NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F031141

Metagenome Family F031141

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F031141
Family Type Metagenome
Number of Sequences 183
Average Sequence Length 41 residues
Representative Sequence VTDAPTEREGEGAWTRLRRRKVVQWGIAYAAAAWTLLQ
Number of Associated Samples 91
Number of Associated Scaffolds 183

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 94.38 %
% of genes near scaffold ends (potentially truncated) 95.63 %
% of genes from short scaffolds (< 2000 bps) 89.07 %
Associated GOLD sequencing projects 85
AlphaFold2 3D model prediction Yes
3D model pTM-score0.46

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (64.481 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil
(34.973 % of family members)
Environment Ontology (ENVO) Unclassified
(45.902 % of family members)
Earth Microbiome Project Ontology (EMPO) Unclassified
(47.541 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 48.48%    β-sheet: 0.00%    Coil/Unstructured: 51.52%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.46
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 183 Family Scaffolds
PF13432TPR_16 4.37
PF14559TPR_19 3.28
PF13193AMP-binding_C 2.73
PF09361Phasin_2 2.19
PF00593TonB_dep_Rec 1.64
PF14023DUF4239 1.09
PF12697Abhydrolase_6 1.09
PF13520AA_permease_2 1.09
PF13673Acetyltransf_10 1.09
PF02225PA 1.09
PF01061ABC2_membrane 1.09
PF13545HTH_Crp_2 1.09
PF13474SnoaL_3 1.09
PF11746DUF3303 1.09
PF02321OEP 0.55
PF02219MTHFR 0.55
PF13181TPR_8 0.55
PF14534DUF4440 0.55
PF13738Pyr_redox_3 0.55
PF00210Ferritin 0.55
PF13450NAD_binding_8 0.55
PF13683rve_3 0.55
PF13531SBP_bac_11 0.55
PF07690MFS_1 0.55
PF01432Peptidase_M3 0.55
PF00361Proton_antipo_M 0.55
PF04408HA2 0.55
PF00171Aldedh 0.55
PF03009GDPD 0.55
PF06155GBBH-like_N 0.55
PF00596Aldolase_II 0.55
PF12769PNTB_4TM 0.55
PF13091PLDc_2 0.55
PF00149Metallophos 0.55
PF01596Methyltransf_3 0.55
PF00732GMC_oxred_N 0.55
PF08332CaMKII_AD 0.55
PF01746tRNA_m1G_MT 0.55
PF13586DDE_Tnp_1_2 0.55
PF13416SBP_bac_8 0.55
PF00561Abhydrolase_1 0.55
PF03886ABC_trans_aux 0.55
PF07715Plug 0.55
PF09137Glucodextran_N 0.55
PF00144Beta-lactamase 0.55
PF13414TPR_11 0.55
PF13192Thioredoxin_3 0.55

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 183 Family Scaffolds
COG1538Outer membrane protein TolCCell wall/membrane/envelope biogenesis [M] 1.09
COG1686D-alanyl-D-alanine carboxypeptidaseCell wall/membrane/envelope biogenesis [M] 0.55
COG4875Protein kinase association domain CaMKII_AD, NTF2-like superfamilyPosttranslational modification, protein turnover, chaperones [O] 0.55
COG4230Delta 1-pyrroline-5-carboxylate dehydrogenaseAmino acid transport and metabolism [E] 0.55
COG4123tRNA1(Val) A37 N6-methylase TrmN6Translation, ribosomal structure and biogenesis [J] 0.55
COG4122tRNA 5-hydroxyU34 O-methylase TrmR/YrrMTranslation, ribosomal structure and biogenesis [J] 0.55
COG3536Uncharacterized conserved protein, DUF971 familyFunction unknown [S] 0.55
COG3387Glucoamylase (glucan-1,4-alpha-glucosidase), GH15 familyCarbohydrate transport and metabolism [G] 0.55
COG2518Protein-L-isoaspartate O-methyltransferasePosttranslational modification, protein turnover, chaperones [O] 0.55
COG2367Beta-lactamase class ADefense mechanisms [V] 0.55
COG2303Choline dehydrogenase or related flavoproteinLipid transport and metabolism [I] 0.55
COG0014Gamma-glutamyl phosphate reductaseAmino acid transport and metabolism [E] 0.55
COG1680CubicO group peptidase, beta-lactamase class C familyDefense mechanisms [V] 0.55
COG1643HrpA-like RNA helicaseTranslation, ribosomal structure and biogenesis [J] 0.55
COG1164Oligoendopeptidase FAmino acid transport and metabolism [E] 0.55
COG1012Acyl-CoA reductase or other NAD-dependent aldehyde dehydrogenaseLipid transport and metabolism [I] 0.55
COG06855,10-methylenetetrahydrofolate reductaseAmino acid transport and metabolism [E] 0.55
COG0584Glycerophosphoryl diester phosphodiesteraseLipid transport and metabolism [I] 0.55
COG0339Zn-dependent oligopeptidase, M3 familyPosttranslational modification, protein turnover, chaperones [O] 0.55


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms64.48 %
UnclassifiedrootN/A35.52 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000124|BS_KBA_SWE12_21mDRAFT_c10064332All Organisms → cellular organisms → Bacteria951Open in IMG/M
3300000881|JGI10215J12807_1180358All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria2876Open in IMG/M
3300000891|JGI10214J12806_12152521Not Available1016Open in IMG/M
3300001213|JGIcombinedJ13530_100858289All Organisms → cellular organisms → Bacteria504Open in IMG/M
3300004050|Ga0055491_10049675All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria936Open in IMG/M
3300004463|Ga0063356_101517906All Organisms → cellular organisms → Bacteria993Open in IMG/M
3300004480|Ga0062592_100464035All Organisms → cellular organisms → Bacteria → Proteobacteria1033Open in IMG/M
3300004481|Ga0069718_15672070All Organisms → cellular organisms → Bacteria1277Open in IMG/M
3300005487|Ga0074211_152176Not Available886Open in IMG/M
3300005718|Ga0068866_10337189All Organisms → cellular organisms → Bacteria → Proteobacteria954Open in IMG/M
3300005829|Ga0074479_10281373All Organisms → cellular organisms → Bacteria539Open in IMG/M
3300005844|Ga0068862_100617618All Organisms → cellular organisms → Bacteria → Proteobacteria1042Open in IMG/M
3300006224|Ga0079037_100073473All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales2776Open in IMG/M
3300006224|Ga0079037_100166772All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → unclassified Anaerolineae → Anaerolineae bacterium1945Open in IMG/M
3300006224|Ga0079037_100171145All Organisms → cellular organisms → Bacteria1923Open in IMG/M
3300006224|Ga0079037_100361387All Organisms → cellular organisms → Bacteria1365Open in IMG/M
3300006224|Ga0079037_100784638All Organisms → cellular organisms → Bacteria935Open in IMG/M
3300006224|Ga0079037_100795307All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria928Open in IMG/M
