| Basic Information | |
|---|---|
| Family ID | F031101 |
| Family Type | Metagenome |
| Number of Sequences | 183 |
| Average Sequence Length | 47 residues |
| Representative Sequence | MNDLFWYSRQLREAVSTTGMENGWNDEKCKEVFDQLMDKYLVSKDLK |
| Number of Associated Samples | 99 |
| Number of Associated Scaffolds | 183 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 65.92 % |
| % of genes near scaffold ends (potentially truncated) | 25.68 % |
| % of genes from short scaffolds (< 2000 bps) | 76.50 % |
| Associated GOLD sequencing projects | 85 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.65 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (56.831 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine (44.809 % of family members) |
| Environment Ontology (ENVO) | Unclassified (56.284 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (74.317 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 50.67% β-sheet: 0.00% Coil/Unstructured: 49.33% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.65 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 183 Family Scaffolds |
|---|---|---|
| PF01521 | Fe-S_biosyn | 13.11 |
| PF02811 | PHP | 3.83 |
| PF07733 | DNA_pol3_alpha | 2.73 |
| PF13640 | 2OG-FeII_Oxy_3 | 2.19 |
| PF04973 | NMN_transporter | 2.19 |
| PF13662 | Toprim_4 | 1.64 |
| PF02945 | Endonuclease_7 | 1.64 |
| PF14579 | HHH_6 | 1.64 |
| PF01844 | HNH | 1.64 |
| PF03819 | MazG | 1.09 |
| PF02675 | AdoMet_dc | 1.09 |
| PF04488 | Gly_transf_sug | 1.09 |
| PF13578 | Methyltransf_24 | 1.09 |
| PF07235 | DUF1427 | 1.09 |
| PF10544 | T5orf172 | 0.55 |
| PF06067 | DUF932 | 0.55 |
| PF03796 | DnaB_C | 0.55 |
| PF13884 | Peptidase_S74 | 0.55 |
| PF13936 | HTH_38 | 0.55 |
| PF05711 | TylF | 0.55 |
| PF04586 | Peptidase_S78 | 0.55 |
| PF00085 | Thioredoxin | 0.55 |
| PF08282 | Hydrolase_3 | 0.55 |
| COG ID | Name | Functional Category | % Frequency in 183 Family Scaffolds |
|---|---|---|---|
| COG0316 | Fe-S cluster assembly iron-binding protein IscA | Posttranslational modification, protein turnover, chaperones [O] | 13.11 |
| COG4841 | Uncharacterized conserved protein YneR, related to HesB/YadR/YfhF family | Function unknown [S] | 13.11 |
| COG0587 | DNA polymerase III, alpha subunit | Replication, recombination and repair [L] | 2.73 |
| COG2176 | DNA polymerase III, alpha subunit (gram-positive type) | Replication, recombination and repair [L] | 2.73 |
| COG3201 | Nicotinamide riboside transporter PnuC | Coenzyme transport and metabolism [H] | 2.19 |
| COG1586 | S-adenosylmethionine decarboxylase | Amino acid transport and metabolism [E] | 1.09 |
| COG3774 | Mannosyltransferase OCH1 or related enzyme | Cell wall/membrane/envelope biogenesis [M] | 1.09 |
| COG4317 | Xanthosine utilization system component, XapX domain | Nucleotide transport and metabolism [F] | 1.09 |
| COG0305 | Replicative DNA helicase | Replication, recombination and repair [L] | 0.55 |
| COG0560 | Phosphoserine phosphatase | Amino acid transport and metabolism [E] | 0.55 |
| COG0561 | Hydroxymethylpyrimidine pyrophosphatase and other HAD family phosphatases | Coenzyme transport and metabolism [H] | 0.55 |
| COG1066 | DNA repair protein RadA/Sms, contains AAA+ ATPase domain | Replication, recombination and repair [L] | 0.55 |
| COG1877 | Trehalose-6-phosphate phosphatase | Carbohydrate transport and metabolism [G] | 0.55 |
| COG2217 | Cation-transporting P-type ATPase | Inorganic ion transport and metabolism [P] | 0.55 |
| COG3740 | Phage head maturation protease | Mobilome: prophages, transposons [X] | 0.55 |
| COG3769 | Mannosyl-3-phosphoglycerate phosphatase YedP/MpgP, HAD superfamily | Carbohydrate transport and metabolism [G] | 0.55 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 56.83 % |
| All Organisms | root | All Organisms | 43.17 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000756|JGI12421J11937_10159187 | Not Available | 552 | Open in IMG/M |
| 3300000929|NpDRAFT_10049949 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2633 | Open in IMG/M |
| 3300002835|B570J40625_100452245 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102 | 1225 | Open in IMG/M |
| 3300003490|JGI25926J51410_1062691 | Not Available | 625 | Open in IMG/M |
| 3300003493|JGI25923J51411_1018036 | All Organisms → Viruses → Predicted Viral | 1454 | Open in IMG/M |
| 3300003493|JGI25923J51411_1060641 | Not Available | 667 | Open in IMG/M |
| 3300005517|Ga0070374_10082614 | All Organisms → Viruses → Predicted Viral | 1675 | Open in IMG/M |
| 3300005517|Ga0070374_10083194 | All Organisms → Viruses → Predicted Viral | 1668 | Open in IMG/M |
| 3300005580|Ga0049083_10237009 | Not Available | 616 | Open in IMG/M |
| 3300005583|Ga0049085_10007437 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4321 | Open in IMG/M |
| 3300005584|Ga0049082_10082444 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102 | 1128 | Open in IMG/M |
| 3300005805|Ga0079957_1004238 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 11966 | Open in IMG/M |
| 3300005941|Ga0070743_10206180 | Not Available | 644 | Open in IMG/M |
| 3300005941|Ga0070743_10206181 | Not Available | 644 | Open in IMG/M |
| 3300005941|Ga0070743_10245930 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 582 | Open in IMG/M |
| 3300005942|Ga0070742_10166002 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 615 | Open in IMG/M |
| 3300005955|Ga0073922_1056357 | Not Available | 506 | Open in IMG/M |
| 3300006484|Ga0070744_10000666 | Not Available | 10049 | Open in IMG/M |
| 3300006484|Ga0070744_10000976 | Not Available | 8474 | Open in IMG/M |
| 3300006484|Ga0070744_10002116 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5989 | Open in IMG/M |
