| Basic Information | |
|---|---|
| Family ID | F031112 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 183 |
| Average Sequence Length | 48 residues |
| Representative Sequence | MSRSKTYGLVLALLASAALSTACTRTDATGPSDQPQASFESQGANN |
| Number of Associated Samples | 131 |
| Number of Associated Scaffolds | 183 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 67.03 % |
| % of genes near scaffold ends (potentially truncated) | 40.98 % |
| % of genes from short scaffolds (< 2000 bps) | 77.60 % |
| Associated GOLD sequencing projects | 123 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.37 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (81.421 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (24.044 % of family members) |
| Environment Ontology (ENVO) | Unclassified (27.322 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (37.705 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | Yes | Secondary Structure distribution: | α-helix: 31.08% β-sheet: 0.00% Coil/Unstructured: 68.92% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.37 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 183 Family Scaffolds |
|---|---|---|
| PF12833 | HTH_18 | 8.74 |
| PF00072 | Response_reg | 3.83 |
| PF04264 | YceI | 3.83 |
| PF02954 | HTH_8 | 2.73 |
| PF13411 | MerR_1 | 2.19 |
| PF01435 | Peptidase_M48 | 1.64 |
| PF07963 | N_methyl | 1.09 |
| PF13641 | Glyco_tranf_2_3 | 0.55 |
| PF12019 | GspH | 0.55 |
| PF08402 | TOBE_2 | 0.55 |
| PF00512 | HisKA | 0.55 |
| COG ID | Name | Functional Category | % Frequency in 183 Family Scaffolds |
|---|---|---|---|
| COG2353 | Polyisoprenoid-binding periplasmic protein YceI | General function prediction only [R] | 3.83 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 81.42 % |
| Unclassified | root | N/A | 18.58 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000363|ICChiseqgaiiFebDRAFT_11362259 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 3147 | Open in IMG/M |
| 3300000956|JGI10216J12902_115756828 | Not Available | 695 | Open in IMG/M |
| 3300001305|C688J14111_10026414 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 1725 | Open in IMG/M |
| 3300001686|C688J18823_10416704 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 867 | Open in IMG/M |
| 3300002568|C688J35102_118970429 | Not Available | 620 | Open in IMG/M |
| 3300002568|C688J35102_120938792 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 2626 | Open in IMG/M |
| 3300003267|soilL1_10002948 | All Organisms → cellular organisms → Bacteria | 32009 | Open in IMG/M |
| 3300003267|soilL1_10076059 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 4115 | Open in IMG/M |
| 3300003321|soilH1_10111690 | All Organisms → cellular organisms → Bacteria | 6315 | Open in IMG/M |
| 3300003987|Ga0055471_10259732 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 552 | Open in IMG/M |
| 3300003993|Ga0055468_10280075 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 530 | Open in IMG/M |
| 3300004081|Ga0063454_100707599 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 760 | Open in IMG/M |
| 3300004153|Ga0063455_100614451 | Not Available | 711 | Open in IMG/M |
| 3300004157|Ga0062590_100378845 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 1148 | Open in IMG/M |
| 3300004463|Ga0063356_100265038 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 2096 | Open in IMG/M |
| 3300004463|Ga0063356_100476740 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1640 | Open in IMG/M |
| 3300004463|Ga0063356_102660359 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 769 | Open in IMG/M |
| 3300004463|Ga0063356_103829361 | Not Available | 648 | Open in IMG/M |
| 3300004479|Ga0062595_102552845 | Not Available | 511 | Open in IMG/M |
| 3300004808|Ga0062381_10334486 | Not Available | 565 | Open in IMG/M |
| 3300005345|Ga0070692_10746694 | Not Available | 663 | Open in IMG/M |
| 3300005367|Ga0070667_101600330 | Not Available | 612 | Open in IMG/M |
| 3300005444|Ga0070694_100871967 | Not Available | 742 | Open in IMG/M |
| 3300005545|Ga0070695_100321762 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1150 | Open in IMG/M |
| 3300005562|Ga0058697_10124123 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 1099 | Open in IMG/M |
| 3300005844|Ga0068862_101703113 | Not Available | 639 | Open in IMG/M |
| 3300005873|Ga0075287_1030620 | Not Available | 698 | Open in IMG/M |
| 3300005889|Ga0075290_1054705 | All Organisms → cellular organisms → Bacteria | 555 | Open in IMG/M |
| 3300005937|Ga0081455_10043522 | All Organisms → cellular organisms → Bacteria | 3926 | Open in IMG/M |
| 3300006358|Ga0068871_102006226 | Not Available | 551 | Open in IMG/M |
| 3300006804|Ga0079221_11721173 | All Organisms → cellular organisms → Bacteria | 511 | Open in IMG/M |
| 3300006844|Ga0075428_102441381 | Not Available | 536 | Open in IMG/M |
| 3300006845|Ga0075421_100003040 | All Organisms → cellular organisms → Bacteria | 20052 | Open in IMG/M |
| 3300006845|Ga0075421_101396554 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 771 | Open in IMG/M |
| 3300006894|Ga0079215_10229555 | Not Available | 966 | Open in IMG/M |
| 3300006894|Ga0079215_10394262 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 814 | Open in IMG/M |
| 3300006918|Ga0079216_10702228 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 721 | Open in IMG/M |
| 3300006918|Ga0079216_11940572 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 509 | Open in IMG/M |
| 3300007004|Ga0079218_11389273 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 749 | Open in IMG/M |
| 3300007790|Ga0105679_10636086 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 1201 | Open in IMG/M |
| 3300007821|Ga0104323_126690 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 2165 | Open in IMG/M |
| 3300009053|Ga0105095_10069708 | All Organisms → cellular organisms → Bacteria | 1895 | Open in IMG/M |
| 3300009078|Ga0105106_10009094 | All Organisms → cellular organisms → Bacteria | 7168 | Open in IMG/M |
| 3300009147|Ga0114129_13029320 | All Organisms → cellular organisms → Bacteria | 551 | Open in IMG/M |
| 3300009174|Ga0105241_12664898 | Not Available | 503 | Open in IMG/M |
| 3300009789|Ga0126307_10036855 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 3786 | Open in IMG/M |
| 3300009789|Ga0126307_10169756 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 1748 | Open in IMG/M |
| 3300009789|Ga0126307_10473719 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1010 | Open in IMG/M |
| 3300009840|Ga0126313_10305906 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 1244 | Open in IMG/M |
| 3300010036|Ga0126305_10097371 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 1761 | Open in IMG/M |
| 3300010039|Ga0126309_10001780 | All Organisms → cellular organisms → Bacteria | 7755 | Open in IMG/M |
| 3300010039|Ga0126309_11307322 | All Organisms → cellular organisms → Bacteria | 502 | Open in IMG/M |