3300006224|Ga0079037_101029397All Organisms → cellular organisms → Bacteria815Open in IMG/M
3300006224|Ga0079037_101258008Not Available736Open in IMG/M
3300006224|Ga0079037_101983498All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria582Open in IMG/M
3300006224|Ga0079037_102051280All Organisms → cellular organisms → Bacteria571Open in IMG/M
3300006224|Ga0079037_102057632All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria570Open in IMG/M
3300006224|Ga0079037_102157504Not Available556Open in IMG/M
3300006224|Ga0079037_102158219All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium556Open in IMG/M
3300006844|Ga0075428_100844552All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria972Open in IMG/M
3300006844|Ga0075428_101835979All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria630Open in IMG/M
3300006847|Ga0075431_101572075All Organisms → cellular organisms → Bacteria → Acidobacteria → Vicinamibacteria → Vicinamibacterales → Vicinamibacteraceae → Luteitalea → unclassified Luteitalea → Luteitalea sp. TBR-22616Open in IMG/M
3300006853|Ga0075420_101182978All Organisms → cellular organisms → Bacteria657Open in IMG/M
3300007004|Ga0079218_11022297All Organisms → cellular organisms → Bacteria831Open in IMG/M
3300009075|Ga0105090_10314551All Organisms → cellular organisms → Bacteria959Open in IMG/M
3300009075|Ga0105090_10610963All Organisms → cellular organisms → Bacteria662Open in IMG/M
3300009075|Ga0105090_10694404All Organisms → cellular organisms → Bacteria → Proteobacteria618Open in IMG/M
3300009075|Ga0105090_10841024Not Available558Open in IMG/M
3300009081|Ga0105098_10029959All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Reichenbachiellaceae → Ekhidna → Ekhidna lutea2131Open in IMG/M
3300009085|Ga0105103_10329251All Organisms → cellular organisms → Bacteria836Open in IMG/M
3300009091|Ga0102851_10381551Not Available1411Open in IMG/M
3300009091|Ga0102851_12142982All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Aminicenantes → unclassified Aminicenantes → Candidatus Aminicenantes bacterium635Open in IMG/M
3300009091|Ga0102851_12863802Not Available554Open in IMG/M
3300009091|Ga0102851_13066484All Organisms → cellular organisms → Bacteria536Open in IMG/M
3300009111|Ga0115026_11245467All Organisms → cellular organisms → Bacteria608Open in IMG/M
3300009131|Ga0115027_10014419All Organisms → cellular organisms → Bacteria3198Open in IMG/M
3300009131|Ga0115027_11155802All Organisms → cellular organisms → Bacteria616Open in IMG/M
3300009165|Ga0105102_10065216All Organisms → cellular organisms → Bacteria → Proteobacteria1637Open in IMG/M
3300009167|Ga0113563_11548856All Organisms → cellular organisms → Bacteria782Open in IMG/M
3300009167|Ga0113563_11936423All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium RIFCSPHIGHO2_12_FULL_63_22703Open in IMG/M
3300009167|Ga0113563_12296171All Organisms → cellular organisms → Bacteria649Open in IMG/M
3300009167|Ga0113563_12533850Not Available619Open in IMG/M
3300009167|Ga0113563_13222452All Organisms → cellular organisms → Bacteria552Open in IMG/M
3300009167|Ga0113563_13269537All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria549Open in IMG/M
3300009179|Ga0115028_10156447All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Thiotrichales → unclassified Thiotrichales → Thiotrichales bacterium SG8_501388Open in IMG/M
3300009179|Ga0115028_11418806Not Available585Open in IMG/M
3300010412|Ga0136852_11377027Not Available669Open in IMG/M
3300010412|Ga0136852_11927116Not Available557Open in IMG/M
3300012898|Ga0157293_10178027Not Available624Open in IMG/M
3300012907|Ga0157283_10346769Not Available533Open in IMG/M
3300012912|Ga0157306_10154266Not Available729Open in IMG/M
3300014312|Ga0075345_1108750Not Available633Open in IMG/M
3300014313|Ga0075347_1091091Not Available678Open in IMG/M
3300014316|Ga0075339_1031812All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Cellvibrionales → Microbulbiferaceae → Microbulbifer1289Open in IMG/M
3300014319|Ga0075348_1229531All Organisms → cellular organisms → Bacteria → Proteobacteria524Open in IMG/M
3300014326|Ga0157380_10461304All Organisms → cellular organisms → Bacteria1223Open in IMG/M
3300014326|Ga0157380_11333192Not Available766Open in IMG/M
3300015371|Ga0132258_13667988All Organisms → cellular organisms → Bacteria1048Open in IMG/M
3300018469|Ga0190270_12834328Not Available547Open in IMG/M
3300018469|Ga0190270_13200373Not Available518Open in IMG/M
3300019356|Ga0173481_10509598All Organisms → cellular organisms → Bacteria → Terrabacteria group → unclassified Terrabacteria group → Terrabacteria group bacterium ANGP1615Open in IMG/M
3300022214|Ga0224505_10144690Not Available919Open in IMG/M
3300023266|Ga0247789_1066436Not Available684Open in IMG/M
3300024056|Ga0124853_1394490Not Available1467Open in IMG/M
3300025907|Ga0207645_10615828All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria737Open in IMG/M
3300025919|Ga0207657_11054831Not Available622Open in IMG/M
3300025923|Ga0207681_10144135All Organisms → cellular organisms → Bacteria1777Open in IMG/M
3300025925|Ga0207650_11259038All Organisms → cellular organisms → Bacteria630Open in IMG/M
3300025940|Ga0207691_10753160All Organisms → cellular organisms → Bacteria820Open in IMG/M
3300025956|Ga0210104_1004012All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1787Open in IMG/M
3300026089|Ga0207648_10239672All Organisms → cellular organisms → Bacteria1615Open in IMG/M
3300026116|Ga0207674_11470770All Organisms → cellular organisms → Bacteria650Open in IMG/M
3300026118|Ga0207675_101472766All Organisms → cellular organisms → Bacteria701Open in IMG/M
3300026118|Ga0207675_101913758Not Available611Open in IMG/M
3300027617|Ga0210002_1014655All Organisms → cellular organisms → Bacteria1231Open in IMG/M
3300027693|Ga0209704_1173560Not Available627Open in IMG/M
3300027818|Ga0209706_10051926All Organisms → cellular organisms → Bacteria2066Open in IMG/M