| 3300006484|Ga0070744_10002280 | Not Available | 5802 | Open in IMG/M |
| 3300006484|Ga0070744_10005543 | Not Available | 3790 | Open in IMG/M |
| 3300006484|Ga0070744_10016784 | All Organisms → Viruses → Predicted Viral | 2175 | Open in IMG/M |
| 3300006484|Ga0070744_10017183 | Not Available | 2147 | Open in IMG/M |
| 3300006484|Ga0070744_10044114 | All Organisms → Viruses → Predicted Viral | 1309 | Open in IMG/M |
| 3300006484|Ga0070744_10048002 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102 | 1253 | Open in IMG/M |
| 3300006484|Ga0070744_10059690 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Sinorhizobium phage phiM6 | 1113 | Open in IMG/M |
| 3300006484|Ga0070744_10073012 | Not Available | 996 | Open in IMG/M |
| 3300006484|Ga0070744_10097038 | Not Available | 852 | Open in IMG/M |
| 3300006484|Ga0070744_10146881 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 677 | Open in IMG/M |
| 3300006484|Ga0070744_10161852 | Not Available | 641 | Open in IMG/M |
| 3300006484|Ga0070744_10181676 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 600 | Open in IMG/M |
| 3300006484|Ga0070744_10222982 | Not Available | 535 | Open in IMG/M |
| 3300006484|Ga0070744_10228342 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 528 | Open in IMG/M |
| 3300006484|Ga0070744_10236390 | Not Available | 517 | Open in IMG/M |
| 3300007544|Ga0102861_1016061 | Not Available | 1831 | Open in IMG/M |
| 3300007544|Ga0102861_1109117 | Not Available | 741 | Open in IMG/M |
| 3300007545|Ga0102873_1015889 | Not Available | 2321 | Open in IMG/M |
| 3300007545|Ga0102873_1210382 | Not Available | 584 | Open in IMG/M |
| 3300007547|Ga0102875_1019817 | Not Available | 2233 | Open in IMG/M |
| 3300007548|Ga0102877_1052917 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1173 | Open in IMG/M |
| 3300007549|Ga0102879_1239351 | Not Available | 543 | Open in IMG/M |
| 3300007550|Ga0102880_1005484 | Not Available | 3603 | Open in IMG/M |
| 3300007550|Ga0102880_1051526 | Not Available | 1099 | Open in IMG/M |
| 3300007550|Ga0102880_1210858 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102 | 507 | Open in IMG/M |
| 3300007558|Ga0102822_1047434 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1020 | Open in IMG/M |
| 3300007559|Ga0102828_1089212 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 744 | Open in IMG/M |
| 3300007559|Ga0102828_1111012 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 671 | Open in IMG/M |
| 3300007560|Ga0102913_1291358 | Not Available | 521 | Open in IMG/M |
| 3300007561|Ga0102914_1131802 | Not Available | 775 | Open in IMG/M |
| 3300007562|Ga0102915_1045670 | Not Available | 1445 | Open in IMG/M |
| 3300007562|Ga0102915_1211835 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 629 | Open in IMG/M |
| 3300007562|Ga0102915_1211837 | Not Available | 629 | Open in IMG/M |
| 3300007562|Ga0102915_1278117 | Not Available | 541 | Open in IMG/M |
| 3300007593|Ga0102918_1131683 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 751 | Open in IMG/M |
| 3300007593|Ga0102918_1212867 | Not Available | 589 | Open in IMG/M |
| 3300007600|Ga0102920_1294341 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 523 | Open in IMG/M |
| 3300007603|Ga0102921_1270595 | Not Available | 607 | Open in IMG/M |
| 3300007617|Ga0102897_1237026 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 540 | Open in IMG/M |
| 3300007620|Ga0102871_1138542 | Not Available | 689 | Open in IMG/M |
| 3300007621|Ga0102872_1099528 | Not Available | 780 | Open in IMG/M |
| 3300007621|Ga0102872_1127548 | Not Available | 678 | Open in IMG/M |
| 3300007624|Ga0102878_1072320 | Not Available | 1037 | Open in IMG/M |
| 3300007625|Ga0102870_1052703 | Not Available | 1207 | Open in IMG/M |
| 3300007632|Ga0102894_1127348 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102 | 673 | Open in IMG/M |
| 3300007639|Ga0102865_1148486 | Not Available | 701 | Open in IMG/M |
| 3300007639|Ga0102865_1196847 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 601 | Open in IMG/M |
| 3300007639|Ga0102865_1205368 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 588 | Open in IMG/M |
| 3300007642|Ga0102876_1183785 | Not Available | 556 | Open in IMG/M |
| 3300007642|Ga0102876_1208913 | Not Available | 516 | Open in IMG/M |
| 3300007649|Ga0102912_1068094 | Not Available | 1030 | Open in IMG/M |
| 3300007658|Ga0102898_1060596 | Not Available | 859 | Open in IMG/M |
| 3300007670|Ga0102862_1132896 | Not Available | 632 | Open in IMG/M |
| 3300007716|Ga0102867_1138554 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 656 | Open in IMG/M |
| 3300007861|Ga0105736_1116017 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 592 | Open in IMG/M |
| 3300007973|Ga0105746_1254441 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 605 | Open in IMG/M |
| 3300007974|Ga0105747_1229667 | Not Available | 617 | Open in IMG/M |
| 3300007974|Ga0105747_1262958 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 579 | Open in IMG/M |
| 3300007992|Ga0105748_10213703 | Not Available | 804 | Open in IMG/M |
| 3300008021|Ga0102922_1275423 | Not Available | 527 | Open in IMG/M |
| 3300008055|Ga0108970_10395255 | Not Available | 741 | Open in IMG/M |
| 3300008055|Ga0108970_10822275 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1280 | Open in IMG/M |
| 3300008055|Ga0108970_11771344 | Not Available | 1211 | Open in IMG/M |
| 3300008261|Ga0114336_1025206 | Not Available | 4254 | Open in IMG/M |
| 3300008964|Ga0102889_1024681 | Not Available | 1893 | Open in IMG/M |
| 3300008964|Ga0102889_1139861 | Not Available | 711 | Open in IMG/M |
| 3300008996|Ga0102831_1118215 | Not Available | 881 | Open in IMG/M |
| 3300009026|Ga0102829_1014870 | Not Available | 2178 | Open in IMG/M |
