVIARTISSVDFNAK |
Ga0335076_100885691 | 3300032955 | Soil | VVISRGTDIFTVLGMTYADNDLIQIQENIIERAVASLDFSAH |
Ga0335076_107120251 | 3300032955 | Soil | GPDVFTVLGMTYADNDLIQIQENIIEHAIGSLDFSVH |
Ga0335076_112390141 | 3300032955 | Soil | EYLTVLGMTFADSDLIQIQENVINRAIGSLDFSVK |
Ga0335077_108945731 | 3300033158 | Soil | VSRNGGDVFTVLGMTFGDSDLIQIQENVIGRTIASLEFGK |
Ga0310914_100717311 | 3300033289 | Soil | VARGEEVFTVLGMTFADTDLIQIQENVISRSIASLSFGAK |
⦗Top⦘ |