3300027841|Ga0209262_10554720Not Available558Open in IMG/M
3300027871|Ga0209397_10080698All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Cellvibrionales → Halieaceae → Kineobactrum → Kineobactrum salinum1313Open in IMG/M
3300027877|Ga0209293_10170896All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Woeseiaceae → unclassified Woeseiaceae → Woeseiaceae bacterium1048Open in IMG/M
3300027890|Ga0209496_10778633Not Available527Open in IMG/M
3300027897|Ga0209254_10368238All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes1075Open in IMG/M
3300027897|Ga0209254_10601229All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → unclassified Burkholderiales → Burkholderiales bacterium775Open in IMG/M
3300027897|Ga0209254_11054211All Organisms → cellular organisms → Bacteria524Open in IMG/M
3300027909|Ga0209382_10814291All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium993Open in IMG/M
3300027979|Ga0209705_10326035Not Available777Open in IMG/M
3300031547|Ga0310887_10695636Not Available631Open in IMG/M
3300031858|Ga0310892_10003399All Organisms → cellular organisms → Bacteria → Proteobacteria5769Open in IMG/M
3300031908|Ga0310900_10723796All Organisms → cellular organisms → Bacteria799Open in IMG/M
3300031997|Ga0315278_10008381All Organisms → cellular organisms → Bacteria → Proteobacteria9488Open in IMG/M
3300031997|Ga0315278_10868438Not Available907Open in IMG/M
3300031997|Ga0315278_11773566Not Available584Open in IMG/M
3300032013|Ga0310906_11007739All Organisms → cellular organisms → Bacteria599Open in IMG/M
3300032053|Ga0315284_11715997Not Available653Open in IMG/M
3300032075|Ga0310890_11514016Not Available553Open in IMG/M
3300032143|Ga0315292_10165571All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria1789Open in IMG/M
3300032143|Ga0315292_10332431Not Available1269Open in IMG/M
3300032143|Ga0315292_11164999Not Available635Open in IMG/M
3300032143|Ga0315292_11168842All Organisms → cellular organisms → Bacteria634Open in IMG/M
3300032164|Ga0315283_10048322All Organisms → cellular organisms → Bacteria → Proteobacteria4278Open in IMG/M
3300032164|Ga0315283_10132783All Organisms → cellular organisms → Bacteria → Proteobacteria2643Open in IMG/M
3300032164|Ga0315283_11052652All Organisms → cellular organisms → Bacteria858Open in IMG/M
3300032179|Ga0310889_10282388Not Available796Open in IMG/M
3300032179|Ga0310889_10684291All Organisms → cellular organisms → Bacteria534Open in IMG/M
3300032397|Ga0315287_10986907Not Available981Open in IMG/M
3300032401|Ga0315275_11684763Not Available676Open in IMG/M
3300032516|Ga0315273_10154051All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria3152Open in IMG/M
3300033406|Ga0316604_10442892All Organisms → cellular organisms → Bacteria713Open in IMG/M
3300033406|Ga0316604_10569372Not Available623Open in IMG/M
3300033408|Ga0316605_11394777All Organisms → cellular organisms → Bacteria679Open in IMG/M
3300033408|Ga0316605_12441375Not Available508Open in IMG/M
3300033413|Ga0316603_11045679All Organisms → cellular organisms → Bacteria772Open in IMG/M
3300033413|Ga0316603_11868608All Organisms → cellular organisms → Bacteria568Open in IMG/M
3300033413|Ga0316603_12067302All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Variovorax → unclassified Variovorax → Variovorax sp.538Open in IMG/M
3300033413|Ga0316603_12187217All Organisms → cellular organisms → Bacteria522Open in IMG/M
3300033414|Ga0316619_10224824All Organisms → cellular organisms → Bacteria1373Open in IMG/M
3300033414|Ga0316619_11353925Not Available634Open in IMG/M
3300033416|Ga0316622_100290709All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → unclassified Anaerolineae → Anaerolineae bacterium1792Open in IMG/M
3300033416|Ga0316622_100999903All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Oceanospirillales → Alcanivoracaceae → Alcanivorax → unclassified Alcanivorax → Alcanivorax sp. 1008976Open in IMG/M
3300033416|Ga0316622_101368029Not Available827Open in IMG/M
3300033416|Ga0316622_102191834All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria640Open in IMG/M
3300033416|Ga0316622_102461073All Organisms → cellular organisms → Bacteria600Open in IMG/M
3300033416|Ga0316622_102636388All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium578Open in IMG/M
3300033416|Ga0316622_102821350Not Available556Open in IMG/M
3300033416|Ga0316622_102839856Not Available554Open in IMG/M
3300033416|Ga0316622_103401159All Organisms → cellular organisms → Bacteria501Open in IMG/M
3300033418|Ga0316625_101013837All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Ectothiorhodospiraceae → Thioalkalivibrio → unclassified Thioalkalivibrio → Thioalkalivibrio sp. XN8740Open in IMG/M
3300033418|Ga0316625_101288565Not Available676Open in IMG/M
3300033418|Ga0316625_101375760All Organisms → cellular organisms → Bacteria659Open in IMG/M
3300033418|Ga0316625_101514590Not Available635Open in IMG/M
3300033418|Ga0316625_102107244Not Available558Open in IMG/M
3300033419|Ga0316601_100137568Not Available2052Open in IMG/M
3300033419|Ga0316601_100258702All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium1569Open in IMG/M
3300033419|Ga0316601_100669875All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium1015Open in IMG/M
3300033419|Ga0316601_100972425Not Available846Open in IMG/M
3300033419|Ga0316601_101992581All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium585Open in IMG/M
3300033419|Ga0316601_102051062Not Available576Open in IMG/M
3300033419|Ga0316601_102203836All Organisms → cellular organisms → Bacteria555Open in IMG/M
3300033434|Ga0316613_10051122All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii2389Open in IMG/M
3300033434|Ga0316613_10169850All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria1389Open in IMG/M
3300033434|Ga0316613_10658226All Organisms → cellular organisms → Bacteria716Open in IMG/M
3300033434|Ga0316613_10753165All Organisms → cellular organisms → Bacteria668Open in IMG/M