| 3300009026|Ga0102829_1095767 | Not Available | 923 | Open in IMG/M |
| 3300009026|Ga0102829_1294922 | Not Available | 539 | Open in IMG/M |
| 3300009049|Ga0102911_1030993 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102 | 1587 | Open in IMG/M |
| 3300009051|Ga0102864_1145366 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 648 | Open in IMG/M |
| 3300009056|Ga0102860_1025281 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1544 | Open in IMG/M |
| 3300009059|Ga0102830_1178656 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 621 | Open in IMG/M |
| 3300009059|Ga0102830_1230914 | Not Available | 541 | Open in IMG/M |
| 3300009086|Ga0102812_10465671 | Not Available | 690 | Open in IMG/M |
| 3300010312|Ga0102883_1059534 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102 | 1127 | Open in IMG/M |
| 3300012000|Ga0119951_1005894 | Not Available | 5715 | Open in IMG/M |
| 3300013092|Ga0163199_1070741 | All Organisms → Viruses → Predicted Viral | 1523 | Open in IMG/M |
| 3300017761|Ga0181356_1147233 | Not Available | 732 | Open in IMG/M |
| 3300017761|Ga0181356_1173755 | Not Available | 654 | Open in IMG/M |
| 3300017774|Ga0181358_1070257 | Not Available | 1293 | Open in IMG/M |
| 3300019784|Ga0181359_1004933 | All Organisms → Viruses → Predicted Viral | 4289 | Open in IMG/M |
| 3300020527|Ga0208232_1021958 | Not Available | 907 | Open in IMG/M |
| 3300020562|Ga0208597_1019477 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1578 | Open in IMG/M |
| 3300023174|Ga0214921_10004273 | Not Available | 21137 | Open in IMG/M |
| 3300023174|Ga0214921_10162883 | All Organisms → Viruses → Predicted Viral | 1480 | Open in IMG/M |
| 3300023184|Ga0214919_10001523 | Not Available | 37703 | Open in IMG/M |
| 3300023184|Ga0214919_10215102 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1422 | Open in IMG/M |
| 3300024343|Ga0244777_10011036 | Not Available | 5740 | Open in IMG/M |
| 3300024343|Ga0244777_10057727 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102 | 2486 | Open in IMG/M |
| 3300024343|Ga0244777_10091830 | Not Available | 1958 | Open in IMG/M |
| 3300024343|Ga0244777_10108449 | Not Available | 1793 | Open in IMG/M |
| 3300024343|Ga0244777_10166974 | All Organisms → Viruses → Predicted Viral | 1419 | Open in IMG/M |
| 3300024343|Ga0244777_10317801 | Not Available | 981 | Open in IMG/M |
| 3300024343|Ga0244777_10403071 | Not Available | 852 | Open in IMG/M |
| 3300024343|Ga0244777_10453026 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 793 | Open in IMG/M |
| 3300024346|Ga0244775_10001852 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 23787 | Open in IMG/M |
| 3300024346|Ga0244775_10007085 | Not Available | 11060 | Open in IMG/M |
| 3300024346|Ga0244775_10012800 | Not Available | 7897 | Open in IMG/M |
| 3300024346|Ga0244775_10015313 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 7124 | Open in IMG/M |
| 3300024346|Ga0244775_10015778 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae → Samistivirus → Streptomyces virus Jay2Jay | 7008 | Open in IMG/M |
| 3300024346|Ga0244775_10018895 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102 | 6326 | Open in IMG/M |
| 3300024346|Ga0244775_10050870 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102 | 3607 | Open in IMG/M |
| 3300024346|Ga0244775_10055352 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3441 | Open in IMG/M |
| 3300024346|Ga0244775_10108769 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2354 | Open in IMG/M |
| 3300024346|Ga0244775_10117877 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102 | 2250 | Open in IMG/M |
| 3300024346|Ga0244775_10121226 | All Organisms → Viruses → Predicted Viral | 2216 | Open in IMG/M |
| 3300024346|Ga0244775_10121318 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2215 | Open in IMG/M |
| 3300024346|Ga0244775_10248540 | All Organisms → Viruses → Predicted Viral | 1482 | Open in IMG/M |
| 3300024346|Ga0244775_10325812 | Not Available | 1271 | Open in IMG/M |
| 3300024346|Ga0244775_10375441 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Sinorhizobium phage phiM6 | 1171 | Open in IMG/M |
| 3300024346|Ga0244775_10410795 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1113 | Open in IMG/M |
| 3300024346|Ga0244775_10447961 | Not Available | 1058 | Open in IMG/M |
| 3300024346|Ga0244775_10494862 | Not Available | 999 | Open in IMG/M |
| 3300024346|Ga0244775_10859955 | Not Available | 722 | Open in IMG/M |
| 3300024346|Ga0244775_11175988 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 598 | Open in IMG/M |
| 3300024348|Ga0244776_10071063 | Not Available | 2660 | Open in IMG/M |
| 3300024348|Ga0244776_10289343 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1124 | Open in IMG/M |
| 3300024348|Ga0244776_10761412 | Not Available | 590 | Open in IMG/M |
| 3300024348|Ga0244776_10863860 | Not Available | 540 | Open in IMG/M |
| 3300025307|Ga0208566_1128725 | Not Available | 724 | Open in IMG/M |
| 3300027084|Ga0208443_1060051 | Not Available | 782 | Open in IMG/M |
| 3300027121|Ga0255074_1041282 | Not Available | 573 | Open in IMG/M |
| 3300027121|Ga0255074_1053433 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 501 | Open in IMG/M |
| 3300027123|Ga0255090_1040013 | Not Available | 725 | Open in IMG/M |
| 3300027129|Ga0255067_1019912 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 993 | Open in IMG/M |
| 3300027139|Ga0255082_1019495 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1132 | Open in IMG/M |
| 3300027142|Ga0255065_1079988 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 558 | Open in IMG/M |
| 3300027197|Ga0208922_1019842 | All Organisms → Viruses → Predicted Viral | 1222 | Open in IMG/M |