| 3300010040|Ga0126308_10747245 | All Organisms → cellular organisms → Bacteria | 675 | Open in IMG/M |
| 3300010045|Ga0126311_10001047 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 13106 | Open in IMG/M |
| 3300010400|Ga0134122_11132051 | All Organisms → cellular organisms → Bacteria | 778 | Open in IMG/M |
| 3300010403|Ga0134123_13517388 | Not Available | 507 | Open in IMG/M |
| 3300011332|Ga0126317_10506962 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 765 | Open in IMG/M |
| 3300011332|Ga0126317_10507960 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 684 | Open in IMG/M |
| 3300011332|Ga0126317_10544038 | Not Available | 899 | Open in IMG/M |
| 3300011333|Ga0127502_10641908 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 1570 | Open in IMG/M |
| 3300011333|Ga0127502_11259115 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 851 | Open in IMG/M |
| 3300011429|Ga0137455_1017112 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 1959 | Open in IMG/M |
| 3300012043|Ga0136631_10020576 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 2379 | Open in IMG/M |
| 3300012043|Ga0136631_10363325 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 583 | Open in IMG/M |
| 3300012187|Ga0136622_10272157 | All Organisms → cellular organisms → Bacteria | 711 | Open in IMG/M |
| 3300012212|Ga0150985_101248018 | Not Available | 528 | Open in IMG/M |
| 3300012212|Ga0150985_104197841 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 1628 | Open in IMG/M |
| 3300012212|Ga0150985_104645944 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 1610 | Open in IMG/M |
| 3300012212|Ga0150985_111235151 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 783 | Open in IMG/M |
| 3300012212|Ga0150985_113653735 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 779 | Open in IMG/M |
| 3300012212|Ga0150985_114862426 | Not Available | 611 | Open in IMG/M |
| 3300012212|Ga0150985_117131096 | Not Available | 540 | Open in IMG/M |
| 3300012212|Ga0150985_118501592 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 811 | Open in IMG/M |
| 3300012469|Ga0150984_105307087 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 621 | Open in IMG/M |
| 3300012469|Ga0150984_111651103 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 1840 | Open in IMG/M |
| 3300012469|Ga0150984_123118156 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 614 | Open in IMG/M |
| 3300012530|Ga0136635_10010342 | All Organisms → cellular organisms → Bacteria | 2821 | Open in IMG/M |
| 3300012678|Ga0136615_10013748 | All Organisms → cellular organisms → Bacteria | 4170 | Open in IMG/M |
| 3300012679|Ga0136616_10157428 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 1061 | Open in IMG/M |
| 3300012681|Ga0136613_10287282 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 914 | Open in IMG/M |
| 3300012684|Ga0136614_10019366 | All Organisms → cellular organisms → Bacteria | 4972 | Open in IMG/M |
| 3300012684|Ga0136614_11233357 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 504 | Open in IMG/M |
| 3300012914|Ga0157297_10058566 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1036 | Open in IMG/M |
| 3300012917|Ga0137395_10553898 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 830 | Open in IMG/M |
| 3300012930|Ga0137407_10034211 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 3995 | Open in IMG/M |
| 3300012989|Ga0164305_12229746 | Not Available | 504 | Open in IMG/M |
| 3300013772|Ga0120158_10166833 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1194 | Open in IMG/M |
| 3300014969|Ga0157376_11058322 | Not Available | 836 | Open in IMG/M |
| 3300015079|Ga0167657_1005765 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 1831 | Open in IMG/M |
| 3300017695|Ga0180121_10000042 | All Organisms → cellular organisms → Bacteria | 39538 | Open in IMG/M |
| 3300017695|Ga0180121_10008706 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 3753 | Open in IMG/M |
| 3300017695|Ga0180121_10008988 | All Organisms → cellular organisms → Bacteria | 3685 | Open in IMG/M |
| 3300017695|Ga0180121_10078452 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 1178 | Open in IMG/M |
| 3300017787|Ga0183260_10027353 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 4320 | Open in IMG/M |
| 3300017789|Ga0136617_10000485 | All Organisms → cellular organisms → Bacteria | 33353 | Open in IMG/M |
| 3300017789|Ga0136617_10009376 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 8730 | Open in IMG/M |
| 3300017997|Ga0184610_1001897 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 4728 | Open in IMG/M |
| 3300017997|Ga0184610_1098186 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 926 | Open in IMG/M |
| 3300018000|Ga0184604_10000222 | All Organisms → cellular organisms → Bacteria | 5262 | Open in IMG/M |
| 3300018027|Ga0184605_10027256 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 2335 | Open in IMG/M |
| 3300018027|Ga0184605_10047312 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 1822 | Open in IMG/M |
| 3300018028|Ga0184608_10036809 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 1870 | Open in IMG/M |
| 3300018056|Ga0184623_10217088 | All Organisms → cellular organisms → Bacteria | 878 | Open in IMG/M |
| 3300018063|Ga0184637_10500442 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 706 | Open in IMG/M |
| 3300018076|Ga0184609_10419535 | All Organisms → cellular organisms → Bacteria | 619 | Open in IMG/M |
| 3300018077|Ga0184633_10138102 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 1263 | Open in IMG/M |
| 3300018079|Ga0184627_10005732 | All Organisms → cellular organisms → Bacteria | 5537 | Open in IMG/M |
| 3300018079|Ga0184627_10022682 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 3100 | Open in IMG/M |
| 3300018422|Ga0190265_10000699 | All Organisms → cellular organisms → Bacteria | 22665 | Open in IMG/M |
| 3300018422|Ga0190265_10055934 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 3474 | Open in IMG/M |
| 3300018422|Ga0190265_10732971 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 1110 | Open in IMG/M |
| 3300018429|Ga0190272_10006813 | All Organisms → cellular organisms → Bacteria | 5482 | Open in IMG/M |
| 3300018429|Ga0190272_10252407 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 1325 | Open in IMG/M |
| 3300019233|Ga0184645_1005647 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 601 | Open in IMG/M |
| 3300019233|Ga0184645_1256927 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 521 | Open in IMG/M |
| 3300019249|Ga0184648_1350131 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 757 | Open in IMG/M |
| 3300019259|Ga0184646_1146329 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 692 | Open in IMG/M |
| 3300019259|Ga0184646_1220770 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 942 | Open in IMG/M |