3300033434|Ga0316613_11263327Not Available509Open in IMG/M
3300033481|Ga0316600_10021767Not Available3287Open in IMG/M
3300033481|Ga0316600_10044300All Organisms → cellular organisms → Bacteria2463Open in IMG/M
3300033481|Ga0316600_10161907All Organisms → cellular organisms → Bacteria1432Open in IMG/M
3300033481|Ga0316600_10190189All Organisms → cellular organisms → Bacteria1333Open in IMG/M
3300033482|Ga0316627_101448968All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → unclassified Chromatiales → Chromatiales bacterium692Open in IMG/M
3300033482|Ga0316627_102074154Not Available592Open in IMG/M
3300033483|Ga0316629_10284432All Organisms → cellular organisms → Bacteria1107Open in IMG/M
3300033487|Ga0316630_10054092All Organisms → cellular organisms → Bacteria2469Open in IMG/M
3300033487|Ga0316630_10364123All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes1140Open in IMG/M
3300033487|Ga0316630_10750394Not Available832Open in IMG/M
3300033488|Ga0316621_10104835All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae1597Open in IMG/M
3300033488|Ga0316621_10182431All Organisms → cellular organisms → Bacteria1291Open in IMG/M
3300033488|Ga0316621_10321091All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Caulobacterales → Caulobacteraceae → Brevundimonas → Brevundimonas variabilis1026Open in IMG/M
3300033488|Ga0316621_10413346All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Woeseiaceae → unclassified Woeseiaceae → Woeseiaceae bacterium922Open in IMG/M
3300033488|Ga0316621_10460157Not Available881Open in IMG/M
3300033488|Ga0316621_10509788All Organisms → cellular organisms → Bacteria842Open in IMG/M
3300033488|Ga0316621_10661502Not Available750Open in IMG/M
3300033488|Ga0316621_10816897All Organisms → cellular organisms → Bacteria683Open in IMG/M
3300033488|Ga0316621_11228391All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → unclassified Chromatiales → Chromatiales bacterium567Open in IMG/M
3300033488|Ga0316621_11420601Not Available530Open in IMG/M
3300033488|Ga0316621_11458681Not Available524Open in IMG/M
3300033521|Ga0316616_100374328All Organisms → cellular organisms → Bacteria1562Open in IMG/M
3300033521|Ga0316616_100412648All Organisms → cellular organisms → Bacteria1503Open in IMG/M
3300033521|Ga0316616_101837540All Organisms → cellular organisms → Bacteria797Open in IMG/M
3300033557|Ga0316617_100389048All Organisms → cellular organisms → Bacteria1225Open in IMG/M
3300033557|Ga0316617_100787893All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Caulobacterales → Caulobacteraceae → Brevundimonas → Brevundimonas variabilis908Open in IMG/M
3300033557|Ga0316617_102299685Not Available557Open in IMG/M
3300033557|Ga0316617_102892440Not Available500Open in IMG/M
3300034076|Ga0373898_032660All Organisms → cellular organisms → Bacteria771Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil34.97%
Freshwater WetlandsEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands13.66%
SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Sediment7.65%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment6.01%
WetlandEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Wetland4.37%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil3.83%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil3.28%
Natural And Restored WetlandsEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands2.73%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere2.73%
Freshwater Lake SedimentEnvironmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment1.64%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere1.64%
Arabidopsis Thaliana RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere1.64%
Natural And Restored WetlandsEnvironmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands1.09%
Mangrove SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Mangrove Sediment1.09%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil1.09%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil1.09%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere1.09%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere1.09%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere1.09%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere1.09%
SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Sediment0.55%
SedimentEnvironmental → Aquatic → Freshwater → Lentic → Sediment → Sediment0.55%
FreshwaterEnvironmental → Aquatic → Freshwater → Pond → Sediment → Freshwater0.55%
WetlandEnvironmental → Aquatic → Marine → Wetlands → Sediment → Wetland0.55%
MarineEnvironmental → Aquatic → Marine → Wetlands → Sediment → Marine0.55%
SedimentEnvironmental → Aquatic → Marine → Sediment → Unclassified → Sediment0.55%
Sediment (Intertidal)Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal)0.55%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil0.55%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil0.55%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere0.55%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere0.55%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere0.55%
Sediment SlurryEngineered → Bioremediation → Metal → Unclassified → Unclassified → Sediment Slurry0.55%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000124Marine microbial communities from chronically polluted sediments in the Baltic Sea - site KBA sample SWE 12_21mEnvironmentalOpen in IMG/M
3300000881Soil microbial communities from Great Prairies - Wisconsin Restored Prairie soilEnvironmentalOpen in IMG/M
3300000891Soil microbial communities from Great Prairies - Wisconsin, Continuous corn soilEnvironmentalOpen in IMG/M
3300001213Combined assembly of wetland microbial communities from Twitchell Island in the Sacramento Delta (Jan 2013 JGI Velvet Assembly)EnvironmentalOpen in IMG/M
3300004050Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushSE_CattailNLA_D2EnvironmentalOpen in IMG/M
3300004463Combined assembly of Arabidopsis thaliana microbial communitiesHost-AssociatedOpen in IMG/M