| 3300027214|Ga0208306_1077742 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 551 | Open in IMG/M |
| 3300027219|Ga0208167_1033770 | Not Available | 905 | Open in IMG/M |
| 3300027222|Ga0208024_1086677 | Not Available | 538 | Open in IMG/M |
| 3300027242|Ga0208806_1041432 | Not Available | 924 | Open in IMG/M |
| 3300027242|Ga0208806_1088364 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102 | 563 | Open in IMG/M |
| 3300027260|Ga0208027_1006442 | Not Available | 2435 | Open in IMG/M |
| 3300027260|Ga0208027_1039732 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 961 | Open in IMG/M |
| 3300027311|Ga0208812_1079980 | Not Available | 653 | Open in IMG/M |
| 3300027320|Ga0208923_1018435 | All Organisms → Viruses → Predicted Viral | 1230 | Open in IMG/M |
| 3300027320|Ga0208923_1061190 | Not Available | 668 | Open in IMG/M |
| 3300027320|Ga0208923_1068083 | Not Available | 631 | Open in IMG/M |
| 3300027418|Ga0208022_1056660 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 854 | Open in IMG/M |
| 3300027529|Ga0255077_1018947 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1240 | Open in IMG/M |
| 3300027563|Ga0209552_1054975 | Not Available | 1123 | Open in IMG/M |
| 3300027571|Ga0208897_1000282 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 24311 | Open in IMG/M |
| 3300027581|Ga0209651_1148353 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 637 | Open in IMG/M |
| 3300027586|Ga0208966_1000092 | Not Available | 27611 | Open in IMG/M |
| 3300027627|Ga0208942_1095849 | Not Available | 849 | Open in IMG/M |
| 3300027631|Ga0208133_1014049 | Not Available | 2145 | Open in IMG/M |
| 3300027631|Ga0208133_1055939 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 948 | Open in IMG/M |
| 3300027631|Ga0208133_1143559 | Not Available | 551 | Open in IMG/M |
| 3300027644|Ga0209356_1067802 | Not Available | 1082 | Open in IMG/M |
| 3300027644|Ga0209356_1200251 | Not Available | 539 | Open in IMG/M |
| 3300027656|Ga0209357_1071343 | Not Available | 1035 | Open in IMG/M |
| 3300027689|Ga0209551_1011323 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3090 | Open in IMG/M |
| 3300027744|Ga0209355_1346735 | Not Available | 547 | Open in IMG/M |
| 3300027751|Ga0208304_10115415 | Not Available | 1003 | Open in IMG/M |
| 3300027756|Ga0209444_10160994 | Not Available | 850 | Open in IMG/M |
| 3300027797|Ga0209107_10079927 | All Organisms → Viruses → Predicted Viral | 1785 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 44.81% |
| Estuarine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine | 25.14% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 9.29% |
| Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 3.83% |
| Estuary Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water | 3.83% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 3.28% |
| Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 2.73% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 1.64% |
| Estuary | Host-Associated → Plants → Leaf → Unclassified → Unclassified → Estuary | 1.64% |
| Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater And Sediment | 1.09% |
| Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 0.55% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 0.55% |
| Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Lake | 0.55% |
| Freshwater And Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Freshwater And Marine | 0.55% |
| Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Sand | 0.55% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000756 | Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB hypolimnion July 2011 | Environmental | Open in IMG/M |
| 3300000929 | Marine plume microbial communities from the Columbia River - 15 PSU | Environmental | Open in IMG/M |
| 3300002835 | Freshwater microbial communities from Lake Mendota, WI - (Lake Mendota Combined Ray assembly, ASSEMBLY_DATE=20140605) | Environmental | Open in IMG/M |
| 3300003490 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM110.SN | Environmental | Open in IMG/M |
| 3300003493 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.SN | Environmental | Open in IMG/M |
| 3300005517 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (version 4) | Environmental | Open in IMG/M |
| 3300005580 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG MI27MSRF | Environmental | Open in IMG/M |
| 3300005583 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG SU08MSRF | Environmental | Open in IMG/M |
| 3300005584 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG HU45MSRF | Environmental | Open in IMG/M |
| 3300005805 | Microbial and algae communities from Cheney Reservoir in Wichita, Kansas, USA | Environmental | Open in IMG/M |
| 3300005941 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.697 | Environmental | Open in IMG/M |
| 3300005942 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.757 | Environmental | Open in IMG/M |
| 3300005955 | Groundwater microbial communities from the Columbia River, Washington, USA, for microbe roles in carbon and contaminant biogeochemistry - GW-RW metaG T2_23-Sept-14 | Environmental | Open in IMG/M |
| 3300006484 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.535 | Environmental | Open in IMG/M |
| 3300007544 | Estuarine microbial communities from the Columbia River estuary - metaG 1449B-3 | Environmental | Open in IMG/M |
| 3300007545 | Estuarine microbial communities from the Columbia River estuary - metaG 1547B-3 | Environmental | Open in IMG/M |
| 3300007547 | Estuarine microbial communities from the Columbia River estuary - metaG 1547B-02 | Environmental | Open in IMG/M |
| 3300007548 | Estuarine microbial communities from the Columbia River estuary - metaG 1548B-3 | Environmental | Open in IMG/M |