| 3300019259|Ga0184646_1245343 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 593 | Open in IMG/M |
| 3300019259|Ga0184646_1628954 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 573 | Open in IMG/M |
| 3300019279|Ga0184642_1584241 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 887 | Open in IMG/M |
| 3300019356|Ga0173481_10423577 | Not Available | 658 | Open in IMG/M |
| 3300019362|Ga0173479_10152082 | Not Available | 926 | Open in IMG/M |
| 3300019487|Ga0187893_10087135 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 2833 | Open in IMG/M |
| 3300019881|Ga0193707_1120874 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 763 | Open in IMG/M |
| 3300020067|Ga0180109_1312812 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 538 | Open in IMG/M |
| 3300020068|Ga0184649_1228213 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 845 | Open in IMG/M |
| 3300020068|Ga0184649_1441176 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 615 | Open in IMG/M |
| 3300021078|Ga0210381_10033666 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1456 | Open in IMG/M |
| 3300021951|Ga0222624_1002806 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 531 | Open in IMG/M |
| 3300025327|Ga0209751_10716916 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 790 | Open in IMG/M |
| 3300025960|Ga0207651_11766620 | Not Available | 557 | Open in IMG/M |
| 3300026116|Ga0207674_10795849 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 912 | Open in IMG/M |
| 3300027543|Ga0209999_1062971 | All Organisms → cellular organisms → Bacteria | 707 | Open in IMG/M |
| 3300027778|Ga0209464_10116632 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 923 | Open in IMG/M |
| 3300027886|Ga0209486_11143893 | All Organisms → cellular organisms → Bacteria | 531 | Open in IMG/M |
| 3300027909|Ga0209382_10007004 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 14433 | Open in IMG/M |
| 3300027964|Ga0256864_1011481 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 2196 | Open in IMG/M |
| 3300027979|Ga0209705_10569735 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 545 | Open in IMG/M |
| 3300028380|Ga0268265_12525243 | Not Available | 520 | Open in IMG/M |
| 3300028592|Ga0247822_10055419 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 2777 | Open in IMG/M |
| 3300028717|Ga0307298_10128484 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 729 | Open in IMG/M |
| 3300028784|Ga0307282_10569122 | All Organisms → cellular organisms → Bacteria | 550 | Open in IMG/M |
| 3300028814|Ga0307302_10043031 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 2094 | Open in IMG/M |
| 3300028872|Ga0307314_10035390 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 1204 | Open in IMG/M |
| 3300028880|Ga0307300_10365495 | Not Available | 500 | Open in IMG/M |
| 3300028881|Ga0307277_10138676 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1050 | Open in IMG/M |
| 3300028881|Ga0307277_10464424 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 567 | Open in IMG/M |
| 3300030606|Ga0299906_11330500 | Not Available | 513 | Open in IMG/M |
| 3300030831|Ga0308152_112993 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 540 | Open in IMG/M |
| 3300030904|Ga0308198_1014554 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 994 | Open in IMG/M |
| 3300030904|Ga0308198_1040049 | Not Available | 699 | Open in IMG/M |
| 3300030905|Ga0308200_1023028 | All Organisms → cellular organisms → Bacteria | 1012 | Open in IMG/M |
| 3300030989|Ga0308196_1006803 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 1094 | Open in IMG/M |
| 3300030989|Ga0308196_1033308 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 657 | Open in IMG/M |
| 3300030990|Ga0308178_1047959 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 789 | Open in IMG/M |
| 3300030990|Ga0308178_1080129 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 663 | Open in IMG/M |
| 3300030993|Ga0308190_1053618 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 785 | Open in IMG/M |
| 3300030993|Ga0308190_1162625 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 539 | Open in IMG/M |
| 3300031058|Ga0308189_10051720 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 1144 | Open in IMG/M |
| 3300031092|Ga0308204_10132364 | Not Available | 722 | Open in IMG/M |
| 3300031093|Ga0308197_10149835 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 748 | Open in IMG/M |
| 3300031093|Ga0308197_10336035 | Not Available | 570 | Open in IMG/M |
| 3300031094|Ga0308199_1007761 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 1538 | Open in IMG/M |
| 3300031094|Ga0308199_1029683 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 977 | Open in IMG/M |
| 3300031096|Ga0308193_1042661 | Not Available | 661 | Open in IMG/M |
| 3300031114|Ga0308187_10099954 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 899 | Open in IMG/M |
| 3300031114|Ga0308187_10338139 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 577 | Open in IMG/M |
| 3300031229|Ga0299913_10087912 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 3022 | Open in IMG/M |
| 3300031421|Ga0308194_10138287 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 740 | Open in IMG/M |
| 3300031421|Ga0308194_10269369 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 578 | Open in IMG/M |
| 3300031424|Ga0308179_1009363 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 928 | Open in IMG/M |
| 3300031548|Ga0307408_100017580 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 4787 | Open in IMG/M |
| 3300031548|Ga0307408_100397586 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1182 | Open in IMG/M |
| 3300031852|Ga0307410_10018723 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 4191 | Open in IMG/M |
| 3300031903|Ga0307407_11496095 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 534 | Open in IMG/M |
| 3300031949|Ga0214473_11989202 | All Organisms → cellular organisms → Bacteria | 567 | Open in IMG/M |
| 3300032002|Ga0307416_100866685 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1002 | Open in IMG/M |
| 3300033814|Ga0364930_0146304 | All Organisms → cellular organisms → Bacteria | 807 | Open in IMG/M |
| 3300034671|Ga0314796_091044 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 647 | Open in IMG/M |
| 3300034680|Ga0370541_032071 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 636 | Open in IMG/M |
| 3300034680|Ga0370541_033354 | Not Available | 628 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 24.04% |
| Polar Desert Sand | Environmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand | 8.74% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 7.10% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 6.56% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 4.37% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 4.92% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 3.83% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 3.28% |