3300004480Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4EnvironmentalOpen in IMG/M
3300004481Combined Assembly of Gp0112041, Gp0112042, Gp0112043EnvironmentalOpen in IMG/M
3300004643Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3EnvironmentalOpen in IMG/M
3300005487Sediment microbial communities from Lake Washington, Seattle, Washington, USA - Methanol enrichmentEnvironmentalOpen in IMG/M
3300005718Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2Host-AssociatedOpen in IMG/M
3300005829Microbial communities from Cathlamet Bay sediment, Columbia River estuary, Oregon - S.190_CBCEnvironmentalOpen in IMG/M
3300005844Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2Host-AssociatedOpen in IMG/M
3300006224Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 4 metaGEnvironmentalOpen in IMG/M
3300006844Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2Host-AssociatedOpen in IMG/M
3300006847Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5Host-AssociatedOpen in IMG/M
3300006853Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD4Host-AssociatedOpen in IMG/M
3300007004Agricultural soil microbial communities from Utah to study Nitrogen management - NC CompostEnvironmentalOpen in IMG/M
3300009075Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 1-3cm March2015EnvironmentalOpen in IMG/M
3300009081Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm May2015EnvironmentalOpen in IMG/M
3300009085Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 10-12cm September2015EnvironmentalOpen in IMG/M
3300009091Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 3 metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300009111Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Mud_0915_D1EnvironmentalOpen in IMG/M
3300009131Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Open_0915_D1EnvironmentalOpen in IMG/M
3300009165Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 1-3cm September2015EnvironmentalOpen in IMG/M
3300009167Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 3 metaG - Illumina Assembly (version 2)EnvironmentalOpen in IMG/M
3300009179Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Plant_0915_D1EnvironmentalOpen in IMG/M
3300010412Mangrove sediment microbial communities from Mai Po Nature Reserve Marshes in Hong Kong, China - Maipo_10EnvironmentalOpen in IMG/M
3300012898Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S194-509B-1EnvironmentalOpen in IMG/M
3300012907Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S044-104R-1EnvironmentalOpen in IMG/M
3300012912Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S163-409C-2EnvironmentalOpen in IMG/M
3300014312Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushSE_CattailNLA_D1EnvironmentalOpen in IMG/M
3300014313Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushSE_CattailNLC_D1EnvironmentalOpen in IMG/M
3300014316Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushMan_CattailNLC_D1EnvironmentalOpen in IMG/M
3300014319Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushSE_TuleA_D1EnvironmentalOpen in IMG/M
3300014326Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaGHost-AssociatedOpen in IMG/M
3300015371Combined assembly of cpr5 and col0 rhizosphere and soilHost-AssociatedOpen in IMG/M
3300018469Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 TEnvironmentalOpen in IMG/M
3300019356Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S073-202C-2 (version 2)EnvironmentalOpen in IMG/M
3300022214Sediment microbial communities from San Francisco Bay, California, United States - SF_Jan12_sed_USGS_4_1EnvironmentalOpen in IMG/M
3300023266Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S220-509R-4EnvironmentalOpen in IMG/M
3300024056Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 3 metaG (PacBio error correction)EnvironmentalOpen in IMG/M
3300025907Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025919Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025923Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025925Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025940Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025956Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushSE_TuleA_D2 (SPAdes)EnvironmentalOpen in IMG/M
3300026089Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026116Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026118Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300027617Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes)Host-AssociatedOpen in IMG/M
3300027693Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 1-3cm September2015 (SPAdes)EnvironmentalOpen in IMG/M
3300027726Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (3) Depth 1-3cm March2015 (SPAdes)EnvironmentalOpen in IMG/M
3300027818Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 19-21cm September2015 (SPAdes)EnvironmentalOpen in IMG/M
3300027841Freshwater pond sediment microbial communities from the University of Edinburgh, under environmental carbon perturbations - Low cellulose week 11 (SPAdes)EnvironmentalOpen in IMG/M
3300027871Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Open_0915_D1 (SPAdes)EnvironmentalOpen in IMG/M
3300027877Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Mud_0915_D1 (SPAdes)EnvironmentalOpen in IMG/M
3300027890Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Plant_0915_D1 (SPAdes)EnvironmentalOpen in IMG/M
3300027897Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - DIP11 DI (SPAdes)EnvironmentalOpen in IMG/M
3300027909Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes)Host-AssociatedOpen in IMG/M
3300027979Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 10-12cm September2015 (SPAdes)EnvironmentalOpen in IMG/M
3300031547Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D4EnvironmentalOpen in IMG/M
3300031858Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D2EnvironmentalOpen in IMG/M