| 3300007549 | Estuarine microbial communities from the Columbia River estuary - metaG 1548B-02 | Environmental | Open in IMG/M |
| 3300007550 | Estuarine microbial communities from the Columbia River estuary - metaG 1549A-3 | Environmental | Open in IMG/M |
| 3300007558 | Estuarine microbial communities from the Columbia River estuary - Flood tide non-ETM metaG S.733 | Environmental | Open in IMG/M |
| 3300007559 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.541 | Environmental | Open in IMG/M |
| 3300007560 | Estuarine microbial communities from the Columbia River estuary - metaG 1560A-02 | Environmental | Open in IMG/M |
| 3300007561 | Estuarine microbial communities from the Columbia River estuary - metaG 1561A-3 | Environmental | Open in IMG/M |
| 3300007562 | Estuarine microbial communities from the Columbia River estuary - metaG 1561A-02 | Environmental | Open in IMG/M |
| 3300007593 | Estuarine microbial communities from the Columbia River estuary - metaG 1563A-3 | Environmental | Open in IMG/M |
| 3300007600 | Estuarine microbial communities from the Columbia River estuary - metaG 1568A-3 | Environmental | Open in IMG/M |
| 3300007603 | Estuarine microbial communities from the Columbia River estuary - metaG 1568-02 | Environmental | Open in IMG/M |
| 3300007617 | Estuarine microbial communities from the Columbia River estuary - metaG 1554B-02 | Environmental | Open in IMG/M |
| 3300007620 | Estuarine microbial communities from the Columbia River estuary - metaG 1546C-02 | Environmental | Open in IMG/M |
| 3300007621 | Estuarine microbial communities from the Columbia River estuary - metaG 1547A-3 | Environmental | Open in IMG/M |
| 3300007624 | Estuarine microbial communities from the Columbia River estuary - metaG 1548A-02 | Environmental | Open in IMG/M |
| 3300007625 | Estuarine microbial communities from the Columbia River estuary - metaG 1546B-02 | Environmental | Open in IMG/M |
| 3300007632 | Estuarine microbial communities from the Columbia River estuary - metaG 1554A-3 | Environmental | Open in IMG/M |
| 3300007639 | Estuarine microbial communities from the Columbia River estuary - metaG 1449C-02 | Environmental | Open in IMG/M |
| 3300007642 | Estuarine microbial communities from the Columbia River estuary - metaG 1548A-3 | Environmental | Open in IMG/M |
| 3300007649 | Estuarine microbial communities from the Columbia River estuary - metaG 1560A-3 | Environmental | Open in IMG/M |
| 3300007658 | Estuarine microbial communities from the Columbia River estuary - metaG 1555A-3 | Environmental | Open in IMG/M |
| 3300007670 | Estuarine microbial communities from the Columbia River estuary - metaG 1449C-3 | Environmental | Open in IMG/M |
| 3300007716 | Estuarine microbial communities from the Columbia River estuary - metaG 1546B-3 | Environmental | Open in IMG/M |
| 3300007861 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1372B_3um | Environmental | Open in IMG/M |
| 3300007972 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460ABC_3.0um | Environmental | Open in IMG/M |
| 3300007973 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460A_0.2um | Environmental | Open in IMG/M |
| 3300007974 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460C_0.2um | Environmental | Open in IMG/M |
| 3300007992 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1461AB_0.2um | Environmental | Open in IMG/M |
| 3300008021 | Estuarine microbial communities from the Columbia River estuary - metaG 1569A-3 | Environmental | Open in IMG/M |
| 3300008055 | Metatranscriptomes of the Eelgrass leaves and roots. Combined Assembly of Gp0128390, Gp0128391, Gp0128392, and Gp0128393 | Host-Associated | Open in IMG/M |
| 3300008261 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0024-C-NA | Environmental | Open in IMG/M |
| 3300008964 | Estuarine microbial communities from the Columbia River estuary - metaG 1551A-02 | Environmental | Open in IMG/M |
| 3300008996 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.747 | Environmental | Open in IMG/M |
| 3300009026 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.575 | Environmental | Open in IMG/M |
| 3300009049 | Estuarine microbial communities from the Columbia River estuary - metaG 1558A-02 | Environmental | Open in IMG/M |
| 3300009051 | Estuarine microbial communities from the Columbia River estuary - metaG 1449B-02 | Environmental | Open in IMG/M |
| 3300009056 | Estuarine microbial communities from the Columbia River estuary - metaG 1449A-3 | Environmental | Open in IMG/M |
| 3300009059 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.703 | Environmental | Open in IMG/M |
| 3300009086 | Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.713 | Environmental | Open in IMG/M |
| 3300010312 | Estuarine microbial communities from the Columbia River estuary - metaG 1549B-02 | Environmental | Open in IMG/M |
| 3300012000 | Freshwater microbial communities from Lake Lanier in Georgia, USA - LL_1007A | Environmental | Open in IMG/M |
| 3300013092 | Freshwater microbial communities from Powell Lake, British Columbia, Canada to study Microbial Dark Matter (Phase II) - PL_2010_150m | Environmental | Open in IMG/M |
| 3300017761 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.N | Environmental | Open in IMG/M |
| 3300017774 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.D | Environmental | Open in IMG/M |
| 3300019784 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.D | Environmental | Open in IMG/M |
| 3300020527 | Freshwater microbial communities from Lake Mendota, WI - 24AUG2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020562 | Freshwater microbial communities from Lake Mendota, WI - 05MAY2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300023174 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1505 | Environmental | Open in IMG/M |
