Basic Information | |
---|---|
Family ID | F031141 |
Family Type | Metagenome |
Number of Sequences | 183 |
Average Sequence Length | 41 residues |
Representative Sequence | VTDAPTEREGEGAWTRLRRRKVVQWGIAYAAAAWTLLQ |
Number of Associated Samples | 91 |
Number of Associated Scaffolds | 183 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | No |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 94.38 % |
% of genes near scaffold ends (potentially truncated) | 95.63 % |
% of genes from short scaffolds (< 2000 bps) | 89.07 % |
Associated GOLD sequencing projects | 85 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.46 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (64.481 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil (34.973 % of family members) |
Environment Ontology (ENVO) | Unclassified (45.902 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Unclassified (47.541 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 48.48% β-sheet: 0.00% Coil/Unstructured: 51.52% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.46 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 183 Family Scaffolds |
---|---|---|
PF13432 | TPR_16 | 4.37 |
PF14559 | TPR_19 | 3.28 |
PF13193 | AMP-binding_C | 2.73 |
PF09361 | Phasin_2 | 2.19 |
PF00593 | TonB_dep_Rec | 1.64 |
PF14023 | DUF4239 | 1.09 |
PF12697 | Abhydrolase_6 | 1.09 |
PF13520 | AA_permease_2 | 1.09 |
PF13673 | Acetyltransf_10 | 1.09 |
PF02225 | PA | 1.09 |
PF01061 | ABC2_membrane | 1.09 |
PF13545 | HTH_Crp_2 | 1.09 |
PF13474 | SnoaL_3 | 1.09 |
PF11746 | DUF3303 | 1.09 |
PF02321 | OEP | 0.55 |
PF02219 | MTHFR | 0.55 |
PF13181 | TPR_8 | 0.55 |
PF14534 | DUF4440 | 0.55 |
PF13738 | Pyr_redox_3 | 0.55 |
PF00210 | Ferritin | 0.55 |
PF13450 | NAD_binding_8 | 0.55 |
PF13683 | rve_3 | 0.55 |
PF13531 | SBP_bac_11 | 0.55 |
PF07690 | MFS_1 | 0.55 |
PF01432 | Peptidase_M3 | 0.55 |
PF00361 | Proton_antipo_M | 0.55 |
PF04408 | HA2 | 0.55 |
PF00171 | Aldedh | 0.55 |
PF03009 | GDPD | 0.55 |
PF06155 | GBBH-like_N | 0.55 |
PF00596 | Aldolase_II | 0.55 |
PF12769 | PNTB_4TM | 0.55 |
PF13091 | PLDc_2 | 0.55 |
PF00149 | Metallophos | 0.55 |
PF01596 | Methyltransf_3 | 0.55 |
PF00732 | GMC_oxred_N | 0.55 |
PF08332 | CaMKII_AD | 0.55 |
PF01746 | tRNA_m1G_MT | 0.55 |
PF13586 | DDE_Tnp_1_2 | 0.55 |
PF13416 | SBP_bac_8 | 0.55 |
PF00561 | Abhydrolase_1 | 0.55 |
PF03886 | ABC_trans_aux | 0.55 |
PF07715 | Plug | 0.55 |
PF09137 | Glucodextran_N | 0.55 |
PF00144 | Beta-lactamase | 0.55 |
PF13414 | TPR_11 | 0.55 |
PF13192 | Thioredoxin_3 | 0.55 |
COG ID | Name | Functional Category | % Frequency in 183 Family Scaffolds |
---|---|---|---|
COG1538 | Outer membrane protein TolC | Cell wall/membrane/envelope biogenesis [M] | 1.09 |
COG1686 | D-alanyl-D-alanine carboxypeptidase | Cell wall/membrane/envelope biogenesis [M] | 0.55 |
COG4875 | Protein kinase association domain CaMKII_AD, NTF2-like superfamily | Posttranslational modification, protein turnover, chaperones [O] | 0.55 |
COG4230 | Delta 1-pyrroline-5-carboxylate dehydrogenase | Amino acid transport and metabolism [E] | 0.55 |
COG4123 | tRNA1(Val) A37 N6-methylase TrmN6 | Translation, ribosomal structure and biogenesis [J] | 0.55 |
COG4122 | tRNA 5-hydroxyU34 O-methylase TrmR/YrrM | Translation, ribosomal structure and biogenesis [J] | 0.55 |
COG3536 | Uncharacterized conserved protein, DUF971 family | Function unknown [S] | 0.55 |
COG3387 | Glucoamylase (glucan-1,4-alpha-glucosidase), GH15 family | Carbohydrate transport and metabolism [G] | 0.55 |
COG2518 | Protein-L-isoaspartate O-methyltransferase | Posttranslational modification, protein turnover, chaperones [O] | 0.55 |
COG2367 | Beta-lactamase class A | Defense mechanisms [V] | 0.55 |
COG2303 | Choline dehydrogenase or related flavoprotein | Lipid transport and metabolism [I] | 0.55 |
COG0014 | Gamma-glutamyl phosphate reductase | Amino acid transport and metabolism [E] | 0.55 |
COG1680 | CubicO group peptidase, beta-lactamase class C family | Defense mechanisms [V] | 0.55 |
COG1643 | HrpA-like RNA helicase | Translation, ribosomal structure and biogenesis [J] | 0.55 |
COG1164 | Oligoendopeptidase F | Amino acid transport and metabolism [E] | 0.55 |
COG1012 | Acyl-CoA reductase or other NAD-dependent aldehyde dehydrogenase | Lipid transport and metabolism [I] | 0.55 |
COG0685 | 5,10-methylenetetrahydrofolate reductase | Amino acid transport and metabolism [E] | 0.55 |
COG0584 | Glycerophosphoryl diester phosphodiesterase | Lipid transport and metabolism [I] | 0.55 |
COG0339 | Zn-dependent oligopeptidase, M3 family | Posttranslational modification, protein turnover, chaperones [O] | 0.55 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 64.48 % |
Unclassified | root | N/A | 35.52 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300000124|BS_KBA_SWE12_21mDRAFT_c10064332 | All Organisms → cellular organisms → Bacteria | 951 | Open in IMG/M |
3300000881|JGI10215J12807_1180358 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 2876 | Open in IMG/M |
3300000891|JGI10214J12806_12152521 | Not Available | 1016 | Open in IMG/M |
3300001213|JGIcombinedJ13530_100858289 | All Organisms → cellular organisms → Bacteria | 504 | Open in IMG/M |
3300004050|Ga0055491_10049675 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 936 | Open in IMG/M |
3300004463|Ga0063356_101517906 | All Organisms → cellular organisms → Bacteria | 993 | Open in IMG/M |
3300004480|Ga0062592_100464035 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1033 | Open in IMG/M |
3300004481|Ga0069718_15672070 | All Organisms → cellular organisms → Bacteria | 1277 | Open in IMG/M |
3300005487|Ga0074211_152176 | Not Available | 886 | Open in IMG/M |
3300005718|Ga0068866_10337189 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 954 | Open in IMG/M |
3300005829|Ga0074479_10281373 | All Organisms → cellular organisms → Bacteria | 539 | Open in IMG/M |
3300005844|Ga0068862_100617618 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1042 | Open in IMG/M |
3300006224|Ga0079037_100073473 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales | 2776 | Open in IMG/M |
3300006224|Ga0079037_100166772 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → unclassified Anaerolineae → Anaerolineae bacterium | 1945 | Open in IMG/M |
3300006224|Ga0079037_100171145 | All Organisms → cellular organisms → Bacteria | 1923 | Open in IMG/M |
3300006224|Ga0079037_100361387 | All Organisms → cellular organisms → Bacteria | 1365 | Open in IMG/M |