3300031908Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D1EnvironmentalOpen in IMG/M
3300031997Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G06_0EnvironmentalOpen in IMG/M
3300032013Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D3EnvironmentalOpen in IMG/M
3300032053Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_16EnvironmentalOpen in IMG/M
3300032075Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D3EnvironmentalOpen in IMG/M
3300032143Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_0EnvironmentalOpen in IMG/M
3300032164Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_0EnvironmentalOpen in IMG/M
3300032179Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D2EnvironmentalOpen in IMG/M
3300032397Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_0EnvironmentalOpen in IMG/M
3300032401Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G03_0EnvironmentalOpen in IMG/M
3300032516Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_0EnvironmentalOpen in IMG/M
3300033406Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day20_CTEnvironmentalOpen in IMG/M
3300033408Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day20_noCTEnvironmentalOpen in IMG/M
3300033413Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day10_noCTEnvironmentalOpen in IMG/M
3300033414Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D4_BEnvironmentalOpen in IMG/M
3300033416Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_OW2_C1_D5_CEnvironmentalOpen in IMG/M
3300033418Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_T1_C1_D1_AEnvironmentalOpen in IMG/M
3300033419Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day5_noCTEnvironmentalOpen in IMG/M
3300033434Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day10_CT_bEnvironmentalOpen in IMG/M
3300033481Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day5_CTEnvironmentalOpen in IMG/M
3300033482Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M2_C1_D1_CEnvironmentalOpen in IMG/M
3300033483Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_May_M1_C1_D1_AEnvironmentalOpen in IMG/M
3300033487Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_May_M1_C1_D6_AEnvironmentalOpen in IMG/M
3300033488Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_OW2_C1_D1_CEnvironmentalOpen in IMG/M
3300033521Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D1_BEnvironmentalOpen in IMG/M
3300033557Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D2_BEnvironmentalOpen in IMG/M
3300034076Uranium-contaminated sediment microbial communities from bioreactor in Oak Ridge, Tennessee, United States - A5A4.2EngineeredOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
BS_KBA_SWE12_21mDRAFT_1006433213300000124MarineLADAPTERDDEAAWARLSRRKVVQWGLAYAAGAWALLEVIGFAA
JGI10215J12807_118035813300000881SoilVTDTPEERGAESTWTRLRRRKVVQWGVAYAAGAWLLMQVLEYFSGTFDW
JGI10214J12806_1215252113300000891SoilVTDTPEERGAESTWTRLRRRKVVQWGVAYAAGAWLLMQVLEYF
JGIcombinedJ13530_10085828913300001213WetlandVTDTPTEREGEDAWMKLRRRKVVQWGIAYSAAAWTLLQVMEYLTETYGWP
Ga0055491_1004967523300004050Natural And Restored WetlandsVTDTPTEREGAWAKLRRRKVVQWCLTYGLGAWGFLQGLEYVS
Ga0063356_10023052113300004463Arabidopsis Thaliana RhizosphereMNDATPPTDEGVWVRLRRRKVVQWGIAYAAGAWVLLQVLGFATDTY
Ga0063356_10151790613300004463Arabidopsis Thaliana RhizosphereVTDTPAEREAESTWTSLRRRKVVQWGLAYAAGAWVLLQVLGFATDTY
Ga0062592_10046403533300004480SoilVTDTPEERGAESTWTRLRRRKVVQWGVAYAAGAWLLMQVLEYFSGTF
Ga0069718_1567207013300004481SedimentVTDTPTEREGEGAWTKLRRRKVVQWGFAYAAAAWTLLQVIEYLGETYGWP
Ga0062591_10268283813300004643SoilVTSAGVAGVAGIWQKLRRRKVVQWGIAYVAAAWALLQGIDF
Ga0074211_15217613300005487SedimentMPTADEGGTWANLLRRKVVQWGLAYAAGAWASLQVFGFAADSFGWPT
Ga0068866_1033718923300005718Miscanthus RhizosphereVNDAPAERGGDSAWARLRRRKVMQWGIAYAAAAWVLLQVL
Ga0074479_1028137313300005829Sediment (Intertidal)VTDAPTEREGEGAFSKLRRRKVVQWGIVYVAGAWGLLQGIGFSADA
Ga0068862_10061761813300005844Switchgrass RhizosphereVNDTPAERAAESTWTRVRRRKVVQWGVAYAAGAWLLMQVLEYFSGTFDWPRQ
Ga0079037_10007347333300006224Freshwater WetlandsVTDAPTEREDEGAWAKLRRRKVVQWGIAYAGGSWVVLQVIGFFADAFH
Ga0079037_10012587743300006224Freshwater WetlandsVSEHHQVTDTPERGEVASTWDKLRRRKVVQWGIVYAAGAW
Ga0079037_10016677213300006224Freshwater WetlandsVTDAPTEREGEGAWTRLRRRKVVQWGIAYAAAAWTLLQ
Ga0079037_10017114513300006224Freshwater WetlandsMTDTPTERAYEGAWARLRHHKVVQWTLAYGAAAYTLL
Ga0079037_10036138723300006224Freshwater WetlandsVTGTPTEREEEGGWAKLRRHKVVQWSLAYAAGAWLLLQVLAYVSG
Ga0079037_10078463833300006224Freshwater WetlandsLADSPTERETEGPWDKLRRRKVVQWGLAYAAGAWGLLQGLEYVSE
Ga0079037_10079530723300006224Freshwater WetlandsVTDAPTEREGEGAWTRLHRRKVVQWGVAYAAAAWTLLQVIEYLGETY
Ga0079037_10102939713300006224Freshwater WetlandsLIDTPTGLAGEGAWAKLRRRKVVQWGVAYVAAAWG
Ga0079037_10125800813300006224Freshwater WetlandsMTEPTEQGGENLWTRLRRRKVVQWALAYAAGAWTLL
Ga0079037_10198349813300006224Freshwater WetlandsVTESTEPAGENLWTRLRRRKVVQWGIAYAAAAWTLLQVLEYFGE
Ga0079037_10205128023300006224Freshwater WetlandsMTEPTEQGGENLWTRLRRRKVVQWALAYAAGAWTLLQGLEYIT
Ga0079037_10205763213300006224Freshwater WetlandsLADTPTERETEGPWDKLRRRKVVQWGLAYAAGAWGLLQGLEYV
Ga0079037_10215750413300006224Freshwater WetlandsMTDTPIEREEEGGWAKLRRRKVVQWSLAYAAGAWL
Ga0079037_10215821913300006224Freshwater WetlandsMTDAPPELEGDGPWAKLRRRKVVQWGVLYAAGAWGFLQGLEYATD
Ga0075428_10084455213300006844Populus RhizosphereVTDTPTRGGGEGPWAKLRRRKVVEWGIAYAAGAWGL
Ga0075428_10183597923300006844Populus RhizosphereVTDTPTRGGGEGPWAKLRRRKVVEWGIAYAAGAWG
Ga0075431_10157207523300006847Populus RhizosphereVTDTPTERETEDVWTRLRPRNVVQWGIAYVAGGWAILQMNLPT*
Ga0075420_10118297823300006853Populus RhizosphereLSAAPAEREAESAWARLRRRKVVQWGLIYVAGAWGFLQG
Ga0079218_1102229733300007004Agricultural SoilVTDTPTEREAESTWTRLRRRKVVQWTVAYAAGGWVLLQVLDFAADAFAW
Ga0105090_1031455123300009075Freshwater SedimentMTDAPPEREGEGPWAKLRRRKVVQWGVLYAAGAWGFLQGL
Ga0105090_1061096313300009075Freshwater SedimentLIDTPTGLAGAGAWAKLRRRKVVQWGIAYVAAAWGLLQGL
Ga0105090_1069440413300009075Freshwater SedimentMTDAQTEPAVEGAWDKLRRRKVVQWGIVYAAGAWGLLQGL