| 3300023184 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1503 | Environmental | Open in IMG/M |
| 3300024343 | Combined assembly of estuarine microbial communities from Columbia River, Washington, USA >3um size fraction | Environmental | Open in IMG/M |
| 3300024346 | Whole water sample coassembly | Environmental | Open in IMG/M |
| 3300024348 | 0.2um to 3um size fraction coassembly | Environmental | Open in IMG/M |
| 3300025307 | Freshwater microbial communities from Powell Lake, British Columbia, Canada to study Microbial Dark Matter (Phase II) - PL_2010_150m (SPAdes) | Environmental | Open in IMG/M |
| 3300027084 | Estuarine microbial communities from the Columbia River estuary - metaG 1554A-02 (SPAdes) | Environmental | Open in IMG/M |
| 3300027121 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Yuk_RepC_8h | Environmental | Open in IMG/M |
| 3300027123 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Yuk_RepA_8d | Environmental | Open in IMG/M |
| 3300027129 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Cont_RepB_8h | Environmental | Open in IMG/M |
| 3300027139 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Colum_RepB_8h | Environmental | Open in IMG/M |
| 3300027142 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Cont_RepC_0h | Environmental | Open in IMG/M |
| 3300027197 | Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.743 (SPAdes) | Environmental | Open in IMG/M |
| 3300027214 | Estuarine microbial communities from the Columbia River estuary - metaG 1449A-02 (SPAdes) | Environmental | Open in IMG/M |
| 3300027219 | Estuarine microbial communities from the Columbia River estuary - metaG 1546A-02 (SPAdes) | Environmental | Open in IMG/M |
| 3300027222 | Estuarine microbial communities from the Columbia River estuary - metaG 1546B-02 (SPAdes) | Environmental | Open in IMG/M |
| 3300027242 | Estuarine microbial communities from the Columbia River estuary - metaG 1554B-02 (SPAdes) | Environmental | Open in IMG/M |
| 3300027260 | Estuarine microbial communities from the Columbia River estuary - metaG 1563A-02 (SPAdes) | Environmental | Open in IMG/M |
| 3300027311 | Estuarine microbial communities from the Columbia River estuary - metaG 1569-02 (SPAdes) | Environmental | Open in IMG/M |
| 3300027320 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.575 (SPAdes) | Environmental | Open in IMG/M |
| 3300027418 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.747 (SPAdes) | Environmental | Open in IMG/M |
| 3300027529 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Law_RepC_8h | Environmental | Open in IMG/M |
| 3300027563 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.SD (SPAdes) | Environmental | Open in IMG/M |
| 3300027571 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.697 (SPAdes) | Environmental | Open in IMG/M |
| 3300027581 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM110.SN (SPAdes) | Environmental | Open in IMG/M |
| 3300027586 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG HU45MSRF (SPAdes) | Environmental | Open in IMG/M |
| 3300027627 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG SU08MSRF (SPAdes) | Environmental | Open in IMG/M |
| 3300027631 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.535 (SPAdes) | Environmental | Open in IMG/M |
| 3300027644 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.SN (SPAdes) | Environmental | Open in IMG/M |
| 3300027656 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM110.SD (SPAdes) | Environmental | Open in IMG/M |
| 3300027689 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SD (SPAdes) | Environmental | Open in IMG/M |
| 3300027744 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.SN (SPAdes) | Environmental | Open in IMG/M |
| 3300027751 | Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.713 (SPAdes) | Environmental | Open in IMG/M |
| 3300027756 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.DN (SPAdes) | Environmental | Open in IMG/M |
| 3300027797 | Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB hypolimnion July 2011 (SPAdes) | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI12421J11937_101591873 | 3300000756 | Freshwater And Sediment | MNDLFWYSRKLREAVSTTGMENGWNDEKCKEVFDDLMDKY |
| NpDRAFT_100499493 | 3300000929 | Freshwater And Marine | MNDLFWYSRQLREAVSTTGMENGWDNDKCKEVFDELMDKYLVSKDLK* |
| B570J40625_1004522451 | 3300002835 | Freshwater | MNDLFWYKIKLREAVSATGMENGWSNEKCKEVFDQLMDKYLVSKNLK* |
| JGI25926J51410_10626912 | 3300003490 | Freshwater Lake | MNDLFWYSRQLREAVSTTGMENGWNDEKCKEVFDQLMDKYLVSKDLK* |
| JGI25923J51411_10180363 | 3300003493 | Freshwater Lake | MNDLFWYSRQLREAVSNTGMENGWNDEKCKEVFDNLMDKYLVSKDLK* |
| JGI25923J51411_10606412 | 3300003493 | Freshwater Lake | MNDLFWYSRQLREAVSTTGMENGWNDEKCKEVFDQLMDKYLVSKDLR* |
| Ga0070374_100826142 | 3300005517 | Freshwater Lake | MSWGILMNDLFWYSRQLREAVSTTGMENGWNDEKCKEVFDQLMDKYLVSKDLK* |
| Ga0070374_100831943 | 3300005517 | Freshwater Lake | MNDLFWYSRQLREAVSTTGMENGWNNEKCKEVFDQLMDKYLVSKDLK* |
| Ga0049083_102370091 | 3300005580 | Freshwater Lentic | MNDLFWYSRKLREAVSTTGMENGWNDEKCKEVFDQLMDKYLVSKD |
| Ga0049085_100074375 | 3300005583 | Freshwater Lentic | MNDLFWYGRQLREAVSTTGMENGWNDEKCKEVFDQMMDKYLVDKDLK* |
| Ga0049082_100824444 | 3300005584 | Freshwater Lentic | MNELFWYSRQLKEAVSTTAMENGWNDAKCKEVFDELMEKYLVSKDLK* |
| Ga0079957_100423830 | 3300005805 | Lake | MNELFWYSRQLREAVSTTGMENGWTDDKCKEVFDELMDKYLVSKDLK* |
| Ga0070743_102061803 | 3300005941 | Estuarine | MNDLFWYSRQLREAVSTTGMENGWNDEKCKEVFDQLMDKYLVSKGLE* |