| Soil | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil | 2.73% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 2.73% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 2.73% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 2.73% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 2.19% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 1.64% |
| Sugarcane Root And Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Sugarcane Root And Bulk Soil | 1.64% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.64% |
| Wetland Sediment | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Wetland Sediment | 1.09% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 1.09% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 1.09% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.09% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.09% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 1.09% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 1.09% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil | 1.09% |
| Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 1.09% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.09% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 1.09% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 0.55% |
| Glacier Forefield Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil | 0.55% |
| Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 0.55% |
| Soil | Environmental → Terrestrial → Soil → Loam → Unclassified → Soil | 0.55% |
| Soil | Environmental → Terrestrial → Soil → Sand → Desert → Soil | 0.55% |
| Microbial Mat On Rocks | Environmental → Terrestrial → Cave → Unclassified → Unclassified → Microbial Mat On Rocks | 0.55% |
| Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 0.55% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.55% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.55% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.55% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.55% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.55% |
| Agave | Host-Associated → Plants → Phylloplane → Unclassified → Unclassified → Agave | 0.55% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000363 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300001305 | Grasslands soil microbial communities from Hopland, California, USA | Environmental | Open in IMG/M |
| 3300001686 | Grasslands soil microbial communities from Hopland, California, USA | Environmental | Open in IMG/M |
| 3300002568 | Grasslands soil microbial communities from Hopland, California, USA - 2 | Environmental | Open in IMG/M |
| 3300003267 | Sugarcane bulk soil Sample L1 | Environmental | Open in IMG/M |
| 3300003321 | Sugarcane bulk soil Sample H1 | Environmental | Open in IMG/M |
| 3300003987 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleB_D2 | Environmental | Open in IMG/M |
| 3300003993 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailC_D2 | Environmental | Open in IMG/M |
| 3300004081 | Grasslands soil microbial communities from Hopland, California, USA - 2 (version 2) | Environmental | Open in IMG/M |
| 3300004153 | Grasslands soil microbial communities from Hopland, California, USA (version 2) | Environmental | Open in IMG/M |
| 3300004157 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2 | Environmental | Open in IMG/M |
| 3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
| 3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
| 3300004808 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare1Fresh | Environmental | Open in IMG/M |
| 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Environmental | Open in IMG/M |
| 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Environmental | Open in IMG/M |
| 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Environmental | Open in IMG/M |
| 3300005562 | Agave microbial communities from Guanajuato, Mexico - As.Ma.e | Host-Associated | Open in IMG/M |
| 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Host-Associated | Open in IMG/M |
| 3300005873 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_0N_301 | Environmental | Open in IMG/M |
| 3300005889 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_80N_201 | Environmental | Open in IMG/M |
| 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Host-Associated | Open in IMG/M |
| 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Host-Associated | Open in IMG/M |
| 3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
| 3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
| 3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
| 3300006894 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Control | Environmental | Open in IMG/M |
| 3300006918 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS100 | Environmental | Open in IMG/M |
| 3300007004 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost | Environmental | Open in IMG/M |
| 3300007790 | Microbial communities of desert soil contaminated with blood from dead anthrax infected zebra in Etosha National Park, Namibia. Combined Assembly of 14 sequencing projects | Environmental | Open in IMG/M |
| 3300007821 | Permafrost core soil microbial communities from Svalbard, Norway - sample 2-10-2 Soapdenovo | Environmental | Open in IMG/M |
| 3300009053 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (3) Depth 19-21cm March2015 | Environmental | Open in IMG/M |
| 3300009078 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 10-12cm September2015 | Environmental | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Host-Associated | Open in IMG/M |
| 3300009789 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot28 | Environmental | Open in IMG/M |
| 3300009840 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105A | Environmental | Open in IMG/M |
| 3300010036 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot26 | Environmental | Open in IMG/M |
| 3300010039 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot56 | Environmental | Open in IMG/M |
| 3300010040 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot55 | Environmental | Open in IMG/M |
| 3300010045 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot61 | Environmental | Open in IMG/M |
| 3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
| 3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
| 3300011332 | Soil microbial communities from California, USA to study soil gas exchange rates - SR-CA-SC2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300011333 | Cornfield soil microbial communities from Stanford, California, USA - CI-CA-CRN metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300011429 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT600_2 | Environmental | Open in IMG/M |