Ga0105090_1084102423300009075Freshwater SedimentVSKTPAEDEGAWAKLRRRKVVQWGLAYAATAWTLL
Ga0105098_1002995913300009081Freshwater SedimentLAAGGNEVTDAPAEREGDSAWAKLRRRKVVQWGIAYVAAAW
Ga0105103_1032925113300009085Freshwater SedimentMTDAPPEREGEGPWAKLRRRKVVQWGVLYAAGAWGFLQ
Ga0102851_1038155113300009091Freshwater WetlandsVTEPTEQGGENLWTRLRRRKVVQWGIAYAAAAWTLLQ
Ga0102851_1214298213300009091Freshwater WetlandsVTDVPEEREGEGAWANLRRRKVVQWGIAYLAGAWALLQSI
Ga0102851_1286380213300009091Freshwater WetlandsVTDAPTEREGEGAWTRLRRRKVVQWGIAYAAAAWT
Ga0102851_1306648413300009091Freshwater WetlandsVTDVPTEREGGGAWTKLRRRKVVQWSLAYAAAAWTLLQVIEYLGE
Ga0115026_1124546713300009111WetlandMPTERAGENPWGRLRRRKVGQWGIVYAAGAWGFLQG
Ga0115027_1001441953300009131WetlandMDVTDATTERAGEDLWAKLRRRKVVQWGLTYLAGAWGLLQGI
Ga0115027_1115580213300009131WetlandVTDAPTEREGEGAWTRLRRRKVVQWGIAYAAAAWTLLQVLEYFGETYV
Ga0105102_1006521633300009165Freshwater SedimentMTESPSGREGQGLWDKLRRRKVVQWGIIYAAGAWGFLQGLAYV
Ga0113563_1154885623300009167Freshwater WetlandsVTDAPTEREGEGGWAKLRRRKVVQWGIAYAAGSWVLLQVLGFAADA
Ga0113563_1193642313300009167Freshwater WetlandsVTDAPTEREEEGGWAKLRRRKVVQWGVAYAAAAWTLLQVIEFL
Ga0113563_1229617123300009167Freshwater WetlandsVTDAPTEREGEGAWTRLRRRKVVQWGIAYAAAAWTLLQVLE
Ga0113563_1253385013300009167Freshwater WetlandsMTDAPTKRDDEGGWAELRRRKVVQWGIAYAAGAWVLLQVIGFL
Ga0113563_1322245223300009167Freshwater WetlandsLIDTPTGLAGEGTWAKLRRRKVVQWGVAYVAAAWGLL
Ga0113563_1326953713300009167Freshwater WetlandsVTGASDQREGDSHWTVLSRRKVVQWGLGYAAAAWTLLQVIE
Ga0115028_1015644713300009179WetlandVTDTPTEREEEGGWAKLHRRKVVQWGLAYAAGAWALL
Ga0115028_1141880613300009179WetlandMTEPTEQGGENLWTRLRRRKVVQWALAYAAGAWTLLQ
Ga0136852_1137702713300010412Mangrove SedimentVTDTPGEPASGGLWAKLRSKKVVQWGIAYAAIAWTL
Ga0136852_1192711613300010412Mangrove SedimentLGDSPPEPQRENTWDRLRRRKVVQWGIAYAAGAWGLLQGIS
Ga0157293_1017802713300012898SoilVNDAPAEREGDSTWARLRRRKVVQWGIAYAAAAWVL
Ga0157283_1034676913300012907SoilVNDTPAEREAENIWTTLRRRKVVQWTVAYAAGAWLTLQVLGFAADTY
Ga0157306_1015426613300012912SoilVTDTPAERGAESTWARLRRRKVVQWGFAYAAAAWV
Ga0075345_109684713300014312Natural And Restored WetlandsVTDVPTETTGESAWDKLRRRKVGQWGILYAAGAWGFLQGLE
Ga0075345_110875013300014312Natural And Restored WetlandsMTDTPIEREEEGGWAKLRRRKVVQWSLAYAAGAWLLLQVIGFLADA
Ga0075347_109109133300014313Natural And Restored WetlandsVTDTPTAREDERAWGKLRRRKVVQWGLAYAAGAWVLLQGLEYVTGTF
Ga0075339_103181223300014316Natural And Restored WetlandsVTDAPTEREGEGDWTKLRRRKVVQWGIAYAAAAWTLLQVIEYLGETYAW
Ga0075348_122953113300014319Natural And Restored WetlandsVTDPPPERQGESTWDRLRRRKVVQWGVAYAAGAWGLLQGISYVT
Ga0157380_1046130423300014326Switchgrass RhizosphereMTDAPTESAGESAWAKLRRRKVVQWGIAFVAAAWGLLQGLE*
Ga0157380_1133319213300014326Switchgrass RhizosphereVNDTPAERGADSTWAILRRRKVVQWTVAYAAGAWVLLQVLDF
Ga0132258_1366798813300015371Arabidopsis RhizosphereVNDTPTERAVESTWTGLRRRKVVQWGIAYAAVAWGLLQGL
Ga0190270_1283432813300018469SoilLTDTPAERGAESTWTRLRRRKVVQWGLAYAAGAWLLMQL
Ga0190270_1320037323300018469SoilVTDTPTRGGGEGTWAKLRRRKVVQWGIAYAAGAWGLL
Ga0173481_1050959823300019356SoilVNDTPAEREAENIWKTLRRRKVVQWTVAYSAGGWVLLQVLGFAA
Ga0224505_1014469013300022214SedimentVTDTPTERASDGAWARLTRRKVVQWGIAYLAGAWVLLQV
Ga0247789_106643613300023266SoilVNDTPAEREAENIWTTLRRRKVVQWTVAYSAGGWVLLQVL
Ga0124853_139449023300024056Freshwater WetlandsVAETPTGRETGSAWTTLHRRKVVQWGVAYAAGAWTLMQVLEYFSGTFDCPARFSNCRRSF
Ga0207645_1061582823300025907Miscanthus RhizosphereVTDTPPEREAESTWTSLRRRKVVQWGVAYVAAAWGL
Ga0207657_1105483113300025919Corn RhizosphereVNDAPAERGGDSAWARLRRRKVMQWGIAYAAAAWVLLQVLE
Ga0207681_1014413513300025923Switchgrass RhizosphereVTDTPAERGAESTWARLRRRKVVQWGFAYAAAAWVLLQV
Ga0207650_1125903823300025925Switchgrass RhizosphereVTDTPTEREGEGIWTRLRRRKVVQWGIAYAAGAWGL
Ga0207691_1075316013300025940Miscanthus RhizosphereVTDAPIERAVESTWTRLRRRKVVQWGIIYVAAAWGFLQ
Ga0210104_100401223300025956Natural And Restored WetlandsMTDTPTEREEEGAWTKLRRRKVVQWGLAYAAGAWVLLQGLEYVTGTF
Ga0207648_1023967243300026089Miscanthus RhizosphereVTDTPAERGAESTWARLRRRKVVQWGFAYAAAAWVLLQVLEY
Ga0207674_1147077023300026116Corn RhizosphereVNDTPAEREAENIWTTLRRRKVVQWTVAYSAGGWVLL
Ga0207675_10147276613300026118Switchgrass RhizosphereVTDTPAERAAEGTWTRLRRRKVAQWGVAYAAGAWLLMQVL
Ga0207675_10191375813300026118Switchgrass RhizosphereMTDAPTESAGESAWAKLRRRKVVQWGIAFVAAAWGLLQG
Ga0210002_101465523300027617Arabidopsis Thaliana RhizosphereVTDTPPEREAESTWTSLRRRKVVQWGVAYVAAAWGLLQ
Ga0209704_117356013300027693Freshwater SedimentLIDTPTGLAGEGAWAKLRRRKVVQWGIAYVAAAWG
Ga0209285_1005117813300027726Freshwater SedimentLAEAGGGDAEGAWAKLRRRKVAQWGIAYAAGAWGLL
Ga0209706_1005192633300027818Freshwater SedimentVSDTPPEREDGSPWAKLRRRKVVQWGIVYAAGAWGFLQGLE
Ga0209262_1055472013300027841FreshwaterMTDAPTERDANGALAKLRRRKVVQWGLAYAAGAWALLQVI
Ga0209397_1008069823300027871WetlandLTDTPAEREDEGAWAKLRRRKVVQWGLAYAAGAWALLEV
Ga0209293_1017089613300027877WetlandLIDTPTGLAGEGAWAKLRRRKVVQWGIAYVAAAWGLLQGLAYL
Ga0209496_1077863313300027890WetlandVTDTPPEREDEGAWAKLRRRKVVQWGIAYAAGAWGL
Ga0209254_1036823813300027897Freshwater Lake SedimentVTDAPTEREGEGDWTKLRRRKVVQWGLAYAAAAWTLLQV
Ga0209254_1060122923300027897Freshwater Lake SedimentVTDAPTEREGDGAWTRLRRRKVVQWGIAYAAAAWTLLQVLEYFG
Ga0209254_1105421123300027897Freshwater Lake SedimentVTDTPIEREEEGGWAKLRRRKVVQWGLAYAAGAWVMLQV
Ga0209382_1081429113300027909Populus RhizosphereVNDTPTEREGESVWTRLRRRRVVQWGVAYAASAWVLLQV
Ga0209705_1032603523300027979Freshwater SedimentLTDAPTERDANGAWAKLRRRKVVQWGLAYAAGAWALLQVIG
Ga0310887_1069563613300031547SoilVNDTPAEREAENIWTTLRRRKVVQWTVAYSAGGWVLLQ
Ga0310892_1000339953300031858SoilVNDTPAEREAENIWTTLRRRKVVQWTVAYSAGGWVLLQVLGFAADTYGWPTIV
Ga0310900_1072379623300031908SoilVTDTPAERAAEGTWTRLRRRKVAQWGVAYAAGAWL
Ga0315278_10008381133300031997SedimentVTNAPTEREGEGAWTKLTRRKLVQWGVAYAAGAWQVTQAWITEI
Ga0315278_1086843813300031997SedimentLTDAPTTRDDESAWARLRRRKVVQWGLAYAAGAWALLQ
Ga0315278_1177356623300031997SedimentLTDAPNERDDERAWAKLSRRKVVQWGLAYAAGAWALLQVIGF
Ga0310906_1100773913300032013SoilLTDTPAERGAESTWARRRRRKVVQWGFAYAAAAWVLLQVLEY
Ga0315284_1171599713300032053SedimentVTDAPTEREGEGAFSKLRRRKVVQWSFAYAAAAWTLLQ