3300006224|Ga0079037_100784638 | All Organisms → cellular organisms → Bacteria | 935 | Open in IMG/M |
3300006224|Ga0079037_100795307 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 928 | Open in IMG/M |
3300006224|Ga0079037_101029397 | All Organisms → cellular organisms → Bacteria | 815 | Open in IMG/M |
3300006224|Ga0079037_101258008 | Not Available | 736 | Open in IMG/M |
3300006224|Ga0079037_101983498 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 582 | Open in IMG/M |
3300006224|Ga0079037_102051280 | All Organisms → cellular organisms → Bacteria | 571 | Open in IMG/M |
3300006224|Ga0079037_102057632 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 570 | Open in IMG/M |
3300006224|Ga0079037_102157504 | Not Available | 556 | Open in IMG/M |
3300006224|Ga0079037_102158219 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 556 | Open in IMG/M |
3300006844|Ga0075428_100844552 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 972 | Open in IMG/M |
3300006844|Ga0075428_101835979 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 630 | Open in IMG/M |
3300006847|Ga0075431_101572075 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Vicinamibacteria → Vicinamibacterales → Vicinamibacteraceae → Luteitalea → unclassified Luteitalea → Luteitalea sp. TBR-22 | 616 | Open in IMG/M |
3300006853|Ga0075420_101182978 | All Organisms → cellular organisms → Bacteria | 657 | Open in IMG/M |
3300007004|Ga0079218_11022297 | All Organisms → cellular organisms → Bacteria | 831 | Open in IMG/M |
3300009075|Ga0105090_10314551 | All Organisms → cellular organisms → Bacteria | 959 | Open in IMG/M |
3300009075|Ga0105090_10610963 | All Organisms → cellular organisms → Bacteria | 662 | Open in IMG/M |
3300009075|Ga0105090_10694404 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 618 | Open in IMG/M |
3300009075|Ga0105090_10841024 | Not Available | 558 | Open in IMG/M |
3300009081|Ga0105098_10029959 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Reichenbachiellaceae → Ekhidna → Ekhidna lutea | 2131 | Open in IMG/M |
3300009085|Ga0105103_10329251 | All Organisms → cellular organisms → Bacteria | 836 | Open in IMG/M |
3300009091|Ga0102851_10381551 | Not Available | 1411 | Open in IMG/M |
3300009091|Ga0102851_12142982 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Aminicenantes → unclassified Aminicenantes → Candidatus Aminicenantes bacterium | 635 | Open in IMG/M |
3300009091|Ga0102851_12863802 | Not Available | 554 | Open in IMG/M |
3300009091|Ga0102851_13066484 | All Organisms → cellular organisms → Bacteria | 536 | Open in IMG/M |
3300009111|Ga0115026_11245467 | All Organisms → cellular organisms → Bacteria | 608 | Open in IMG/M |
3300009131|Ga0115027_10014419 | All Organisms → cellular organisms → Bacteria | 3198 | Open in IMG/M |
3300009131|Ga0115027_11155802 | All Organisms → cellular organisms → Bacteria | 616 | Open in IMG/M |
3300009165|Ga0105102_10065216 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1637 | Open in IMG/M |
3300009167|Ga0113563_11548856 | All Organisms → cellular organisms → Bacteria | 782 | Open in IMG/M |
3300009167|Ga0113563_11936423 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium RIFCSPHIGHO2_12_FULL_63_22 | 703 | Open in IMG/M |
3300009167|Ga0113563_12296171 | All Organisms → cellular organisms → Bacteria | 649 | Open in IMG/M |
3300009167|Ga0113563_12533850 | Not Available | 619 | Open in IMG/M |
3300009167|Ga0113563_13222452 | All Organisms → cellular organisms → Bacteria | 552 | Open in IMG/M |
3300009167|Ga0113563_13269537 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 549 | Open in IMG/M |
3300009179|Ga0115028_10156447 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Thiotrichales → unclassified Thiotrichales → Thiotrichales bacterium SG8_50 | 1388 | Open in IMG/M |
3300009179|Ga0115028_11418806 | Not Available | 585 | Open in IMG/M |
3300010412|Ga0136852_11377027 | Not Available | 669 | Open in IMG/M |
3300010412|Ga0136852_11927116 | Not Available | 557 | Open in IMG/M |
3300012898|Ga0157293_10178027 | Not Available | 624 | Open in IMG/M |
3300012907|Ga0157283_10346769 | Not Available | 533 | Open in IMG/M |
3300012912|Ga0157306_10154266 | Not Available | 729 | Open in IMG/M |
3300014312|Ga0075345_1108750 | Not Available | 633 | Open in IMG/M |
3300014313|Ga0075347_1091091 | Not Available | 678 | Open in IMG/M |
3300014316|Ga0075339_1031812 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Cellvibrionales → Microbulbiferaceae → Microbulbifer | 1289 | Open in IMG/M |
3300014319|Ga0075348_1229531 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 524 | Open in IMG/M |
3300014326|Ga0157380_10461304 | All Organisms → cellular organisms → Bacteria | 1223 | Open in IMG/M |
3300014326|Ga0157380_11333192 | Not Available | 766 | Open in IMG/M |
3300015371|Ga0132258_13667988 | All Organisms → cellular organisms → Bacteria | 1048 | Open in IMG/M |
3300018469|Ga0190270_12834328 | Not Available | 547 | Open in IMG/M |
3300018469|Ga0190270_13200373 | Not Available | 518 | Open in IMG/M |
3300019356|Ga0173481_10509598 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → unclassified Terrabacteria group → Terrabacteria group bacterium ANGP1 | 615 | Open in IMG/M |
3300022214|Ga0224505_10144690 | Not Available | 919 | Open in IMG/M |
3300023266|Ga0247789_1066436 | Not Available | 684 | Open in IMG/M |
3300024056|Ga0124853_1394490 | Not Available | 1467 | Open in IMG/M |
3300025907|Ga0207645_10615828 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 737 | Open in IMG/M |
3300025919|Ga0207657_11054831 | Not Available | 622 | Open in IMG/M |
3300025923|Ga0207681_10144135 | All Organisms → cellular organisms → Bacteria | 1777 | Open in IMG/M |
3300025925|Ga0207650_11259038 | All Organisms → cellular organisms → Bacteria | 630 | Open in IMG/M |
3300025940|Ga0207691_10753160 | All Organisms → cellular organisms → Bacteria | 820 | Open in IMG/M |
3300025956|Ga0210104_1004012 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1787 | Open in IMG/M |
3300026089|Ga0207648_10239672 | All Organisms → cellular organisms → Bacteria | 1615 | Open in IMG/M |
3300026116|Ga0207674_11470770 | All Organisms → cellular organisms → Bacteria | 650 | Open in IMG/M |
3300026118|Ga0207675_101472766 | All Organisms → cellular organisms → Bacteria | 701 | Open in IMG/M |
3300026118|Ga0207675_101913758 | Not Available | 611 | Open in IMG/M |
3300027617|Ga0210002_1014655 | All Organisms → cellular organisms → Bacteria | 1231 | Open in IMG/M |