| 3300012043 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ601 (22.06) | Environmental | Open in IMG/M |
| 3300012187 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ448 (21.06) | Environmental | Open in IMG/M |
| 3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
| 3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
| 3300012530 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ85 (21.06) | Environmental | Open in IMG/M |
| 3300012678 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ288 (22.06) | Environmental | Open in IMG/M |
| 3300012679 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ299 (21.06) | Environmental | Open in IMG/M |
| 3300012681 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ272 (21.06) | Environmental | Open in IMG/M |
| 3300012684 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ279 (21.06) | Environmental | Open in IMG/M |
| 3300012914 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S028-104C-2 | Environmental | Open in IMG/M |
| 3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
| 3300013772 | Permafrost microbial communities from Nunavut, Canada - A10_80_0.25M | Environmental | Open in IMG/M |
| 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Host-Associated | Open in IMG/M |
| 3300015079 | Arctic soil microbial communities from a glacier forefield, Storglaci?ren, Tarfala, Sweden (Sample st-6b, vegetation/snow interface) | Environmental | Open in IMG/M |
| 3300017695 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ540 (21.06) (version 2) | Environmental | Open in IMG/M |
| 3300017787 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ497 (22.06) (version 2) | Environmental | Open in IMG/M |
| 3300017789 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ322 (21.06) | Environmental | Open in IMG/M |
| 3300017997 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_coex | Environmental | Open in IMG/M |
| 3300018000 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_5_coex | Environmental | Open in IMG/M |
| 3300018027 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_coex | Environmental | Open in IMG/M |
| 3300018028 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_coex | Environmental | Open in IMG/M |
| 3300018056 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_b1 | Environmental | Open in IMG/M |
| 3300018063 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_127_b2 | Environmental | Open in IMG/M |
| 3300018076 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_coex | Environmental | Open in IMG/M |
| 3300018077 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_170_b1 | Environmental | Open in IMG/M |
| 3300018079 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_127_b1 | Environmental | Open in IMG/M |
| 3300018422 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 T | Environmental | Open in IMG/M |
| 3300018429 | Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 T | Environmental | Open in IMG/M |
| 3300019233 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019249 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019259 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019279 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019356 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S073-202C-2 (version 2) | Environmental | Open in IMG/M |
| 3300019362 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S104-311B-1 (version 2) | Environmental | Open in IMG/M |
| 3300019487 | White microbial mat communities from a basaltic lava cave in the Kipuka Kanohina Cave System on the Island of Hawaii, USA - MA170107-4 metaG | Environmental | Open in IMG/M |
| 3300019881 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3c2 | Environmental | Open in IMG/M |
| 3300020067 | Metatranscriptome of soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaT ERMLIBT47_16_1Ra (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300020068 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_65 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300021078 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5_coex redo | Environmental | Open in IMG/M |
| 3300021951 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300025327 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 13_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027778 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare1Fresh (SPAdes) | Environmental | Open in IMG/M |
| 3300027886 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost (SPAdes) | Environmental | Open in IMG/M |
| 3300027909 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027964 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT147D111 HiSeq | Environmental | Open in IMG/M |
| 3300027979 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 10-12cm September2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028592 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Cellulose_Day30 | Environmental | Open in IMG/M |
| 3300028717 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_158 | Environmental | Open in IMG/M |
| 3300028784 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_121 | Environmental | Open in IMG/M |
| 3300028814 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_183 | Environmental | Open in IMG/M |
| 3300028872 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_204 | Environmental | Open in IMG/M |
| 3300028880 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_181 | Environmental | Open in IMG/M |
| 3300028881 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_116 | Environmental | Open in IMG/M |
| 3300030606 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT145D125 | Environmental | Open in IMG/M |
| 3300030831 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_141 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030904 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_202 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030905 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_204 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030989 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_197 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030990 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_149 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030993 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_185 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031058 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_184 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031092 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_367 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031093 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_198 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031094 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_203 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031096 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_194 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031114 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_182 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031229 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT155D38 | Environmental | Open in IMG/M |