| Ga0070743_102061813 | 3300005941 | Estuarine | MNDLFWYSRKLREAVSTTGMENGWNDEKCKEVFDQLMDKYLVSKGLE* |
| Ga0070743_102459302 | 3300005941 | Estuarine | MNDLFWYSRKLREAVSTTGMENGWDDAKCKEVFDELMDKYLISKDLK* |
| Ga0070742_101660023 | 3300005942 | Estuarine | FWYSRQLKEAVSTTAMENGWNDAKCKEVFDELMDKYLISKDLK* |
| Ga0073922_10563572 | 3300005955 | Sand | MNNLFWYSRQLREAVSTTGMENGWNDEKCKEVFDQLMDKYLVSKGLK* |
| Ga0070744_1000066614 | 3300006484 | Estuarine | MNELFWYSRQLKEAVSTTAMENGWSDEKCKEVFDKLMDKYLISKGLK* |
| Ga0070744_1000097612 | 3300006484 | Estuarine | MNDLFWYKIKLREAVSTTGMENGWDDEKCKEVFDQLMGKYLVSKGLK* |
| Ga0070744_1000211614 | 3300006484 | Estuarine | MNDLFWYSRKLREAVSTTGMENGWDDEKCKEVFDQLMDKYLVSKDLK* |
| Ga0070744_1000228016 | 3300006484 | Estuarine | MNELFWYSRQLREAVSTTGMENGWNDAKCKEVFDELMDKYLISKGLK* |
| Ga0070744_100055434 | 3300006484 | Estuarine | MNDLFWYKIKLREAVSTTGMENGWSDEKCKEVFDQLMDKYLVSKDLK* |
| Ga0070744_100167842 | 3300006484 | Estuarine | MNELFWYSRQLREAVSTTGMENGWNDAKCKEVFDSLMDKYLVSKDLK* |
| Ga0070744_100171832 | 3300006484 | Estuarine | MNDIFWYKIKLREAISTTAMENGWDNEKCKEVFDSLMNQYLASRGLE* |
| Ga0070744_100441144 | 3300006484 | Estuarine | MNDLFWYSRQLREAVSTTGMENGWNDAKCKEVFDELMDKYLISKDLK* |
| Ga0070744_100480021 | 3300006484 | Estuarine | MNKLFWYSRQLREAVSTTGMENGWNDAKCKEVFDELMDKYLVSKDLK* |
| Ga0070744_100596901 | 3300006484 | Estuarine | MNELFWYSRQLKEAVSTTAMENGWNDAKCKEVFDQLMDKYLISKDLK*HVQSMDATMN* |
| Ga0070744_100730124 | 3300006484 | Estuarine | MNDLFWYSRQLREAVSTTGMENGWNDEKCKEVFDELMDRYLVSKGLK* |
| Ga0070744_100970382 | 3300006484 | Estuarine | MNDLFWYKIKLREAVSTTGMENGWDDEKCKEVFDSLMNKYLVSRGLE* |
| Ga0070744_101468811 | 3300006484 | Estuarine | ELFWYSRQLREAVSTTGMENGWNDAKCKEVFDKLMDKYLVSKDLK* |
| Ga0070744_101618522 | 3300006484 | Estuarine | MNELFWYSRQLKEAVSTTAMENGWDNAKCKEVFDELMDKYLISKDLK* |
| Ga0070744_101816761 | 3300006484 | Estuarine | KRMHGRILMNDLFWYKIKLREAVSTTGMENGWDDEKCKEVFDQLMDKYLVSKDLK* |
| Ga0070744_102229822 | 3300006484 | Estuarine | MNDLFWYSRQLREAVSTTGMENGWSDEKCKEVFDQLMDKYLVSKDLK* |
| Ga0070744_102283422 | 3300006484 | Estuarine | MNDLFWYKIKLREAVSTTGMENGWNDEKCKEVFDQLMDKYLASKGLK* |
| Ga0070744_102363903 | 3300006484 | Estuarine | MNELFWYSRQLREAVSTTGMENGWNDAKCKEVFDKLMDKYLISKGLK* |
| Ga0102861_10160615 | 3300007544 | Estuarine | MNELFWYSRQLREAVSTTGMENGWNDDKCKEVFDELMDKYLVSKDLK* |
| Ga0102861_11091172 | 3300007544 | Estuarine | MNDLFWYSRKLREAVATTGMENGWDNEKCKEVFDELMDKYLVSKGLE* |
| Ga0102873_10158892 | 3300007545 | Estuarine | MNDIFWYKIKLREAVSTTAMENGWDNEKCKEVFDSLMNQYLASRGLE* |
| Ga0102873_12103821 | 3300007545 | Estuarine | MNDLFWYSRQLREAVSTTGMENGWNDEKCKEVFDELMDKYLVSKDLK* |
| Ga0102875_10198174 | 3300007547 | Estuarine | MNDLFWYKIKLREAVSTTGMENGWDDAKCKEVFDQLMDK |
| Ga0102877_10529171 | 3300007548 | Estuarine | DLFWYSRKLREAVSTTGMENGWNDEKCKEVFDKLMDKYLISKGLS* |
| Ga0102879_12393512 | 3300007549 | Estuarine | MNDLFWYSRQLREAVSTTGMENGWNDEKCKEVFDQLMDKYLVSKGLK* |
| Ga0102880_10054843 | 3300007550 | Estuarine | MNDIFCYKIKLREAVSTTAMENGWDNEKCKEVFDSLMNQYLASRGLE* |
| Ga0102880_10515261 | 3300007550 | Estuarine | MNDLFWYSRQLREAVSTTGMENGWDNEKCKEVFDKLMDKYLISKGLS* |
| Ga0102880_12108582 | 3300007550 | Estuarine | MNELFWYSRQLKEAVSTTAMENGWNDAKCKEVFDQLMEKYLVSKDIK* |
| Ga0102822_10474341 | 3300007558 | Estuarine | MYGWILMNDLFWYSRQLREAVSTTGMENGWNDEKCKEVFDQLMDKYLVSKGLE* |
| Ga0102828_10892124 | 3300007559 | Estuarine | WYSRQLKEAVSTTAMENGWNDEKCKEVFDQLMDKYLVDKDLK* |
| Ga0102828_11110124 | 3300007559 | Estuarine | LFWYSRQLREAVSTTGMENGWDNDKCKEVFDELMDKYLVSKGLE* |
| Ga0102913_12913582 | 3300007560 | Estuarine | MNDLFWYSRKLREAVSTTGMENGWDNEKCKEVFDELMDKYLVSKGLE* |
| Ga0102914_11318021 | 3300007561 | Estuarine | MNDLFWYSRQLREAVSTTGMENGWNDEKCKEVFDQLMDKY |
| Ga0102915_10456703 | 3300007562 | Estuarine | MNELFWYSRQLREAVSTTGMENGWNDAKCKEVFDELMDKYLVSKDLK* |
| Ga0102915_12118354 | 3300007562 | Estuarine | MPWGILMNDLFWYSRKLREAVSTTGMENGWNDEKCKEVFDQLMDKYLVSKGLE* |
| Ga0102915_12118373 | 3300007562 | Estuarine | MNDLFWYSRQLREAVSTTGMENGWDNEKCKEVFDQLMDKYLISKGLS* |
| Ga0102915_12781172 | 3300007562 | Estuarine | MNDLFWYSRQLREAVSTTGMENGWDNEKCKEVFDQLMAKYLDKRRGTNGI* |
| Ga0102918_11316834 | 3300007593 | Estuarine | MNNLFWYSRQLREAVSTTGMENGWNDEKCKEVFDQLMDKYLVSKGLE* |
| Ga0102918_12128673 | 3300007593 | Estuarine | MNDIFWYKIKLREAVSTTAMENGWDNEKCKEVFDSLM |
| Ga0102920_12943413 | 3300007600 | Estuarine | WILMNDLFWYSRQLREAVSTTGMENGWNDEKCKEVFDQLMDKYLVSKGLE* |
| Ga0102921_12705952 | 3300007603 | Estuarine | MNNLFWYSRQLREAVSTTGMENGWDNEKCKEVFDQLMDKYLISKGLS* |
| Ga0102897_12370262 | 3300007617 | Estuarine | MNELFWYSRQLKEAVSTTAMENGWNDAKCKEVFDQLMDKYLISKDLK* |
| Ga0102871_11385422 | 3300007620 | Estuarine | MNDLFWYKIKLREAVSTTGMENGWDDAKCKEVFDQLMDKYLVSKGLKDDDMIAENHEL* |
| Ga0102872_10995282 | 3300007621 | Estuarine | MNDLFWYSRKLREAVSTTGMENGWNDEKCKEVFDKLMDKYLISKGLS* |
| Ga0102872_11275481 | 3300007621 | Estuarine | FWYKIKLREAVSTTAMENGWDNEKCKEVFDSLMNQYLASRGLE* |
| Ga0102878_10723202 | 3300007624 | Estuarine | MNELFWYSRQLREAVSTTAMENGWNDAKCKEFFDELMDKYLVSKDLK* |
| Ga0102870_10527033 | 3300007625 | Estuarine | MNDLFWYSRQLREAVSTTGMENGWNDEKCKEVFDKLMDKYLISKGLS* |
| Ga0102894_11273483 | 3300007632 | Estuarine | WYSRQLREAVSTTAMENGWNDAKCKEVFDQLMEKYLVSKDIK* |
| Ga0102865_11484862 | 3300007639 | Estuarine | MNDLFWYSRKLREAVSTTGMENGWNDEKCKEVFDQLMDKYLVSKGLK* |
| Ga0102865_11968472 | 3300007639 | Estuarine | MNELFWYSRQLREAVSTTGMENGWNDNKCKEVFDELMDKYLVSKDLK* |
| Ga0102865_12053683 | 3300007639 | Estuarine | MNDLFWYSRNLREAVATTGMENGWDNEKCKEVVDELMDKELVSKGLE* |
| Ga0102876_11837852 | 3300007642 | Estuarine | MNDLFWYSRQLREAVSTTGMENGWNDEKCKEVFDELMDKYLVSKGLE* |
| Ga0102876_12089133 | 3300007642 | Estuarine | MNDLFWYSRQLREAVSTTGMENGWNDEKCKEVFDQLMDK |
| Ga0102912_10680943 | 3300007649 | Estuarine | MNDLFWYSRKLREAVSTTGMENGWDNEKCKEVFDQLMDKYLISKGLS* |