3300027693|Ga0209704_1173560 | Not Available | 627 | Open in IMG/M |
3300027818|Ga0209706_10051926 | All Organisms → cellular organisms → Bacteria | 2066 | Open in IMG/M |
3300027841|Ga0209262_10554720 | Not Available | 558 | Open in IMG/M |
3300027871|Ga0209397_10080698 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Cellvibrionales → Halieaceae → Kineobactrum → Kineobactrum salinum | 1313 | Open in IMG/M |
3300027877|Ga0209293_10170896 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Woeseiaceae → unclassified Woeseiaceae → Woeseiaceae bacterium | 1048 | Open in IMG/M |
3300027890|Ga0209496_10778633 | Not Available | 527 | Open in IMG/M |
3300027897|Ga0209254_10368238 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 1075 | Open in IMG/M |
3300027897|Ga0209254_10601229 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → unclassified Burkholderiales → Burkholderiales bacterium | 775 | Open in IMG/M |
3300027897|Ga0209254_11054211 | All Organisms → cellular organisms → Bacteria | 524 | Open in IMG/M |
3300027909|Ga0209382_10814291 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 993 | Open in IMG/M |
3300027979|Ga0209705_10326035 | Not Available | 777 | Open in IMG/M |
3300031547|Ga0310887_10695636 | Not Available | 631 | Open in IMG/M |
3300031858|Ga0310892_10003399 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 5769 | Open in IMG/M |
3300031908|Ga0310900_10723796 | All Organisms → cellular organisms → Bacteria | 799 | Open in IMG/M |
3300031997|Ga0315278_10008381 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 9488 | Open in IMG/M |
3300031997|Ga0315278_10868438 | Not Available | 907 | Open in IMG/M |
3300031997|Ga0315278_11773566 | Not Available | 584 | Open in IMG/M |
3300032013|Ga0310906_11007739 | All Organisms → cellular organisms → Bacteria | 599 | Open in IMG/M |
3300032053|Ga0315284_11715997 | Not Available | 653 | Open in IMG/M |
3300032075|Ga0310890_11514016 | Not Available | 553 | Open in IMG/M |
3300032143|Ga0315292_10165571 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1789 | Open in IMG/M |
3300032143|Ga0315292_10332431 | Not Available | 1269 | Open in IMG/M |
3300032143|Ga0315292_11164999 | Not Available | 635 | Open in IMG/M |
3300032143|Ga0315292_11168842 | All Organisms → cellular organisms → Bacteria | 634 | Open in IMG/M |
3300032164|Ga0315283_10048322 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4278 | Open in IMG/M |
3300032164|Ga0315283_10132783 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2643 | Open in IMG/M |
3300032164|Ga0315283_11052652 | All Organisms → cellular organisms → Bacteria | 858 | Open in IMG/M |
3300032179|Ga0310889_10282388 | Not Available | 796 | Open in IMG/M |
3300032179|Ga0310889_10684291 | All Organisms → cellular organisms → Bacteria | 534 | Open in IMG/M |
3300032397|Ga0315287_10986907 | Not Available | 981 | Open in IMG/M |
3300032401|Ga0315275_11684763 | Not Available | 676 | Open in IMG/M |
3300032516|Ga0315273_10154051 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 3152 | Open in IMG/M |
3300033406|Ga0316604_10442892 | All Organisms → cellular organisms → Bacteria | 713 | Open in IMG/M |
3300033406|Ga0316604_10569372 | Not Available | 623 | Open in IMG/M |
3300033408|Ga0316605_11394777 | All Organisms → cellular organisms → Bacteria | 679 | Open in IMG/M |
3300033408|Ga0316605_12441375 | Not Available | 508 | Open in IMG/M |
3300033413|Ga0316603_11045679 | All Organisms → cellular organisms → Bacteria | 772 | Open in IMG/M |
3300033413|Ga0316603_11868608 | All Organisms → cellular organisms → Bacteria | 568 | Open in IMG/M |
3300033413|Ga0316603_12067302 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Variovorax → unclassified Variovorax → Variovorax sp. | 538 | Open in IMG/M |
3300033413|Ga0316603_12187217 | All Organisms → cellular organisms → Bacteria | 522 | Open in IMG/M |
3300033414|Ga0316619_10224824 | All Organisms → cellular organisms → Bacteria | 1373 | Open in IMG/M |
3300033414|Ga0316619_11353925 | Not Available | 634 | Open in IMG/M |
3300033416|Ga0316622_100290709 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → unclassified Anaerolineae → Anaerolineae bacterium | 1792 | Open in IMG/M |
3300033416|Ga0316622_100999903 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Oceanospirillales → Alcanivoracaceae → Alcanivorax → unclassified Alcanivorax → Alcanivorax sp. 1008 | 976 | Open in IMG/M |
3300033416|Ga0316622_101368029 | Not Available | 827 | Open in IMG/M |
3300033416|Ga0316622_102191834 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 640 | Open in IMG/M |
3300033416|Ga0316622_102461073 | All Organisms → cellular organisms → Bacteria | 600 | Open in IMG/M |
3300033416|Ga0316622_102636388 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium | 578 | Open in IMG/M |
3300033416|Ga0316622_102821350 | Not Available | 556 | Open in IMG/M |
3300033416|Ga0316622_102839856 | Not Available | 554 | Open in IMG/M |
3300033416|Ga0316622_103401159 | All Organisms → cellular organisms → Bacteria | 501 | Open in IMG/M |
3300033418|Ga0316625_101013837 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Ectothiorhodospiraceae → Thioalkalivibrio → unclassified Thioalkalivibrio → Thioalkalivibrio sp. XN8 | 740 | Open in IMG/M |
3300033418|Ga0316625_101288565 | Not Available | 676 | Open in IMG/M |
3300033418|Ga0316625_101375760 | All Organisms → cellular organisms → Bacteria | 659 | Open in IMG/M |
3300033418|Ga0316625_101514590 | Not Available | 635 | Open in IMG/M |
3300033418|Ga0316625_102107244 | Not Available | 558 | Open in IMG/M |
3300033419|Ga0316601_100137568 | Not Available | 2052 | Open in IMG/M |
3300033419|Ga0316601_100258702 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium | 1569 | Open in IMG/M |
3300033419|Ga0316601_100669875 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium | 1015 | Open in IMG/M |
3300033419|Ga0316601_100972425 | Not Available | 846 | Open in IMG/M |
3300033419|Ga0316601_101992581 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium | 585 | Open in IMG/M |
3300033419|Ga0316601_102051062 | Not Available | 576 | Open in IMG/M |
3300033419|Ga0316601_102203836 | All Organisms → cellular organisms → Bacteria | 555 | Open in IMG/M |
3300033434|Ga0316613_10051122 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii | 2389 | Open in IMG/M |
3300033434|Ga0316613_10169850 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 1389 | Open in IMG/M |