| 3300031421 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_195 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031424 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_150 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Host-Associated | Open in IMG/M |
| 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Host-Associated | Open in IMG/M |
| 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Host-Associated | Open in IMG/M |
| 3300031949 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT98D197 | Environmental | Open in IMG/M |
| 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Host-Associated | Open in IMG/M |
| 3300033814 | Sediment microbial communities from East River floodplain, Colorado, United States - 55_j17 | Environmental | Open in IMG/M |
| 3300034671 | Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24R1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300034680 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_116 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| ICChiseqgaiiFebDRAFT_113622592 | 3300000363 | Soil | MSRVKTYGVALALLASAALTSACTRTDATGPSDQTQASFEEGQGANNHH* |
| JGI10216J12902_1157568281 | 3300000956 | Soil | QIGAASPLQAPTPSERDLYMSRSKTYGLALALIASAALSTACTRSDTTGPSDQTQASFQEGQGPNN* |
| C688J14111_100264143 | 3300001305 | Soil | MSRSKTYGLALALIASAALSTACTRSDATGPSDQPQASLETQGGHS* |
| C688J18823_104167042 | 3300001686 | Soil | MNAYLKGTHMSRSKTYGLVLALLASAALSSACTRSDTTGPSDQPQA |
| C688J35102_1189704292 | 3300002568 | Soil | MSRSKTYGLALALIASAALSTACTRSDTTGPSDQTQASFQE |
| C688J35102_1209387923 | 3300002568 | Soil | MSRIKSYGLVLALLASAALSTACTRADTTGPSDQQQPSFETQGSGN* |
| soilL1_100029486 | 3300003267 | Sugarcane Root And Bulk Soil | MSRSKIYGLLLALLASSALSTACTRTDATGPSDQPQASFEEGQGSNNHK* |
| soilL1_100760591 | 3300003267 | Sugarcane Root And Bulk Soil | MSRIKSYGLILVLLASAAISTACTRNDPTAPSDQHQPSFEEGQGANNNH* |
| soilH1_101116907 | 3300003321 | Sugarcane Root And Bulk Soil | MSRSKIYGLVLALIASAALSTACTRSDTTGPSDQPQASFEEGQGPHN* |
| Ga0055471_102597321 | 3300003987 | Natural And Restored Wetlands | MSRSKTYGLVLALLVSSALSAGCTRTDTTGPSEQVEPSFENQGANN* |
| Ga0055468_102800752 | 3300003993 | Natural And Restored Wetlands | MSRLKTYGLVLALLASAALSTACTRTDATGPSEQVQPSFEGIGSNN* |
| Ga0063454_1007075992 | 3300004081 | Soil | RSKTYGLALALIASAALSTACTRSDTTGPSDQTQASFQEGQGPNN* |
| Ga0063455_1006144512 | 3300004153 | Soil | MSRKTYAIVIALLASAALSTACTRTDATGPSSDQAQPSFEESNGANNSK* |
| Ga0062590_1003788452 | 3300004157 | Soil | MSRMKAYGLVLALVASAALSTACTRTDATGPSEQVQPSFEGQGANN* |
| Ga0063356_1002650382 | 3300004463 | Arabidopsis Thaliana Rhizosphere | MSRAKTYGLVLALLASAALSTACTRTDSTGPSEQSQPSYETLGANN* |
| Ga0063356_1004767402 | 3300004463 | Arabidopsis Thaliana Rhizosphere | MSRIKSYGLVLVLLASAAVSTACTRNDPTAPSDQHQPSFEEGQGANNHH* |
| Ga0063356_1026603591 | 3300004463 | Arabidopsis Thaliana Rhizosphere | MSRKTYGIVMALLASAALSTACTRTDATGPSDQAQPSFEENNGSNNNK* |
| Ga0063356_1038293611 | 3300004463 | Arabidopsis Thaliana Rhizosphere | MSRKTYGIVIALLASAALSTACTRTDATGPSDQVQASFEDTNGANNNK* |
| Ga0062595_1025528452 | 3300004479 | Soil | MSRSKTYGLALALIASAALSTACTRSDTTGPSDQTQASFQEGQGPNN* |
| Ga0062381_103344862 | 3300004808 | Wetland Sediment | MSRKTYGIVMALLASAALSTACTRTDATGPSDQTQPSFEENNGANNGK* |
| Ga0070692_107466942 | 3300005345 | Corn, Switchgrass And Miscanthus Rhizosphere | MSRAKTYGLVLALVASAALSTACTRTDATAPSEQAQPAFETQGSGT* |
| Ga0070667_1016003302 | 3300005367 | Switchgrass Rhizosphere | STSLWLALTLLAGAATACTRTDIAGPSADQQPSFENTGGNN* |
| Ga0070694_1008719672 | 3300005444 | Corn, Switchgrass And Miscanthus Rhizosphere | SRSKTYGLALALIASAALSTACTRSDTTGPSDQTQASFQEGQGPNN* |
| Ga0070695_1003217622 | 3300005545 | Corn, Switchgrass And Miscanthus Rhizosphere | MSRSKIYGLVLALLASAALSTACTRTDATGPSDQPQASFESQGANN* |
| Ga0058697_101241232 | 3300005562 | Agave | MSRLKTYGLALALLASAALTSACTRTDATGPSDQPQASFEEGQGGNNHH* |
| Ga0068862_1017031131 | 3300005844 | Switchgrass Rhizosphere | LALIASAALSTACTRSDTTGPSDQTQASFQEGQGPNN* |
| Ga0075287_10306202 | 3300005873 | Rice Paddy Soil | MSRIKSYGLILVLLASAAISTACTRNDPTAPSDQHQASFEEGQGANNHH* |
| Ga0075290_10547051 | 3300005889 | Rice Paddy Soil | MSRIKSYGLILVLLASAAISTACTRNDPTAPSDQHQASFEEGQG |
| Ga0081455_100435221 | 3300005937 | Tabebuia Heterophylla Rhizosphere | MSRSKTYGIVLALLASVAISTACTRTDATGPSEQPQPSFEE |
| Ga0068871_1020062262 | 3300006358 | Miscanthus Rhizosphere | MSRSKTYGLALALIASAALSTACTRSDTTGPSDQT |
| Ga0079221_117211731 | 3300006804 | Agricultural Soil | MSRSRTYGLALALLAATALSTACTRTDATGPSDQQQQQ |
| Ga0075428_1024413812 | 3300006844 | Populus Rhizosphere | MSRSKTYGLALALIASAALSTACTRSDTTGPSDQTQASFQEGQGA |
| Ga0075421_10000304016 | 3300006845 | Populus Rhizosphere | MSRPKSYGLVLALLASMALSTACTRTDATGPSEQPQASFQEGQGSNN* |
| Ga0075421_1013965542 | 3300006845 | Populus Rhizosphere | PKSYGLVLALLASMALSTACTRTDATGPSEQPQASFQEGQGANN* |
| Ga0079215_102295552 | 3300006894 | Agricultural Soil | MSRSKTYGLVMALLASAAFSGCTRSDATGPSEAPAVSFDEAQGANN* |
| Ga0079215_103942622 | 3300006894 | Agricultural Soil | MKTYGLVLALLASAALSTGCTRSDATGPSEQPQPSFENIGANN* |
| Ga0079216_107022282 | 3300006918 | Agricultural Soil | MSRSKSSAIALALLVSAAVSTGCTRTDATGPSEQVQPSFETQGSGN* |
| Ga0079216_119405722 | 3300006918 | Agricultural Soil | MSRSKTYGLVLALLASAALSTACTRTDATGPSEQPQPSFESIGSNN* |
| Ga0079218_113892731 | 3300007004 | Agricultural Soil | PGYHPTLKELHMSRSKSYAIVLTLLVSAAVSTGCTRTDATGPSEQVQPSFETQGSGN* |
| Ga0105679_106360861 | 3300007790 | Soil | MSRPLTSWLTLALTACALLTGACTRSDVTGPSEQPQASFETQGANN* |
| Ga0104323_1266904 | 3300007821 | Soil | MSRFKTYGLALALLASAAITTACTRTDTTGPSDQQQQTSFDESQGANNGK* |
| Ga0105095_100697081 | 3300009053 | Freshwater Sediment | MSRLKTYGLVLALLASAAFSTACTRTDTTGPSEQPQASFESIGANN* |
| Ga0105106_100090949 | 3300009078 | Freshwater Sediment | MSRLKTYGLVLALLASAAFSTACTRTDATGPSEQVQPSFEGMGSGN* |
| Ga0114129_130293202 | 3300009147 | Populus Rhizosphere | MSRSKSYGLVLALLASAALSTACTRADATGPSEQQQ |
| Ga0105241_126648982 | 3300009174 | Corn Rhizosphere | QAPTPSERDLYMSRSKTYGLALALIASAALSTACTRSDTTGPSDQTQASFQEGQGPNN* |
| Ga0126307_100368554 | 3300009789 | Serpentine Soil | MSRLKSYALVLGLLASAALSTACTRNDATGPSEQTPASFEGQGAGN* |
| Ga0126307_101697562 | 3300009789 | Serpentine Soil | MSRSKTYGLVLALLASAALSTACTRSDTTGPSDQPQVSFEEGQGSGNAK* |
| Ga0126307_104737192 | 3300009789 | Serpentine Soil | MSRSKSFAIALALLGSAALSTGCTRTDTTGPSEQTQPSFETQGAGG* |
| Ga0126313_103059061 | 3300009840 | Serpentine Soil | LVLALIASAALTTACTRSDTTGPSDQPQASLQEGQGGTN* |
| Ga0126305_100973712 | 3300010036 | Serpentine Soil | MSRSKIYGLVLALIASAALTTACTRSDTTGPSDQPQASLQEGQGGTN* |
| Ga0126309_100017802 | 3300010039 | Serpentine Soil | MSRSKTYALVLGLLASAALSTACTRSDTTGPSDQPQASMQEGQGSGS* |