Ga0310890_1151401613300032075SoilMRHGGRRVNDTPAERGAESWWGALRRRKVVQWTVAYAAGGWVLLQVLGFAADT
Ga0315292_1016557113300032143SedimentMSDESTERAPAGIWAKLRRRKVVQWGVVYAAGAWGLLQGLAYVSAT
Ga0315292_1033243123300032143SedimentVTDTPTEREEPGGWAKLRRRKVVQWGLAYAAAAWT
Ga0315292_1116499913300032143SedimentVTDAPTEREGEGAWTKLRHRKVVQWGIAYAAGSWVLLQVLGYVS
Ga0315292_1116884213300032143SedimentVTDTPTEREGAGPWAKLRRRKVVQWGIAYVAGAWGLL
Ga0315283_1004832213300032164SedimentVTDTPTEREGEGPWAKLRRRKVVQWGIVYAAGAWGLLQGL
Ga0315283_1013278313300032164SedimentVTDAPAEREGEGAWTKLRRRKVVQWGIAYAAAAWTLLQVLEYFGETYA
Ga0315283_1105265213300032164SedimentVTDAPTEREGDGALSKLRHRKVVQWGIAYAAGAWGLLQGIE
Ga0310889_1028238813300032179SoilVTDTPTERAAESTWTRLRRRKVVQWGVAYAAGAWLLMQ
Ga0310889_1068429113300032179SoilVNDAPAEREGDSTWARLRRRKVVQWGIAYAAAAWVLLQVLEY
Ga0315287_1098690723300032397SedimentVTDATEGEGEGLWTRLRRRKLVQWSLAYAAAAWVLLQ
Ga0315275_1168476323300032401SedimentVTDTPTKRAGEGAWTKLRQRKVVQWGIAYAAGAWALL
Ga0315273_1015405113300032516SedimentVTDTPTEREGEGAWTKLRRRKVVQWGIAYAAGAWVLLQVLGYVS
Ga0316604_1044289223300033406SoilLNEAPSEREDEGAWARLRRRKVVQWGLTYAAGAWLLLQVV
Ga0316604_1056937213300033406SoilVTDAPTEREGEGAFSKLRRRKAVRWGLAYAAGAWALLQV
Ga0316605_1139477723300033408SoilVTDAQAEREADGPWAKLRRRKVVQWGIVYAAGAWGF
Ga0316605_1244137523300033408SoilVTDTPAEREGDSAWAKLRRRKVVQWGVAYAAGAWGFLQ
Ga0316603_1104567913300033413SoilVTDAPTEREGESPWARLRRRKVVQWGLAYAAAAWTLLQVIEYFGET
Ga0316603_1186860813300033413SoilVTDAPTEREGEGAWTRLHRRKVVQWGVAYAAAAWTLLQVIEYLGETYAW
Ga0316603_1206730223300033413SoilLTESTEGEGESTWTRLRRRKVVQWAIAYMAGAWGLLQ
Ga0316603_1218721723300033413SoilVTDTPTEREREGAWARLRRRKVVQWGLGYTAVAWTLLQGLE
Ga0316619_1022482413300033414SoilVTDAPTEREGEGAWTRLHRRKVVQWGVAYAAAAWTLLQVIEY
Ga0316619_1135392513300033414SoilVTDAPTEREGEGAWTKLRRRKVVQWSLAYAAAAWT
Ga0316622_10029070913300033416SoilVTDAPTEREGEGAWTRLRRRKVVQWGIAYAAAAWTLLQVLEYF
Ga0316622_10099990333300033416SoilMTDTPTEREEEGGWARLRRRKVVQWGIAYSAGAWALLQG
Ga0316622_10136802923300033416SoilMTDTPTEREGEGGWAKLRRRKVVQWGLAYAAGAWALLQVIG
Ga0316622_10219183413300033416SoilVIDAPTEHEGEGAFSRLRRRKVVQWGLAYAAGAWALLQVVGFA
Ga0316622_10246107323300033416SoilMTDAPPEREGDGPWAKLRRRKVVQWGVLYAAGAWGFLQ
Ga0316622_10263638823300033416SoilVTDAPTEREGEGAWTKLRRRKVVQWGLAYTAGAWSVLQVIG
Ga0316622_10282135013300033416SoilLIDTPTGLAGEGAWAKLRRRKVVQWGVAYVAAAWGL
Ga0316622_10283985613300033416SoilVTDTPIERDDEVGWAKLRRRKVVQWGLAYAAGAWALL
Ga0316622_10340115913300033416SoilVTEPTEQGGENLWIRLRRRKVVQWGIAYAAAAWTL
Ga0316625_10101383713300033418SoilVTDTPTAREDEGAWGKLRRRKVVQWGIAYAAGVWGLLQVLDYLG
Ga0316625_10128856513300033418SoilVIDTPPEREDGSPWAKLRRRKVVQWGIVYAAGAWG
Ga0316625_10137576013300033418SoilVTDAPTEREGEGAWTKLRRRKVVQWSLAYAAAAWTLLQVIEYLGETYS
Ga0316625_10151459023300033418SoilMTDAPTERNHEGGWAKLRRRKVVQWGIAYAAGAWVLLQVIGFL
Ga0316625_10210724423300033418SoilVTDAPTEREGEGAFSKLRRRKVVQWGLAYAAGAWALL
Ga0316601_10013756813300033419SoilVTNTPTEREDEGAWGKLRRRKVVQWGIAYAAGAWGLLQALSYLGGT
Ga0316601_10025870223300033419SoilMTDTPTEREAEGAWANLRRRKVVQWSLAYAAGAWVLLQVLGFAA
Ga0316601_10066987523300033419SoilMTEPTERGGENLWTRLRRRKVVQWALAYAAGAWALLQVLE
Ga0316601_10097242513300033419SoilVAETPTGRETGSAWTTLHRRKVVQWGVAYAAGAWTLMQVLE
Ga0316601_10199258113300033419SoilVTDAPTEREGEGAWTRLCRRKVVQWGLAYAAGAWVMLQVIG
Ga0316601_10205106223300033419SoilVTDAPTEREGEGAFSKLRRRKAVRWSLAYAAGAWALLQVVGF
Ga0316601_10220383613300033419SoilVSEPAEPADEGMWARLRRRKVVQWGIVYAAGAWGFLQGL
Ga0316613_1005112233300033434SoilVTDAPTEREGEGGWANLRRRKFVQWGLAYAAGAWALLQVIGFL
Ga0316613_1016985013300033434SoilMDVTDATTERAGEDLWAKLRRRKVVQWGLTYLAGAWGLL
Ga0316613_1065822613300033434SoilVIDPPTERDEDGAWTRLRRRKVVQWSIAYAAGAWGLLQVLQFL
Ga0316613_1075316513300033434SoilVTEPTEQGGEGTWARLRRRKVVQWSLAYAAGAWGFL
Ga0316613_1126332713300033434SoilMTDTPTEREGEGGWANLRRRKVVQWGLAYAAGAWALLQAIGFF
Ga0316600_1002176723300033481SoilVTDAPTEREGESPWTALSRRKVVQWGLAYAAAAWTLLQ
Ga0316600_1004430013300033481SoilVTDAPREREDAGAWGKLRRRKVVQWGIAYGAGAWALLQV
Ga0316600_1016190733300033481SoilVTDAPTEREGEGGWAKLRRRKVVQWGIAYAAAAWTLLQVLEYFGETYL
Ga0316600_1019018913300033481SoilVTDAPTEREGEGTWAKLRRRKVVQWGIAYAAGAWA
Ga0316627_10144896813300033482SoilVTNAPAEREDEGAWAKLRRRKVVQWGIAYAAGAWGLLQV
Ga0316627_10207415413300033482SoilMAVTDTPTEREREGAWARLRRRKVVQWGLGYAAVAWTLLQGL
Ga0316629_1028443223300033483SoilVTEPTEQGGENLWIRLRRRKVVQWGIAYAAAAWTLLQVLEYFG
Ga0316630_1005409213300033487SoilVTDTPTEVGGEGTWARLRRRKVVQWGVAYAAGAWALLQGIGFL
Ga0316630_1036412313300033487SoilVTDAPTEREGEGAWTKLRRRKVVQWGIAYTAGSWVLLQVVGF
Ga0316630_1075039423300033487SoilVTEPTELEGEGAWTKVRHRKVVQWALAYAAGAWAL
Ga0316621_1010483523300033488SoilMTDTPTEREEEGGWAKLRRRKVVQWGLAYAAGAWALL
Ga0316621_1018243113300033488SoilMTDAPKAREGEGAFSKLRRRKVVQWSFAYAAAAWTLLQ
Ga0316621_1032109113300033488SoilMTDAPTERNHEGGWAKLRRRKVVQWGIAYAAGAWVLLQVI
Ga0316621_1041334623300033488SoilLIDTPTGLAGEGAWAKLRRRKVVQWGLAYVAAAWGLLQGLASL
Ga0316621_1046015723300033488SoilVSDTPTEREEDSPWAKLRRRKVVQWGVLYAAGAWGFL
Ga0316621_1050978813300033488SoilMTDTPTEREEGGGWAKLRRRKVVQWGLAYAACGWGFLQGLE
Ga0316621_1066150213300033488SoilLADTPTERETEGPWDKLRRRKVVQWGLAYAAGAWGLLQGLEY
Ga0316621_1081689723300033488SoilMTDTPTERAYEGAWARLRHHKVVQWTLAYGAAAYTLLH
Ga0316621_1122839123300033488SoilVTDMPAEREQEGAWAKLRRRKVVQWGIAYAAGAWG
Ga0316621_1142060123300033488SoilVTDAPTEREGEGAWTRLHRRKVVQWAIAYAAAAWTLLQVLEYFGE
Ga0316621_1145868113300033488SoilMTDTPTEREGEGGWANLRRRKVVQWGLAYAAGAWALLQAIGF
Ga0316616_10037432813300033521SoilVTDTPTAREDEGAWAKLRHRKVVQWGIAYAAGAWGLLQVLQFFAEAFE
Ga0316616_10041264813300033521SoilVTDTPTEGGGEGTWAKLRRRKVVQWGIAYAAGAWGLLQG
Ga0316616_10183754013300033521SoilVTDAPTKRDEDGAWATLRRRKVVQWGFAYAAGAWAL
Ga0316617_10038904823300033557SoilVAETPTGRETGSAWTTLHRRKVVQWGVAYAAGAWTLMQ
Ga0316617_10078789323300033557SoilMTDAPTERNHEGGWAKLRRRKVVQWGIAYAAGAWVLLQVIGF
Ga0316617_10229968513300033557SoilVTDAPTERGGEGAWTRLRRRKVVQWGIAYAAAAWTLLQVL
Ga0316617_10289244013300033557SoilMTDTPTEREEGGGWARLRRRKVVQWGLAYAAGAWGLL
Ga0373898_032660_652_7713300034076Sediment SlurryMSDPPVEREEEGAWARLRRRKVVQWGVAYAATAWGLLQGL


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.