3300033434|Ga0316613_10658226 | All Organisms → cellular organisms → Bacteria | 716 | Open in IMG/M |
3300033434|Ga0316613_10753165 | All Organisms → cellular organisms → Bacteria | 668 | Open in IMG/M |
3300033434|Ga0316613_11263327 | Not Available | 509 | Open in IMG/M |
3300033481|Ga0316600_10021767 | Not Available | 3287 | Open in IMG/M |
3300033481|Ga0316600_10044300 | All Organisms → cellular organisms → Bacteria | 2463 | Open in IMG/M |
3300033481|Ga0316600_10161907 | All Organisms → cellular organisms → Bacteria | 1432 | Open in IMG/M |
3300033481|Ga0316600_10190189 | All Organisms → cellular organisms → Bacteria | 1333 | Open in IMG/M |
3300033482|Ga0316627_101448968 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → unclassified Chromatiales → Chromatiales bacterium | 692 | Open in IMG/M |
3300033482|Ga0316627_102074154 | Not Available | 592 | Open in IMG/M |
3300033483|Ga0316629_10284432 | All Organisms → cellular organisms → Bacteria | 1107 | Open in IMG/M |
3300033487|Ga0316630_10054092 | All Organisms → cellular organisms → Bacteria | 2469 | Open in IMG/M |
3300033487|Ga0316630_10364123 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 1140 | Open in IMG/M |
3300033487|Ga0316630_10750394 | Not Available | 832 | Open in IMG/M |
3300033488|Ga0316621_10104835 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae | 1597 | Open in IMG/M |
3300033488|Ga0316621_10182431 | All Organisms → cellular organisms → Bacteria | 1291 | Open in IMG/M |
3300033488|Ga0316621_10321091 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Caulobacterales → Caulobacteraceae → Brevundimonas → Brevundimonas variabilis | 1026 | Open in IMG/M |
3300033488|Ga0316621_10413346 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Woeseiaceae → unclassified Woeseiaceae → Woeseiaceae bacterium | 922 | Open in IMG/M |
3300033488|Ga0316621_10460157 | Not Available | 881 | Open in IMG/M |
3300033488|Ga0316621_10509788 | All Organisms → cellular organisms → Bacteria | 842 | Open in IMG/M |
3300033488|Ga0316621_10661502 | Not Available | 750 | Open in IMG/M |
3300033488|Ga0316621_10816897 | All Organisms → cellular organisms → Bacteria | 683 | Open in IMG/M |
3300033488|Ga0316621_11228391 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → unclassified Chromatiales → Chromatiales bacterium | 567 | Open in IMG/M |
3300033488|Ga0316621_11420601 | Not Available | 530 | Open in IMG/M |
3300033488|Ga0316621_11458681 | Not Available | 524 | Open in IMG/M |
3300033521|Ga0316616_100374328 | All Organisms → cellular organisms → Bacteria | 1562 | Open in IMG/M |
3300033521|Ga0316616_100412648 | All Organisms → cellular organisms → Bacteria | 1503 | Open in IMG/M |
3300033521|Ga0316616_101837540 | All Organisms → cellular organisms → Bacteria | 797 | Open in IMG/M |
3300033557|Ga0316617_100389048 | All Organisms → cellular organisms → Bacteria | 1225 | Open in IMG/M |
3300033557|Ga0316617_100787893 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Caulobacterales → Caulobacteraceae → Brevundimonas → Brevundimonas variabilis | 908 | Open in IMG/M |
3300033557|Ga0316617_102299685 | Not Available | 557 | Open in IMG/M |
3300033557|Ga0316617_102892440 | Not Available | 500 | Open in IMG/M |
3300034076|Ga0373898_032660 | All Organisms → cellular organisms → Bacteria | 771 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 34.97% |
Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 13.66% |
Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 7.65% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 6.01% |
Wetland | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Wetland | 4.37% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 3.83% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.28% |
Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 2.73% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 2.73% |
Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment | 1.64% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.64% |
Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 1.64% |
Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 1.09% |
Mangrove Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Mangrove Sediment | 1.09% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.09% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 1.09% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 1.09% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.09% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 1.09% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 1.09% |
Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Sediment | 0.55% |
Sediment | Environmental → Aquatic → Freshwater → Lentic → Sediment → Sediment | 0.55% |
Freshwater | Environmental → Aquatic → Freshwater → Pond → Sediment → Freshwater | 0.55% |
Wetland | Environmental → Aquatic → Marine → Wetlands → Sediment → Wetland | 0.55% |
Marine | Environmental → Aquatic → Marine → Wetlands → Sediment → Marine | 0.55% |
Sediment | Environmental → Aquatic → Marine → Sediment → Unclassified → Sediment | 0.55% |
Sediment (Intertidal) | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal) | 0.55% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.55% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.55% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.55% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.55% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.55% |
Sediment Slurry | Engineered → Bioremediation → Metal → Unclassified → Unclassified → Sediment Slurry | 0.55% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300000124 | Marine microbial communities from chronically polluted sediments in the Baltic Sea - site KBA sample SWE 12_21m | Environmental | Open in IMG/M |
3300000881 | Soil microbial communities from Great Prairies - Wisconsin Restored Prairie soil | Environmental | Open in IMG/M |
3300000891 | Soil microbial communities from Great Prairies - Wisconsin, Continuous corn soil | Environmental | Open in IMG/M |
3300001213 | Combined assembly of wetland microbial communities from Twitchell Island in the Sacramento Delta (Jan 2013 JGI Velvet Assembly) | Environmental | Open in IMG/M |
3300004050 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushSE_CattailNLA_D2 | Environmental | Open in IMG/M |
3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
3300004480 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4 | Environmental | Open in IMG/M |