| Ga0126309_113073222 | 3300010039 | Serpentine Soil | MSRTKAYGIVMALLASAALSTACTRTDSTGPSDQQEQPSFE |
| Ga0126308_107472452 | 3300010040 | Serpentine Soil | MSRSKTYALILALLASASLSTACTRADTTGPSEPQQQQPSFENIGANN |
| Ga0126311_100010475 | 3300010045 | Serpentine Soil | MSRSKNYGLVLALIASAALTTACTRSDTTGPSDQPQASFEEGQGAHT* |
| Ga0134122_111320512 | 3300010400 | Terrestrial Soil | MSRSKTYGLVLALLASTALSTACTRTDATGPSEQPQPSFENQGANN* |
| Ga0134123_135173881 | 3300010403 | Terrestrial Soil | MSRKTYGIVLALLASAAMSTACTRTDATGPSDQAQPSFEENQGANNGK* |
| Ga0126317_105069621 | 3300011332 | Soil | MSRKTYGIVLALLASAALSTACTRTDATGPSSDQQPSFEESNGANNGK |
| Ga0126317_105079601 | 3300011332 | Soil | HTPSERDPYMSRSKIYGLVLALIASAALTTACTRSDTTGPSDQPQASFEEGQGAHT* |
| Ga0126317_105440382 | 3300011332 | Soil | VPSLTLHASAFGLALALLASAALTSACTRTDATGPSDQPQPSFENQGANN |
| Ga0127502_106419082 | 3300011333 | Soil | MSRSKTYAIALALLASAAVSTGCTRSDTTGPSAAPEASFDEAQGGNN* |
| Ga0127502_112591152 | 3300011333 | Soil | APPLNQKGTPMSRSKTYGLVLALLVSSALSAGCTRTDTTGPSEQVEPSFENQGANN* |
| Ga0137455_10171121 | 3300011429 | Soil | MTRLKTYGLVLTLLASAALSTACTRTDTTGPSEQPQASFETIGANN* |
| Ga0136631_100205762 | 3300012043 | Polar Desert Sand | MSRVKTYGLVLALLASAALSTGCTRTDATGPSEQVQPTFEGMGANN* |
| Ga0136631_103633251 | 3300012043 | Polar Desert Sand | IKTYGLVLALLASVALSTGCTRADATGPSEQVQPTFEGMGSNN* |
| Ga0136622_102721571 | 3300012187 | Polar Desert Sand | MSRVKTYGLVLTLLASAALSTGCTRTDATGPSEQVQPSFEGMGAHN |
| Ga0150985_1012480181 | 3300012212 | Avena Fatua Rhizosphere | PTPSERDLYMSRFKTYGLALALIASAALSTACTRSDTTGPSDQTQASFHEGQGPNN* |
| Ga0150985_1041978412 | 3300012212 | Avena Fatua Rhizosphere | MSRSKTYGLALALIASAALSTACTRSDTTGPSDQTQASFKEGQGPNN* |
| Ga0150985_1046459442 | 3300012212 | Avena Fatua Rhizosphere | MSRSKTYGLVLALLASAALSTACTRTDATGPSDQSQASFESQGANN* |
| Ga0150985_1112351512 | 3300012212 | Avena Fatua Rhizosphere | MSRKTYGIVLALLASAALSTACTRTDATGPSSDHAQPSFEESNGANNSK* |
| Ga0150985_1136537352 | 3300012212 | Avena Fatua Rhizosphere | MSRTKTYAIILGLLASSALSTACTRTDATGPSDQTQASFDENQGANNGK* |
| Ga0150985_1148624262 | 3300012212 | Avena Fatua Rhizosphere | KGTQMSRKTYGIVLALLASAALSTACTRTDATGPSSDQVQPSFEENNGANNGK* |
| Ga0150985_1171310962 | 3300012212 | Avena Fatua Rhizosphere | MSRSKTYGLVLALIASAALSTACTRSDTTGPSDQPQASFEEGQGAHV* |
| Ga0150985_1185015922 | 3300012212 | Avena Fatua Rhizosphere | GHHRPSERIHMSRLKTYGLALALLASAALTSACTRTDATGPSDQQQASFEEGQGGNNHH* |
| Ga0150984_1053070871 | 3300012469 | Avena Fatua Rhizosphere | TLGHHRPSERIHMSRLKTYGLALALLASAALTSACTRTDATGPSDQQQASFEEGQGGNNHH* |
| Ga0150984_1116511032 | 3300012469 | Avena Fatua Rhizosphere | MSRSKTYGLVLALLASAALSSACTRSDTTGPSDQPQASLDESQGGHN* |
| Ga0150984_1169515311 | 3300012469 | Avena Fatua Rhizosphere | TNTPLLKGTSMSRKTYGIVMALLASAALSTACTRTDATGPSDQAQPSFEEGNGSNNGK* |
| Ga0150984_1231181562 | 3300012469 | Avena Fatua Rhizosphere | SPFRKDFTMSRIKAYGLVLALLASAAVSTGCTRTDSTGPSDQAQPSFESIGANN* |
| Ga0136635_100103425 | 3300012530 | Polar Desert Sand | MSRVKTYGLVLALLASAALSTGCTRTDATGPSEQVQPTFEGMGSGN* |
| Ga0136615_100137481 | 3300012678 | Polar Desert Sand | MSRLKTYGLALALLASAALSTACTRSDATGPSEAPQASFEAQGGNN* |
| Ga0136616_101574282 | 3300012679 | Polar Desert Sand | MSRVKSYGLVLTLLATAALSTACTRTDATGPSEQVQPSFENQGANN* |
| Ga0136613_102872821 | 3300012681 | Polar Desert Sand | ALLASAALSTACTRSDATGPSEAPQASFEAQGGNN* |
| Ga0136614_100193664 | 3300012684 | Polar Desert Sand | MSRLKTYVLVLALLASASLSTACTRTDATGPSEQVQPSFEGQGSGN* |
| Ga0136614_112333571 | 3300012684 | Polar Desert Sand | KGTPMSRVKSYGLVLTLLASAALSTACTRTDATGPSEQVQPSFENQGANN* |
| Ga0157297_100585662 | 3300012914 | Soil | MSRSKTYGLALALIASAALSTACTRSDTTGPSDQTQASFQEGQG |
| Ga0137395_105538982 | 3300012917 | Vadose Zone Soil | MSRSKTYALALALLASAALSTACTRTDATGPSEQPQ |
| Ga0137407_100342115 | 3300012930 | Vadose Zone Soil | MSRTKTYAIVMALLASAALSTACTRTDATGPSDQPQPSFENQGANN* |
| Ga0164305_122297462 | 3300012989 | Soil | MSRIKSYGIVLALLASAALSTACTKTDSTGPSDQTQASFDENQGANNHK* |
| Ga0120158_101668332 | 3300013772 | Permafrost | MSRSKAYGIVFALLASAALTTACTRTDATGPSTQSSASFEEGQGANNGK* |
| Ga0157376_110583222 | 3300014969 | Miscanthus Rhizosphere | MSSSKTYGLALALIASAALSTACTRSDTTGPSDQTQASFQEGQGPNN* |
| Ga0167657_10057652 | 3300015079 | Glacier Forefield Soil | MSRLKTYGLVLALVASAALSTACTRTDATGPSEQVQPSFEGIGSNN* |
| Ga0180121_1000004237 | 3300017695 | Polar Desert Sand | MSRSKSYALVLALLASAALSTACTRTDATGPSEQVQPSFETQGSGN |
| Ga0180121_100087064 | 3300017695 | Polar Desert Sand | VKTYGLVLALLASAALSTGCTRTDATGPSEQVQPTFEGMGSGN |
| Ga0180121_100089885 | 3300017695 | Polar Desert Sand | MSRVKTYGLVLALLASAALSTGCTRTDATGPSEQVQPTFEGMGANN |
| Ga0180121_100784521 | 3300017695 | Polar Desert Sand | MSRIKTYGLVLALLASVALSTGCTRADATGPSEQVQPTFEGMGSNN |
| Ga0183260_100273536 | 3300017787 | Polar Desert Sand | MSRVKSYGLVLTLLASAALSTACTRTDATGPSEQPQVSFDEGQGANN |
| Ga0136617_1000048524 | 3300017789 | Polar Desert Sand | MSRLKTYGLALALLASAALSTACTRSDATGPSEAPQASFEAQGGNN |
| Ga0136617_100093765 | 3300017789 | Polar Desert Sand | MSRVKSYGLVLTLLASAALSTACTRTDATGPSEQVQPSFENQGANN |
| Ga0184610_10018972 | 3300017997 | Groundwater Sediment | MSRLKTYGLVLTLLASAALSTACTRTDATGPSEQVQPSFENQGANN |
| Ga0184610_10981862 | 3300017997 | Groundwater Sediment | MTRLKTYGFVLALLASAALSTACTRTDATGPSEQVQPSFDENQGANN |
| Ga0184604_100002222 | 3300018000 | Groundwater Sediment | MSRTKTYAIVMALLASAALSTACTRTDATGPSDQPQPSFEGQGANN |
| Ga0184605_100272562 | 3300018027 | Groundwater Sediment | MSRTKTCGIVMALLASAALSTACTRTDATGPSDQPQPSFDESQGANNGK |
| Ga0184605_100473122 | 3300018027 | Groundwater Sediment | MSRSKTYGLVLALLASAALSTACTRTDATGPSDQPQASFESQGANN |
| Ga0184608_100368092 | 3300018028 | Groundwater Sediment | MSRTKTYAIVMALLASAALSTACTRTDATGPSDQPQPSFENQGANN |
| Ga0184623_102170881 | 3300018056 | Groundwater Sediment | MTRLKTYGFVLALLASAALSTACTRTDATGPSEQVQPSFENQGANN |
| Ga0184637_105004422 | 3300018063 | Groundwater Sediment | EAQIGGVPTPGHHRHSERTSMSRLKTYGLVLALLASAALSTACTRTDATGPSEQVQPSFEGIGSNN |
| Ga0184609_104195352 | 3300018076 | Groundwater Sediment | MSRTKTHAIVMALLASAALSTACTRTDATGPSDQTQ |
| Ga0184633_101381022 | 3300018077 | Groundwater Sediment | LKTYGFVLALLASAALSTACTKTDTTGPSEQPQPSFESIGSNN |
| Ga0184627_100057324 | 3300018079 | Groundwater Sediment | MSRLKTYGLVLALLASAALSTACTRTDTTGPSETPQASFEAQGGNN |
| Ga0184627_100226822 | 3300018079 | Groundwater Sediment | MTRLKTYGFVLALLASAALSTACTKTDATGPSEQVQPSFDENQGANN |
| Ga0190265_1000069913 | 3300018422 | Soil | MTRLKTYGLVLTLLATAALSTACTRTDTTGPSEQPQASFETIGANN |
| Ga0190265_100559342 | 3300018422 | Soil | MSRFKTYGFVLALLASAAFSTSCTRTDATGPSEQVQPSFEGLGANN |
| Ga0190265_107329712 | 3300018422 | Soil | PMSRFKTYGLVLTLLATAALSTACTRTDSTGPSEQVQPSFTETQGANN |
| Ga0190272_100068138 | 3300018429 | Soil | MSRFKAYGLVLALIASAALSTACTRTDATGPSEQVQPSFEGQGANN |
| Ga0190272_102524072 | 3300018429 | Soil | MSRLKTYGLVLALLATGALSTACTRTDATGPSEQPQPSFESIGSNN |
| Ga0184645_10056471 | 3300019233 | Groundwater Sediment | HYQSERHPMTRLKTYGLALALVASAALSTACTRTDATGPSEQVQPSFEGQGANN |