3300004481 | Combined Assembly of Gp0112041, Gp0112042, Gp0112043 | Environmental | Open in IMG/M |
3300004643 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3 | Environmental | Open in IMG/M |
3300005487 | Sediment microbial communities from Lake Washington, Seattle, Washington, USA - Methanol enrichment | Environmental | Open in IMG/M |
3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Host-Associated | Open in IMG/M |
3300005829 | Microbial communities from Cathlamet Bay sediment, Columbia River estuary, Oregon - S.190_CBC | Environmental | Open in IMG/M |
3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Host-Associated | Open in IMG/M |
3300006224 | Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 4 metaG | Environmental | Open in IMG/M |
3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
3300006847 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Host-Associated | Open in IMG/M |
3300006853 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD4 | Host-Associated | Open in IMG/M |
3300007004 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost | Environmental | Open in IMG/M |
3300009075 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 1-3cm March2015 | Environmental | Open in IMG/M |
3300009081 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm May2015 | Environmental | Open in IMG/M |
3300009085 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 10-12cm September2015 | Environmental | Open in IMG/M |
3300009091 | Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 3 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
3300009111 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Mud_0915_D1 | Environmental | Open in IMG/M |
3300009131 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Open_0915_D1 | Environmental | Open in IMG/M |
3300009165 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 1-3cm September2015 | Environmental | Open in IMG/M |
3300009167 | Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 3 metaG - Illumina Assembly (version 2) | Environmental | Open in IMG/M |
3300009179 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Plant_0915_D1 | Environmental | Open in IMG/M |
3300010412 | Mangrove sediment microbial communities from Mai Po Nature Reserve Marshes in Hong Kong, China - Maipo_10 | Environmental | Open in IMG/M |
3300012898 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S194-509B-1 | Environmental | Open in IMG/M |
3300012907 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S044-104R-1 | Environmental | Open in IMG/M |
3300012912 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S163-409C-2 | Environmental | Open in IMG/M |
3300014312 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushSE_CattailNLA_D1 | Environmental | Open in IMG/M |
3300014313 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushSE_CattailNLC_D1 | Environmental | Open in IMG/M |
3300014316 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushMan_CattailNLC_D1 | Environmental | Open in IMG/M |
3300014319 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushSE_TuleA_D1 | Environmental | Open in IMG/M |
3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Host-Associated | Open in IMG/M |
3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
3300018469 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T | Environmental | Open in IMG/M |
3300019356 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S073-202C-2 (version 2) | Environmental | Open in IMG/M |
3300022214 | Sediment microbial communities from San Francisco Bay, California, United States - SF_Jan12_sed_USGS_4_1 | Environmental | Open in IMG/M |
3300023266 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S220-509R-4 | Environmental | Open in IMG/M |
3300024056 | Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 3 metaG (PacBio error correction) | Environmental | Open in IMG/M |
3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025956 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushSE_TuleA_D2 (SPAdes) | Environmental | Open in IMG/M |
3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300027617 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) | Host-Associated | Open in IMG/M |
3300027693 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 1-3cm September2015 (SPAdes) | Environmental | Open in IMG/M |
3300027726 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (3) Depth 1-3cm March2015 (SPAdes) | Environmental | Open in IMG/M |
3300027818 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 19-21cm September2015 (SPAdes) | Environmental | Open in IMG/M |
3300027841 | Freshwater pond sediment microbial communities from the University of Edinburgh, under environmental carbon perturbations - Low cellulose week 11 (SPAdes) | Environmental | Open in IMG/M |
3300027871 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Open_0915_D1 (SPAdes) | Environmental | Open in IMG/M |
3300027877 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Mud_0915_D1 (SPAdes) | Environmental | Open in IMG/M |
3300027890 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Plant_0915_D1 (SPAdes) | Environmental | Open in IMG/M |
3300027897 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - DIP11 DI (SPAdes) | Environmental | Open in IMG/M |
3300027909 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes) | Host-Associated | Open in IMG/M |
3300027979 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 10-12cm September2015 (SPAdes) | Environmental | Open in IMG/M |
3300031547 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D4 | Environmental | Open in IMG/M |
3300031858 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D2 | Environmental | Open in IMG/M |
3300031908 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D1 | Environmental | Open in IMG/M |
3300031997 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G06_0 | Environmental | Open in IMG/M |
3300032013 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D3 | Environmental | Open in IMG/M |
3300032053 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_16 | Environmental | Open in IMG/M |
3300032075 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D3 | Environmental | Open in IMG/M |
3300032143 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_0 | Environmental | Open in IMG/M |
3300032164 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_0 | Environmental | Open in IMG/M |
3300032179 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D2 | Environmental | Open in IMG/M |
3300032397 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_0 | Environmental | Open in IMG/M |
3300032401 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G03_0 | Environmental | Open in IMG/M |
3300032516 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_0 | Environmental | Open in IMG/M |
3300033406 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day20_CT | Environmental | Open in IMG/M |
3300033408 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day20_noCT | Environmental | Open in IMG/M |
3300033413 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day10_noCT | Environmental | Open in IMG/M |
3300033414 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D4_B | Environmental | Open in IMG/M |
3300033416 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_OW2_C1_D5_C | Environmental | Open in IMG/M |
3300033418 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_T1_C1_D1_A | Environmental | Open in IMG/M |
3300033419 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day5_noCT | Environmental | Open in IMG/M |
3300033434 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day10_CT_b | Environmental | Open in IMG/M |
3300033481 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day5_CT | Environmental | Open in IMG/M |
3300033482 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M2_C1_D1_C | Environmental | Open in IMG/M |
3300033483 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_May_M1_C1_D1_A | Environmental | Open in IMG/M |
3300033487 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_May_M1_C1_D6_A | Environmental | Open in IMG/M |
3300033488 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_OW2_C1_D1_C | Environmental | Open in IMG/M |
3300033521 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D1_B | Environmental | Open in IMG/M |
3300033557 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D2_B | Environmental | Open in IMG/M |
3300034076 | Uranium-contaminated sediment microbial communities from bioreactor in Oak Ridge, Tennessee, United States - A5A4.2 | Engineered | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
BS_KBA_SWE12_21mDRAFT_100643321 | 3300000124 | Marine | LADAPTERDDEAAWARLSRRKVVQWGLAYAAGAWALLEVIGFAA |
JGI10215J12807_11803581 | 3300000881 | Soil | VTDTPEERGAESTWTRLRRRKVVQWGVAYAAGAWLLMQVLEYFSGTFDW |
JGI10214J12806_121525211 | 3300000891 | Soil | VTDTPEERGAESTWTRLRRRKVVQWGVAYAAGAWLLMQVLEYF |
JGIcombinedJ13530_1008582891 | 3300001213 | Wetland | VTDTPTEREGEDAWMKLRRRKVVQWGIAYSAAAWTLLQVMEYLTETYGWP |
Ga0055491_100496752 | 3300004050 | Natural And Restored Wetlands | VTDTPTEREGAWAKLRRRKVVQWCLTYGLGAWGFLQGLEYVS |
Ga0063356_1002305211 | 3300004463 | Arabidopsis Thaliana Rhizosphere | MNDATPPTDEGVWVRLRRRKVVQWGIAYAAGAWVLLQVLGFATDTY |
Ga0063356_1015179061 | 3300004463 | Arabidopsis Thaliana Rhizosphere | VTDTPAEREAESTWTSLRRRKVVQWGLAYAAGAWVLLQVLGFATDTY |
Ga0062592_1004640353 | 3300004480 | Soil | VTDTPEERGAESTWTRLRRRKVVQWGVAYAAGAWLLMQVLEYFSGTF |
Ga0069718_156720701 | 3300004481 | Sediment | VTDTPTEREGEGAWTKLRRRKVVQWGFAYAAAAWTLLQVIEYLGETYGWP |
Ga0062591_1026828381 | 3300004643 | Soil | VTSAGVAGVAGIWQKLRRRKVVQWGIAYVAAAWALLQGIDF |
Ga0074211_1521761 | 3300005487 | Sediment | MPTADEGGTWANLLRRKVVQWGLAYAAGAWASLQVFGFAADSFGWPT |
Ga0068866_103371892 | 3300005718 | Miscanthus Rhizosphere | VNDAPAERGGDSAWARLRRRKVMQWGIAYAAAAWVLLQVL |
Ga0074479_102813731 | 3300005829 | Sediment (Intertidal) | VTDAPTEREGEGAFSKLRRRKVVQWGIVYVAGAWGLLQGIGFSADA |
Ga0068862_1006176181 | 3300005844 | Switchgrass Rhizosphere | VNDTPAERAAESTWTRVRRRKVVQWGVAYAAGAWLLMQVLEYFSGTFDWPRQ |
Ga0079037_1000734733 | 3300006224 | Freshwater Wetlands | VTDAPTEREDEGAWAKLRRRKVVQWGIAYAGGSWVVLQVIGFFADAFH |
Ga0079037_1001258774 | 3300006224 | Freshwater Wetlands | VSEHHQVTDTPERGEVASTWDKLRRRKVVQWGIVYAAGAW |
Ga0079037_1001667721 | 3300006224 | Freshwater Wetlands | VTDAPTEREGEGAWTRLRRRKVVQWGIAYAAAAWTLLQ |
Ga0079037_1001711451 | 3300006224 | Freshwater Wetlands | MTDTPTERAYEGAWARLRHHKVVQWTLAYGAAAYTLL |
Ga0079037_1003613872 | 3300006224 | Freshwater Wetlands | VTGTPTEREEEGGWAKLRRHKVVQWSLAYAAGAWLLLQVLAYVSG |
Ga0079037_1007846383 | 3300006224 | Freshwater Wetlands | LADSPTERETEGPWDKLRRRKVVQWGLAYAAGAWGLLQGLEYVSE |
Ga0079037_1007953072 | 3300006224 | Freshwater Wetlands | VTDAPTEREGEGAWTRLHRRKVVQWGVAYAAAAWTLLQVIEYLGETY |
Ga0079037_1010293971 | 3300006224 | Freshwater Wetlands | LIDTPTGLAGEGAWAKLRRRKVVQWGVAYVAAAWG |
Ga0079037_1012580081 | 3300006224 | Freshwater Wetlands | MTEPTEQGGENLWTRLRRRKVVQWALAYAAGAWTLL |
Ga0079037_1019834981 | 3300006224 | Freshwater Wetlands | VTESTEPAGENLWTRLRRRKVVQWGIAYAAAAWTLLQVLEYFGE |
Ga0079037_1020512802 | 3300006224 | Freshwater Wetlands | MTEPTEQGGENLWTRLRRRKVVQWALAYAAGAWTLLQGLEYIT |
Ga0079037_1020576321 | 3300006224 | Freshwater Wetlands | LADTPTERETEGPWDKLRRRKVVQWGLAYAAGAWGLLQGLEYV |
Ga0079037_1021575041 | 3300006224 | Freshwater Wetlands | MTDTPIEREEEGGWAKLRRRKVVQWSLAYAAGAWL |
Ga0079037_1021582191 | 3300006224 | Freshwater Wetlands | MTDAPPELEGDGPWAKLRRRKVVQWGVLYAAGAWGFLQGLEYATD |
Ga0075428_1008445521 | 3300006844 | Populus Rhizosphere | VTDTPTRGGGEGPWAKLRRRKVVEWGIAYAAGAWGL |
Ga0075428_1018359792 | 3300006844 | Populus Rhizosphere | VTDTPTRGGGEGPWAKLRRRKVVEWGIAYAAGAWG |
Ga0075431_1015720752 | 3300006847 | Populus Rhizosphere | VTDTPTERETEDVWTRLRPRNVVQWGIAYVAGGWAILQMNLPT* |
Ga0075420_1011829782 | 3300006853 | Populus Rhizosphere | LSAAPAEREAESAWARLRRRKVVQWGLIYVAGAWGFLQG |
Ga0079218_110222973 | 3300007004 | Agricultural Soil | VTDTPTEREAESTWTRLRRRKVVQWTVAYAAGGWVLLQVLDFAADAFAW |
Ga0105090_103145512 | 3300009075 | Freshwater Sediment | MTDAPPEREGEGPWAKLRRRKVVQWGVLYAAGAWGFLQGL |
Ga0105090_106109631 | 3300009075 | Freshwater Sediment | LIDTPTGLAGAGAWAKLRRRKVVQWGIAYVAAAWGLLQGL |
Ga0105090_106944041 | 3300009075 | Freshwater Sediment | MTDAQTEPAVEGAWDKLRRRKVVQWGIVYAAGAWGLLQGL |
Ga0105090_108410242 | 3300009075 | Freshwater Sediment | VSKTPAEDEGAWAKLRRRKVVQWGLAYAATAWTLL |
Ga0105098_100299591 | 3300009081 | Freshwater Sediment | LAAGGNEVTDAPAEREGDSAWAKLRRRKVVQWGIAYVAAAW |
Ga0105103_103292511 | 3300009085 | Freshwater Sediment | MTDAPPEREGEGPWAKLRRRKVVQWGVLYAAGAWGFLQ |
Ga0102851_103815511 | 3300009091 | Freshwater Wetlands | VTEPTEQGGENLWTRLRRRKVVQWGIAYAAAAWTLLQ |
Ga0102851_121429821 | 3300009091 | Freshwater Wetlands | VTDVPEEREGEGAWANLRRRKVVQWGIAYLAGAWALLQSI |
Ga0102851_128638021 | 3300009091 | Freshwater Wetlands | VTDAPTEREGEGAWTRLRRRKVVQWGIAYAAAAWT |