| Ga0184645_12569271 | 3300019233 | Groundwater Sediment | PWAYRHSERTPMSRLKTYGLVLTLLASAALSTACTRTDATGPSEQVQPSFENQGANN |
| Ga0184648_13501312 | 3300019249 | Groundwater Sediment | MSRLKTYGLVLALLASAALSTACTRTDATGPSEQPQASFENIGANN |
| Ga0184646_11463291 | 3300019259 | Groundwater Sediment | RHHRHSERTPMSRLKTYGLVLALLASAALSTACTRTDATGPSEQVQPSFEGQGADN |
| Ga0184646_12207701 | 3300019259 | Groundwater Sediment | HHSERHPMTRLKTYGFVLALLASAALSTACTKTDATGPSEQVQPSFENQGANN |
| Ga0184646_12453431 | 3300019259 | Groundwater Sediment | HHQSERHPMTRLKTYGLALALVASAALSTACTRTDATGPSEQVQPSFEGQGANN |
| Ga0184646_16289541 | 3300019259 | Groundwater Sediment | HRYSERTPMSRLKTYGLVLALLASAAVSTACTRTDATGPSEQVQPSFDENQGGNN |
| Ga0184642_15842411 | 3300019279 | Groundwater Sediment | MSRSKTYGLVLALLASAALSTGCTRTDATGPSDQPQASFESQGANN |
| Ga0173481_104235771 | 3300019356 | Soil | SERDLYMSRSKTYGLALALIASAALSTACTRSDTTGPSDQTQASFQEGQGPNN |
| Ga0173479_101520822 | 3300019362 | Soil | MSRSKTYGLALALIASAALSTACTRSDTTGPSDQTQASFQEGQGPNN |
| Ga0187893_100871352 | 3300019487 | Microbial Mat On Rocks | MSRTKLYGLVLALLASAAVSTACTRTDATGPSDAPEASFNEGQGANNGK |
| Ga0193707_11208741 | 3300019881 | Soil | ALALVASAALSTACTRTDATGPSEQVQPSFEGQGANN |
| Ga0180109_13128122 | 3300020067 | Groundwater Sediment | PLLKGPPMSRLKTYGLVLTLLASAALSTACTRTDATGPSEQVQPSFDETQGANN |
| Ga0184649_12282131 | 3300020068 | Groundwater Sediment | PGHHRHSERVPMSRLKTYGVVLALVASAALSTACTRTDATGPSEQVQPSFEGQGSNN |
| Ga0184649_14411761 | 3300020068 | Groundwater Sediment | WVSPPFLKGPPMSRLKTYGLVLALVASAALSTACTRTDATGPSEQVQPSFEGQGANN |
| Ga0210381_100336662 | 3300021078 | Groundwater Sediment | MTRLKTYGLALALVASAALSTACTRTDATGPSEQVQPSFEGQGANN |
| Ga0222624_10028062 | 3300021951 | Groundwater Sediment | MSRLKTYGFVLALVASAALSTACTRTDATGPSEQVQPSFEGIGSNN |
| Ga0209751_107169162 | 3300025327 | Soil | KTYGLVLALLASAALSTACTRTDATGPSDAPQASFEAQGGNN |
| Ga0207651_117666202 | 3300025960 | Switchgrass Rhizosphere | DLYMSRSKTYGLALALIASAALSTACTRSDTTGPSDQTQASFQEGQGPNN |
| Ga0207674_107958492 | 3300026116 | Corn Rhizosphere | MSRSKTYGLALALIASAALSTACTRSDTTGPSDQTQASFQEGQGAN |
| Ga0209999_10629711 | 3300027543 | Arabidopsis Thaliana Rhizosphere | MSRMKAYGLVLALVASAALSTACTRTDATGPSEQVQPSFEGQ |
| Ga0209464_101166322 | 3300027778 | Wetland Sediment | MSRKTYGIVMALLASAALSTACTRTDATGPSDQTQPSFEENNGANNGK |
| Ga0209486_111438931 | 3300027886 | Agricultural Soil | MSRSKTYGLVMALLASAAFSGCTRSDATGPSEAPAVSFDEAQGANN |
| Ga0209382_100070042 | 3300027909 | Populus Rhizosphere | MSRPKSYGLVLALLASMALSTACTRTDATGPSEQPQASFQEGQGSNN |
| Ga0256864_10114812 | 3300027964 | Soil | MSRTKTCGLVLALVASAALSTACTRTDATGPSDAPQASFDEVQGGNNGK |
| Ga0209705_105697352 | 3300027979 | Freshwater Sediment | MSRLKTYGLVLALLASAAFSTACTRTDATGPSEQVQPSFEGMGSGN |
| Ga0268265_125252432 | 3300028380 | Switchgrass Rhizosphere | KTYGLALALIASAALSTACTRSDTTGPSDQTQASFQEGQGPNN |
| Ga0247822_100554192 | 3300028592 | Soil | MSRSKTYGLALALIASAALSTACTRSDTTGPSDQTQASFQEGQGANN |
| Ga0307298_101284842 | 3300028717 | Soil | MFMSRTKTYGLVLALLASAALSTACTRADATGPSEQPQPSFENIGSNN |
| Ga0307282_105691222 | 3300028784 | Soil | MSRTKTYAIVMALLASAALSTACTRTDATGPSDQTQASFDENQGANN |
| Ga0307302_100430312 | 3300028814 | Soil | MSRTKTYAIVMALLASAALSTACTRTDATGPSDQTQASFDENQGANNKP |
| Ga0307314_100353902 | 3300028872 | Soil | MSRTKTYGLVLALLASAALSTACTRADATGPSEQPQPSFENIGSNN |
| Ga0307300_103654951 | 3300028880 | Soil | TKTYAIVMALLASAALSTACTRTDATGPSDQPQPSFENQGANN |
| Ga0307277_101386761 | 3300028881 | Soil | MSRTKTYAIVMALLASAALSTACTRTDATGPSDQPQPSFEGQGAN |
| Ga0307277_104644242 | 3300028881 | Soil | MSRLKTYGLALALLASAALTSACTRTDATGPSDQTQASFEEGQR |
| Ga0299906_113305002 | 3300030606 | Soil | MSRTKTYALALALLASAALSTACTRTDATGPSDTPAVSFDEGQGSNNGK |
| Ga0308152_1129931 | 3300030831 | Soil | GYHHQSERHPMTRLKTYGLALALVASAALSTACTRTDATGPSEQVQPSFEGQGANN |
| Ga0308198_10145542 | 3300030904 | Soil | QSERHPMTRLKTYGLALALVASAALSTACTRTDATGPSEQVQPSFEGQGANN |
| Ga0308198_10400492 | 3300030904 | Soil | VATLKGTPMSRYKTYGIVFALLASAALTTACTRTDATGPSDQSSASFEEGQGANNGK |
| Ga0308200_10230282 | 3300030905 | Soil | MSRFKSYGIVLALLASAALTTACTRTDATGPSDQQQASFEEGQGAHN |
| Ga0308196_10068032 | 3300030989 | Soil | RIDDVPAQRHPRHSERMFMSRTKTYGLVLALLASAALSTACTRADATGPSEQPQPSFENIGSNN |
| Ga0308196_10333081 | 3300030989 | Soil | YHHQSERHPMTRLKTYGLALALVASAALSTACTRTDATGPSEQVQPSFEGQGANN |
| Ga0308178_10479592 | 3300030990 | Soil | MSRYKTYGIVFALLASAALTTACTRTDATGPSDQTNASFEEGQGSNNHH |
| Ga0308178_10801292 | 3300030990 | Soil | VTLKGMFMSRTKTYGLVLALLASAALSTACTRADATGPSEQPQPSFENIGSNN |
| Ga0308190_10536182 | 3300030993 | Soil | QFGKGPDMSRIKSYGIVLALLASAALSTACTRTDSTGPSDQTQASFDENQGANNHK |
| Ga0308190_11626251 | 3300030993 | Soil | ASERTSMSRIKTYGLVLALLASAALSTACTRTDATGPSEQVQPAFEGMGSGN |
| Ga0308189_100517202 | 3300031058 | Soil | MSRIKSYGIVLALVASAALSTACTRTDSTGPSDQTQASFEEGQGANNGK |
| Ga0308204_101323641 | 3300031092 | Soil | MSRKTYGIVMALLASAALSTACTRTDATGPSDQAQPSFEESNGANNGK |
| Ga0308197_101498351 | 3300031093 | Soil | ILKGLHMSRIKAYGLVLTLLASAALSTGCTRTDTTGPSDQAQPSFENIGANN |
| Ga0308197_103360352 | 3300031093 | Soil | QMSRTKTCGIVMALLASAALSTACTRTDATGPSDQPQPSFDESQGANNGK |
| Ga0308199_10077612 | 3300031094 | Soil | RHPRHSERMFMSRTKTYGLVLALLASAALSTACTRADATGPSEQPQPSFENIGSNN |
| Ga0308199_10296832 | 3300031094 | Soil | MSRSKTYGLVLALVASMALSTACTRTDATGPSDQQQASFEEGQGSNNHH |
| Ga0308193_10426611 | 3300031096 | Soil | LPLPERDLQMSRSKTYALVISLLASAALSTACTRTDATGPSDQTQASFDENQGANNKP |
| Ga0308187_100999542 | 3300031114 | Soil | MSRTKTCGIVMALLASAALSTACTRTDATGPSDQTQPQPSFDESQGANNGK |
| Ga0308187_103381391 | 3300031114 | Soil | HQSERHPMTRMKTYGLALALVASAALSTACTRTDATGPSEQAQPSFENQGANN |
| Ga0299913_100879124 | 3300031229 | Soil | MSRAKSFGLALALLASAALSTACTRTDATGPSEAPQASFDEAQGANN |
| Ga0308194_101382871 | 3300031421 | Soil | MSRSKTYGLVLALLASAALSTACTRTDATGPSDQQQASFESQGANN |
| Ga0308194_102693692 | 3300031421 | Soil | ALVASMALSTACTRTDATGPSDQQQASFEEGQGSNNHH |
| Ga0308179_10093632 | 3300031424 | Soil | MSRIKTYGFVLALVASAALSTACTRTDATGPSEQVQPSFEGIGSNN |
| Ga0307408_1000175802 | 3300031548 | Rhizosphere | MSRSKTYGVILALLASAALSTACTRSDTTGPSDQPQASFEEGQGAHN |
| Ga0307408_1003975862 | 3300031548 | Rhizosphere | MSRSKSYAIALALLVSAAVSTGCTRSDATGPSESEQVQPSFDESQGSGN |
| Ga0307410_100187231 | 3300031852 | Rhizosphere | MSRSKSYAIALALLVSAAVSTGCTRTDATGPSESEQVQPSFESQGSGN |
| Ga0307407_114960952 | 3300031903 | Rhizosphere | MSRSKTYAIALALLVSAAVSTGCTRTDATGPSEQVQPSFETQGSGN |
| Ga0214473_119892021 | 3300031949 | Soil | MSRLKTYGFVLALLASAAFSTACTRTDATGPSEQV |
| Ga0307416_1008666852 | 3300032002 | Rhizosphere | MSRTKINGIVMALLASAALSTACTRTDATGPSDQTQASFEESQGANNGK |
| Ga0364930_0146304_411_551 | 3300033814 | Sediment | MSRLKTYGFVLALLASAALSTACTRTDATGPSEQPQASFENIGANN |
| Ga0314796_091044_483_623 | 3300034671 | Soil | MSRSKISGLLLALLASAALSTACTRTDATGPSDQPQASFESQGANN |
| Ga0370541_032071_465_614 | 3300034680 | Soil | MSRLKTYGLALALLASAALTSACTRTDATGPSDQTQASFEEGQGGNNHH |
| Ga0370541_033354_445_594 | 3300034680 | Soil | MSRSKTYALVISLLASAALSTACTRTDATGPSDQTQASFDENQGANNKP |
| ⦗Top⦘ |