Ga0102851_130664841 | 3300009091 | Freshwater Wetlands | VTDVPTEREGGGAWTKLRRRKVVQWSLAYAAAAWTLLQVIEYLGE |
Ga0115026_112454671 | 3300009111 | Wetland | MPTERAGENPWGRLRRRKVGQWGIVYAAGAWGFLQG |
Ga0115027_100144195 | 3300009131 | Wetland | MDVTDATTERAGEDLWAKLRRRKVVQWGLTYLAGAWGLLQGI |
Ga0115027_111558021 | 3300009131 | Wetland | VTDAPTEREGEGAWTRLRRRKVVQWGIAYAAAAWTLLQVLEYFGETYV |
Ga0105102_100652163 | 3300009165 | Freshwater Sediment | MTESPSGREGQGLWDKLRRRKVVQWGIIYAAGAWGFLQGLAYV |
Ga0113563_115488562 | 3300009167 | Freshwater Wetlands | VTDAPTEREGEGGWAKLRRRKVVQWGIAYAAGSWVLLQVLGFAADA |
Ga0113563_119364231 | 3300009167 | Freshwater Wetlands | VTDAPTEREEEGGWAKLRRRKVVQWGVAYAAAAWTLLQVIEFL |
Ga0113563_122961712 | 3300009167 | Freshwater Wetlands | VTDAPTEREGEGAWTRLRRRKVVQWGIAYAAAAWTLLQVLE |
Ga0113563_125338501 | 3300009167 | Freshwater Wetlands | MTDAPTKRDDEGGWAELRRRKVVQWGIAYAAGAWVLLQVIGFL |
Ga0113563_132224522 | 3300009167 | Freshwater Wetlands | LIDTPTGLAGEGTWAKLRRRKVVQWGVAYVAAAWGLL |
Ga0113563_132695371 | 3300009167 | Freshwater Wetlands | VTGASDQREGDSHWTVLSRRKVVQWGLGYAAAAWTLLQVIE |
Ga0115028_101564471 | 3300009179 | Wetland | VTDTPTEREEEGGWAKLHRRKVVQWGLAYAAGAWALL |
Ga0115028_114188061 | 3300009179 | Wetland | MTEPTEQGGENLWTRLRRRKVVQWALAYAAGAWTLLQ |
Ga0136852_113770271 | 3300010412 | Mangrove Sediment | VTDTPGEPASGGLWAKLRSKKVVQWGIAYAAIAWTL |
Ga0136852_119271161 | 3300010412 | Mangrove Sediment | LGDSPPEPQRENTWDRLRRRKVVQWGIAYAAGAWGLLQGIS |
Ga0157293_101780271 | 3300012898 | Soil | VNDAPAEREGDSTWARLRRRKVVQWGIAYAAAAWVL |
Ga0157283_103467691 | 3300012907 | Soil | VNDTPAEREAENIWTTLRRRKVVQWTVAYAAGAWLTLQVLGFAADTY |
Ga0157306_101542661 | 3300012912 | Soil | VTDTPAERGAESTWARLRRRKVVQWGFAYAAAAWV |
Ga0075345_10968471 | 3300014312 | Natural And Restored Wetlands | VTDVPTETTGESAWDKLRRRKVGQWGILYAAGAWGFLQGLE |
Ga0075345_11087501 | 3300014312 | Natural And Restored Wetlands | MTDTPIEREEEGGWAKLRRRKVVQWSLAYAAGAWLLLQVIGFLADA |
Ga0075347_10910913 | 3300014313 | Natural And Restored Wetlands | VTDTPTAREDERAWGKLRRRKVVQWGLAYAAGAWVLLQGLEYVTGTF |
Ga0075339_10318122 | 3300014316 | Natural And Restored Wetlands | VTDAPTEREGEGDWTKLRRRKVVQWGIAYAAAAWTLLQVIEYLGETYAW |
Ga0075348_12295311 | 3300014319 | Natural And Restored Wetlands | VTDPPPERQGESTWDRLRRRKVVQWGVAYAAGAWGLLQGISYVT |
Ga0157380_104613042 | 3300014326 | Switchgrass Rhizosphere | MTDAPTESAGESAWAKLRRRKVVQWGIAFVAAAWGLLQGLE* |
Ga0157380_113331921 | 3300014326 | Switchgrass Rhizosphere | VNDTPAERGADSTWAILRRRKVVQWTVAYAAGAWVLLQVLDF |
Ga0132258_136679881 | 3300015371 | Arabidopsis Rhizosphere | VNDTPTERAVESTWTGLRRRKVVQWGIAYAAVAWGLLQGL |
Ga0190270_128343281 | 3300018469 | Soil | LTDTPAERGAESTWTRLRRRKVVQWGLAYAAGAWLLMQL |
Ga0190270_132003732 | 3300018469 | Soil | VTDTPTRGGGEGTWAKLRRRKVVQWGIAYAAGAWGLL |
Ga0173481_105095982 | 3300019356 | Soil | VNDTPAEREAENIWKTLRRRKVVQWTVAYSAGGWVLLQVLGFAA |
Ga0224505_101446901 | 3300022214 | Sediment | VTDTPTERASDGAWARLTRRKVVQWGIAYLAGAWVLLQV |
Ga0247789_10664361 | 3300023266 | Soil | VNDTPAEREAENIWTTLRRRKVVQWTVAYSAGGWVLLQVL |
Ga0124853_13944902 | 3300024056 | Freshwater Wetlands | VAETPTGRETGSAWTTLHRRKVVQWGVAYAAGAWTLMQVLEYFSGTFDCPARFSNCRRSF |
Ga0207645_106158282 | 3300025907 | Miscanthus Rhizosphere | VTDTPPEREAESTWTSLRRRKVVQWGVAYVAAAWGL |
Ga0207657_110548311 | 3300025919 | Corn Rhizosphere | VNDAPAERGGDSAWARLRRRKVMQWGIAYAAAAWVLLQVLE |
Ga0207681_101441351 | 3300025923 | Switchgrass Rhizosphere | VTDTPAERGAESTWARLRRRKVVQWGFAYAAAAWVLLQV |
Ga0207650_112590382 | 3300025925 | Switchgrass Rhizosphere | VTDTPTEREGEGIWTRLRRRKVVQWGIAYAAGAWGL |
Ga0207691_107531601 | 3300025940 | Miscanthus Rhizosphere | VTDAPIERAVESTWTRLRRRKVVQWGIIYVAAAWGFLQ |
Ga0210104_10040122 | 3300025956 | Natural And Restored Wetlands | MTDTPTEREEEGAWTKLRRRKVVQWGLAYAAGAWVLLQGLEYVTGTF |
Ga0207648_102396724 | 3300026089 | Miscanthus Rhizosphere | VTDTPAERGAESTWARLRRRKVVQWGFAYAAAAWVLLQVLEY |
Ga0207674_114707702 | 3300026116 | Corn Rhizosphere | VNDTPAEREAENIWTTLRRRKVVQWTVAYSAGGWVLL |
Ga0207675_1014727661 | 3300026118 | Switchgrass Rhizosphere | VTDTPAERAAEGTWTRLRRRKVAQWGVAYAAGAWLLMQVL |
Ga0207675_1019137581 | 3300026118 | Switchgrass Rhizosphere | MTDAPTESAGESAWAKLRRRKVVQWGIAFVAAAWGLLQG |
Ga0210002_10146552 | 3300027617 | Arabidopsis Thaliana Rhizosphere | VTDTPPEREAESTWTSLRRRKVVQWGVAYVAAAWGLLQ |
Ga0209704_11735601 | 3300027693 | Freshwater Sediment | LIDTPTGLAGEGAWAKLRRRKVVQWGIAYVAAAWG |
Ga0209285_100511781 | 3300027726 | Freshwater Sediment | LAEAGGGDAEGAWAKLRRRKVAQWGIAYAAGAWGLL |
Ga0209706_100519263 | 3300027818 | Freshwater Sediment | VSDTPPEREDGSPWAKLRRRKVVQWGIVYAAGAWGFLQGLE |
Ga0209262_105547201 | 3300027841 | Freshwater | MTDAPTERDANGALAKLRRRKVVQWGLAYAAGAWALLQVI |
Ga0209397_100806982 | 3300027871 | Wetland | LTDTPAEREDEGAWAKLRRRKVVQWGLAYAAGAWALLEV |
Ga0209293_101708961 | 3300027877 | Wetland | LIDTPTGLAGEGAWAKLRRRKVVQWGIAYVAAAWGLLQGLAYL |
Ga0209496_107786331 | 3300027890 | Wetland | VTDTPPEREDEGAWAKLRRRKVVQWGIAYAAGAWGL |
Ga0209254_103682381 | 3300027897 | Freshwater Lake Sediment | VTDAPTEREGEGDWTKLRRRKVVQWGLAYAAAAWTLLQV |
Ga0209254_106012292 | 3300027897 | Freshwater Lake Sediment | VTDAPTEREGDGAWTRLRRRKVVQWGIAYAAAAWTLLQVLEYFG |
Ga0209254_110542112 | 3300027897 | Freshwater Lake Sediment | VTDTPIEREEEGGWAKLRRRKVVQWGLAYAAGAWVMLQV |
Ga0209382_108142911 | 3300027909 | Populus Rhizosphere | VNDTPTEREGESVWTRLRRRRVVQWGVAYAASAWVLLQV |
Ga0209705_103260352 | 3300027979 | Freshwater Sediment | LTDAPTERDANGAWAKLRRRKVVQWGLAYAAGAWALLQVIG |
Ga0310887_106956361 | 3300031547 | Soil | VNDTPAEREAENIWTTLRRRKVVQWTVAYSAGGWVLLQ |
Ga0310892_100033995 | 3300031858 | Soil | VNDTPAEREAENIWTTLRRRKVVQWTVAYSAGGWVLLQVLGFAADTYGWPTIV |
Ga0310900_107237962 | 3300031908 | Soil | VTDTPAERAAEGTWTRLRRRKVAQWGVAYAAGAWL |
Ga0315278_1000838113 | 3300031997 | Sediment | VTNAPTEREGEGAWTKLTRRKLVQWGVAYAAGAWQVTQAWITEI |
Ga0315278_108684381 | 3300031997 | Sediment | LTDAPTTRDDESAWARLRRRKVVQWGLAYAAGAWALLQ |
Ga0315278_117735662 | 3300031997 | Sediment | LTDAPNERDDERAWAKLSRRKVVQWGLAYAAGAWALLQVIGF |
Ga0310906_110077391 | 3300032013 | Soil | LTDTPAERGAESTWARRRRRKVVQWGFAYAAAAWVLLQVLEY |
Ga0315284_117159971 | 3300032053 | Sediment | VTDAPTEREGEGAFSKLRRRKVVQWSFAYAAAAWTLLQ |
Ga0310890_115140161 | 3300032075 | Soil | MRHGGRRVNDTPAERGAESWWGALRRRKVVQWTVAYAAGGWVLLQVLGFAADT |
Ga0315292_101655711 | 3300032143 | Sediment | MSDESTERAPAGIWAKLRRRKVVQWGVVYAAGAWGLLQGLAYVSAT |
Ga0315292_103324312 | 3300032143 | Sediment | VTDTPTEREEPGGWAKLRRRKVVQWGLAYAAAAWT |
Ga0315292_111649991 | 3300032143 | Sediment | VTDAPTEREGEGAWTKLRHRKVVQWGIAYAAGSWVLLQVLGYVS |
Ga0315292_111688421 | 3300032143 | Sediment | VTDTPTEREGAGPWAKLRRRKVVQWGIAYVAGAWGLL |
Ga0315283_100483221 | 3300032164 | Sediment | VTDTPTEREGEGPWAKLRRRKVVQWGIVYAAGAWGLLQGL |
Ga0315283_101327831 | 3300032164 | Sediment | VTDAPAEREGEGAWTKLRRRKVVQWGIAYAAAAWTLLQVLEYFGETYA |
Ga0315283_110526521 | 3300032164 | Sediment | VTDAPTEREGDGALSKLRHRKVVQWGIAYAAGAWGLLQGIE |
Ga0310889_102823881 | 3300032179 | Soil | VTDTPTERAAESTWTRLRRRKVVQWGVAYAAGAWLLMQ |
Ga0310889_106842911 | 3300032179 | Soil | VNDAPAEREGDSTWARLRRRKVVQWGIAYAAAAWVLLQVLEY |
Ga0315287_109869072 | 3300032397 | Sediment | VTDATEGEGEGLWTRLRRRKLVQWSLAYAAAAWVLLQ |
Ga0315275_116847632 | 3300032401 | Sediment | VTDTPTKRAGEGAWTKLRQRKVVQWGIAYAAGAWALL |
Ga0315273_101540511 | 3300032516 | Sediment | VTDTPTEREGEGAWTKLRRRKVVQWGIAYAAGAWVLLQVLGYVS |
Ga0316604_104428922 | 3300033406 | Soil | LNEAPSEREDEGAWARLRRRKVVQWGLTYAAGAWLLLQVV |
Ga0316604_105693721 | 3300033406 | Soil | VTDAPTEREGEGAFSKLRRRKAVRWGLAYAAGAWALLQV |
Ga0316605_113947772 | 3300033408 | Soil | VTDAQAEREADGPWAKLRRRKVVQWGIVYAAGAWGF |
Ga0316605_124413752 | 3300033408 | Soil | VTDTPAEREGDSAWAKLRRRKVVQWGVAYAAGAWGFLQ |
Ga0316603_110456791 | 3300033413 | Soil | VTDAPTEREGESPWARLRRRKVVQWGLAYAAAAWTLLQVIEYFGET |
Ga0316603_118686081 | 3300033413 | Soil | VTDAPTEREGEGAWTRLHRRKVVQWGVAYAAAAWTLLQVIEYLGETYAW |
Ga0316603_120673022 | 3300033413 | Soil | LTESTEGEGESTWTRLRRRKVVQWAIAYMAGAWGLLQ |
Ga0316603_121872172 | 3300033413 | Soil | VTDTPTEREREGAWARLRRRKVVQWGLGYTAVAWTLLQGLE |
Ga0316619_102248241 | 3300033414 | Soil | VTDAPTEREGEGAWTRLHRRKVVQWGVAYAAAAWTLLQVIEY |
Ga0316619_113539251 | 3300033414 | Soil | VTDAPTEREGEGAWTKLRRRKVVQWSLAYAAAAWT |
Ga0316622_1002907091 | 3300033416 | Soil | VTDAPTEREGEGAWTRLRRRKVVQWGIAYAAAAWTLLQVLEYF |
Ga0316622_1009999033 | 3300033416 | Soil | MTDTPTEREEEGGWARLRRRKVVQWGIAYSAGAWALLQG |
Ga0316622_1013680292 | 3300033416 | Soil | MTDTPTEREGEGGWAKLRRRKVVQWGLAYAAGAWALLQVIG |
Ga0316622_1021918341 | 3300033416 | Soil | VIDAPTEHEGEGAFSRLRRRKVVQWGLAYAAGAWALLQVVGFA |
Ga0316622_1024610732 | 3300033416 | Soil | MTDAPPEREGDGPWAKLRRRKVVQWGVLYAAGAWGFLQ |
Ga0316622_1026363882 | 3300033416 | Soil | VTDAPTEREGEGAWTKLRRRKVVQWGLAYTAGAWSVLQVIG |
Ga0316622_1028213501 | 3300033416 | Soil | LIDTPTGLAGEGAWAKLRRRKVVQWGVAYVAAAWGL |
Ga0316622_1028398561 | 3300033416 | Soil | VTDTPIERDDEVGWAKLRRRKVVQWGLAYAAGAWALL |
Ga0316622_1034011591 | 3300033416 | Soil | VTEPTEQGGENLWIRLRRRKVVQWGIAYAAAAWTL |
Ga0316625_1010138371 | 3300033418 | Soil | VTDTPTAREDEGAWGKLRRRKVVQWGIAYAAGVWGLLQVLDYLG |
Ga0316625_1012885651 | 3300033418 | Soil | VIDTPPEREDGSPWAKLRRRKVVQWGIVYAAGAWG |
Ga0316625_1013757601 | 3300033418 | Soil | VTDAPTEREGEGAWTKLRRRKVVQWSLAYAAAAWTLLQVIEYLGETYS |
Ga0316625_1015145902 | 3300033418 | Soil | MTDAPTERNHEGGWAKLRRRKVVQWGIAYAAGAWVLLQVIGFL |
Ga0316625_1021072442 | 3300033418 | Soil | VTDAPTEREGEGAFSKLRRRKVVQWGLAYAAGAWALL |
Ga0316601_1001375681 | 3300033419 | Soil | VTNTPTEREDEGAWGKLRRRKVVQWGIAYAAGAWGLLQALSYLGGT |
Ga0316601_1002587022 | 3300033419 | Soil | MTDTPTEREAEGAWANLRRRKVVQWSLAYAAGAWVLLQVLGFAA |
Ga0316601_1006698752 | 3300033419 | Soil | MTEPTERGGENLWTRLRRRKVVQWALAYAAGAWALLQVLE |
Ga0316601_1009724251 | 3300033419 | Soil | VAETPTGRETGSAWTTLHRRKVVQWGVAYAAGAWTLMQVLE |
Ga0316601_1019925811 | 3300033419 | Soil | VTDAPTEREGEGAWTRLCRRKVVQWGLAYAAGAWVMLQVIG |
Ga0316601_1020510622 | 3300033419 | Soil | VTDAPTEREGEGAFSKLRRRKAVRWSLAYAAGAWALLQVVGF |
Ga0316601_1022038361 | 3300033419 | Soil | VSEPAEPADEGMWARLRRRKVVQWGIVYAAGAWGFLQGL |
Ga0316613_100511223 | 3300033434 | Soil | VTDAPTEREGEGGWANLRRRKFVQWGLAYAAGAWALLQVIGFL |
Ga0316613_101698501 | 3300033434 | Soil | MDVTDATTERAGEDLWAKLRRRKVVQWGLTYLAGAWGLL |
Ga0316613_106582261 | 3300033434 | Soil | VIDPPTERDEDGAWTRLRRRKVVQWSIAYAAGAWGLLQVLQFL |
Ga0316613_107531651 | 3300033434 | Soil | VTEPTEQGGEGTWARLRRRKVVQWSLAYAAGAWGFL |
Ga0316613_112633271 | 3300033434 | Soil | MTDTPTEREGEGGWANLRRRKVVQWGLAYAAGAWALLQAIGFF |
Ga0316600_100217672 | 3300033481 | Soil | VTDAPTEREGESPWTALSRRKVVQWGLAYAAAAWTLLQ |
Ga0316600_100443001 | 3300033481 | Soil | VTDAPREREDAGAWGKLRRRKVVQWGIAYGAGAWALLQV |
Ga0316600_101619073 | 3300033481 | Soil | VTDAPTEREGEGGWAKLRRRKVVQWGIAYAAAAWTLLQVLEYFGETYL |
Ga0316600_101901891 | 3300033481 | Soil | VTDAPTEREGEGTWAKLRRRKVVQWGIAYAAGAWA |
Ga0316627_1014489681 | 3300033482 | Soil | VTNAPAEREDEGAWAKLRRRKVVQWGIAYAAGAWGLLQV |
Ga0316627_1020741541 | 3300033482 | Soil | MAVTDTPTEREREGAWARLRRRKVVQWGLGYAAVAWTLLQGL |
Ga0316629_102844322 | 3300033483 | Soil | VTEPTEQGGENLWIRLRRRKVVQWGIAYAAAAWTLLQVLEYFG |
Ga0316630_100540921 | 3300033487 | Soil | VTDTPTEVGGEGTWARLRRRKVVQWGVAYAAGAWALLQGIGFL |
Ga0316630_103641231 | 3300033487 | Soil | VTDAPTEREGEGAWTKLRRRKVVQWGIAYTAGSWVLLQVVGF |
Ga0316630_107503942 | 3300033487 | Soil | VTEPTELEGEGAWTKVRHRKVVQWALAYAAGAWAL |
Ga0316621_101048352 | 3300033488 | Soil | MTDTPTEREEEGGWAKLRRRKVVQWGLAYAAGAWALL |
Ga0316621_101824311 | 3300033488 | Soil | MTDAPKAREGEGAFSKLRRRKVVQWSFAYAAAAWTLLQ |
Ga0316621_103210911 | 3300033488 | Soil | MTDAPTERNHEGGWAKLRRRKVVQWGIAYAAGAWVLLQVI |
Ga0316621_104133462 | 3300033488 | Soil | LIDTPTGLAGEGAWAKLRRRKVVQWGLAYVAAAWGLLQGLASL |
Ga0316621_104601572 | 3300033488 | Soil | VSDTPTEREEDSPWAKLRRRKVVQWGVLYAAGAWGFL |
Ga0316621_105097881 | 3300033488 | Soil | MTDTPTEREEGGGWAKLRRRKVVQWGLAYAACGWGFLQGLE |
Ga0316621_106615021 | 3300033488 | Soil | LADTPTERETEGPWDKLRRRKVVQWGLAYAAGAWGLLQGLEY |
Ga0316621_108168972 | 3300033488 | Soil | MTDTPTERAYEGAWARLRHHKVVQWTLAYGAAAYTLLH |
Ga0316621_112283912 | 3300033488 | Soil | VTDMPAEREQEGAWAKLRRRKVVQWGIAYAAGAWG |
Ga0316621_114206012 | 3300033488 | Soil | VTDAPTEREGEGAWTRLHRRKVVQWAIAYAAAAWTLLQVLEYFGE |
Ga0316621_114586811 | 3300033488 | Soil | MTDTPTEREGEGGWANLRRRKVVQWGLAYAAGAWALLQAIGF |
Ga0316616_1003743281 | 3300033521 | Soil | VTDTPTAREDEGAWAKLRHRKVVQWGIAYAAGAWGLLQVLQFFAEAFE |
Ga0316616_1004126481 | 3300033521 | Soil | VTDTPTEGGGEGTWAKLRRRKVVQWGIAYAAGAWGLLQG |
Ga0316616_1018375401 | 3300033521 | Soil | VTDAPTKRDEDGAWATLRRRKVVQWGFAYAAGAWAL |
Ga0316617_1003890482 | 3300033557 | Soil | VAETPTGRETGSAWTTLHRRKVVQWGVAYAAGAWTLMQ |
Ga0316617_1007878932 | 3300033557 | Soil | MTDAPTERNHEGGWAKLRRRKVVQWGIAYAAGAWVLLQVIGF |
Ga0316617_1022996851 | 3300033557 | Soil | VTDAPTERGGEGAWTRLRRRKVVQWGIAYAAAAWTLLQVL |
Ga0316617_1028924401 | 3300033557 | Soil | MTDTPTEREEGGGWARLRRRKVVQWGLAYAAGAWGLL |
Ga0373898_032660_652_771 | 3300034076 | Sediment Slurry | MSDPPVEREEEGAWARLRRRKVVQWGVAYAATAWGLLQGL |
⦗Top⦘ |