| Ga0102898_10605963 | 3300007658 | Estuarine | MNDLFWYSRKLREAVSTTGMENGWNDEKCKEVFDQLMDKYLISKGLS* |
| Ga0102862_11328962 | 3300007670 | Estuarine | MNDLFWYSRQLREAVSTTGMENGWNDEKCKEVFDQLMDKYLVSKDIK* |
| Ga0102867_11385541 | 3300007716 | Estuarine | MNELFWYSRQLKEAVSTTAMENGWNDAKCKEVFDELMDKYLVFKDLK* |
| Ga0105736_11160174 | 3300007861 | Estuary Water | AEKFIRGRKLREAVNSTGMENGWDDKKCKEVFDQLMDKYLVSKGLK* |
| Ga0105745_11537303 | 3300007972 | Estuary Water | REAVSTTGMENGWDNEKCKEVFDKLMDKYLISKGLS* |
| Ga0105746_12544411 | 3300007973 | Estuary Water | MNELFWYSRQLKEAVSTTAMENGWNDAKCKEVFDQLMDKYLVSKDLK* |
| Ga0105747_12296673 | 3300007974 | Estuary Water | MNELFWYSRQLREAVSTTGMENGWNDDKCKEVFDELMYKYLVSKDLK* |
| Ga0105747_12629581 | 3300007974 | Estuary Water | NFFAEWYDVYMNELFWYSRQLKEAVSTTAMENGWNDAKCKEVFDELMDKYLVSKDLK* |
| Ga0105748_102137032 | 3300007992 | Estuary Water | MNELFWYSRQLKEAVSTTAMENGWNDAKCKEVFDELMDKYLISKDLK* |
| Ga0105748_102624161 | 3300007992 | Estuary Water | LREAVSTTGMENGWNDEKCKEVFDQLMDKYLVSKGLE* |
| Ga0102922_12754233 | 3300008021 | Estuarine | MPWGILMNDLFWYSRKLREAVATTGMENGWDNEKCKEVFDELMDKYLVSKGLE* |
| Ga0108970_103952553 | 3300008055 | Estuary | MNELFWYSRQLREAVSTTGMENGWNDAKCKEVFDELMDKYLVSKGLK* |
| Ga0108970_108222753 | 3300008055 | Estuary | MPWGILMNSLFWYSRQLREAVSTTGMENGWDDEKCKEVFDQLMDKYLVSKDLK* |
| Ga0108970_117713442 | 3300008055 | Estuary | MNDLFWYSRQLREAVSTTGMENGWNDDKCKEVFDHLMDKYLVSKGLE* |
| Ga0114336_10252068 | 3300008261 | Freshwater, Plankton | MNDLFWYKIKLREAVSTTGMENGWDDKKCKEVFDHLMDKYLVSRGLK* |
| Ga0102889_10246812 | 3300008964 | Estuarine | MNDLFWYKIKLREAVSTTGMENGWDDEKCKEVFDSLMNKYLVSRSLE* |
| Ga0102889_11398613 | 3300008964 | Estuarine | MNELFWYSRQLREAVSTTAMENGWNDAKCKEVFDQLMEK |
| Ga0102831_11182153 | 3300008996 | Estuarine | MNDLFWYKIKLREAVSATGMENGWDNEKCKEVFDELMAKYLEKRAGTNGI* |
| Ga0102829_10148704 | 3300009026 | Estuarine | MNDLFWYKIKLREAVSTTGMENGWSDEKCKEVFDQLMDKYLVS |
| Ga0102829_10957672 | 3300009026 | Estuarine | MNDLFWYKIKLREAISTTAMENGWDNEKCKEVFDSLMNQYLASRGLE* |
| Ga0102829_11439091 | 3300009026 | Estuarine | REAVSTTGMENGWNDEKCKEVFDKLMDKYLVSKGLK* |
| Ga0102829_12949222 | 3300009026 | Estuarine | MNDLFWYKIKLREAVSTTAMENGWDNEKCKEVFDELMDKYLVSRGLK* |
| Ga0102911_10309933 | 3300009049 | Estuarine | MNELFWYSRQLREAVSTTAMENGWNDAKCKEVFDQLMEKYLVSKDIK* |
| Ga0102864_11453661 | 3300009051 | Estuarine | MNDLFWYSRKLREAVSTTGMENGWNDEKCKEVFDQLMDKYLIFKGLE* |
| Ga0102860_10252813 | 3300009056 | Estuarine | QLREAVSTTGMENGWDDEKCKVVFDQLMDKYLVSKDLK* |
| Ga0102830_11786561 | 3300009059 | Estuarine | QLREAVSTTGMENGWNDEKCKEVFDQLMDKYLVSKDLK* |
| Ga0102830_12309142 | 3300009059 | Estuarine | MPWGILMNDLFWYSRKLREAVSTTGMENGWNDEKCKEVFDKLMDKYLISKGLS* |
| Ga0102812_104656713 | 3300009086 | Estuarine | MNDLFWYSRQLKEAVSTTAMENGWNDEKCKEVFDKLMDKYLIS |
| Ga0102883_10056851 | 3300010312 | Estuarine | EAVSTTAMENGWDNEKCKEVFDSLMNQYLASRGLE* |
| Ga0102883_10595343 | 3300010312 | Estuarine | DKFFAEWYDVYMNELFWYSRQLKEAVSTTAMENGWNDAKCKEVFDQLMEKYLVSKDIK* |
| Ga0119951_10058948 | 3300012000 | Freshwater | MNDLFWYKIKLREAVSTTAMENGWDNEKCKEVFDNLMNQYLVSRGFK* |
| Ga0163199_10707412 | 3300013092 | Freshwater | MNDLFWYSRQLREAVSTTGMENGWDNEKCKEVFDKLMDKYLVSKDLK* |
| Ga0181356_11472331 | 3300017761 | Freshwater Lake | MNDLFWYGRQLREAVNSTGMENGWNDEKCKEVFDQLMDKYIELCHS |
| Ga0181356_11737553 | 3300017761 | Freshwater Lake | MNDLFWYSRQLREAVSNTGMENGWNDEKCKEVFDNLMDKYL |
| Ga0181358_10702573 | 3300017774 | Freshwater Lake | MNDLFWYGRQLREAVNSTGMENGWNDEKCKEVFDQLMDKYIELCHLSKDLK |
| Ga0181359_100493313 | 3300019784 | Freshwater Lake | MNDLFWYSRQLREAVSTTGMENGWNDEKCKEVFDQLMDKYLVSKDLK |
| Ga0208232_10219581 | 3300020527 | Freshwater | MNDLFWYKIKLREAVSATGMENGWSNEKCKEVFDQLMDKYLVS |
| Ga0208597_10194771 | 3300020562 | Freshwater | MNDLFWYKIKLREAVSATGMENGWSNEKCKEVFDQLMDKYLVSKNLK |
| Ga0214921_100042732 | 3300023174 | Freshwater | MNDLFWYKIKLREAVSTTAMENGWDNEKCKEVFDNLMNQYLVSRGFK |
| Ga0214921_101628831 | 3300023174 | Freshwater | MNELFWYKIKLREAVSTTGMENGWDDEKCKEVFDELMDKYLISKDLK |
| Ga0214919_100015232 | 3300023184 | Freshwater | MNDLFWYKIKLREAVSTTAMENGWDNEKCKEVFDSLMNQYLVSRGFK |
| Ga0214919_102151023 | 3300023184 | Freshwater | MNDLFWYSRKLREAVSTTGMENGWDNEKCKEVFDELMDKYLVSKDLK |
| Ga0244777_100110362 | 3300024343 | Estuarine | MNDIFWYKIKLREAVSTTAMENGWDNEKCKEVFDSLMNQYLASRGLE |
| Ga0244777_100577273 | 3300024343 | Estuarine | MNELFWYSRQLREAVSTTAMENGWNDAKCKEVFDQLMEKYLVSKDIK |
| Ga0244777_100918304 | 3300024343 | Estuarine | MNELFWYSRQLREAVSTTGMENGWNDAKCKEVFDELMDKYLVFKDLK |
| Ga0244777_101084494 | 3300024343 | Estuarine | MNDLFWYKIKLREAVSTTGMENGWSDEKCKEVFDQLMDKYLVSKDLK |
| Ga0244777_101669741 | 3300024343 | Estuarine | MNDLFWYSRQLREAVSTTGMENGWNDEKCKEVFDQLMDKYLVSKGLE |
| Ga0244777_103178012 | 3300024343 | Estuarine | MNDLFWYSRKLREAVSTTGMENGWNDEKCKEVFDQLMDKYLVSKGLE |
| Ga0244777_104030713 | 3300024343 | Estuarine | MNSLFWYSRLLREAVSTTGMENGWDDEKCKEVFDELMDKYLVSKGLE |
| Ga0244777_104530261 | 3300024343 | Estuarine | FSLMNDLFWYSRQLREAVSTTGMENGWDNEKCKEVFDQLMDKYLISKGLS |
| Ga0244775_100018524 | 3300024346 | Estuarine | MHGRILMNDIFWYKIKLREAISTTAMENGWDNEKCKEVFDSLMNQYLASRGLE |
| Ga0244775_1000708530 | 3300024346 | Estuarine | MNDLFWYSRKLREAVSTTGMENGWDDEKCKEVFDQLMDKYLVSKDLK |
| Ga0244775_1001280010 | 3300024346 | Estuarine | MNELFWYSRQLKEAVSTTAMENGWSDEKCKEVFDKLMDKYLISKGLK |
| Ga0244775_100153132 | 3300024346 | Estuarine | MNDLFWYSRQLKEAVSTTAMENGWNDEKCKEVFDQLMDKYLVDKDLK |
| Ga0244775_100157784 | 3300024346 | Estuarine | MNDLFWYKIKLREAVSTTGMENGWDDEKCKEVFDQLMGKYLVSKGLK |
| Ga0244775_1001889516 | 3300024346 | Estuarine | MNELFWYSRQLREAVSTTGMENGWNDAKCKEVFDKLMDKYLISKGLK |
| Ga0244775_100508703 | 3300024346 | Estuarine | MNDLFWYSRKLREAVSTTGMENGWDDAKCKEVFDELMDKYLISKDLK |
| Ga0244775_100553521 | 3300024346 | Estuarine | LFWYSRQLREAVSTTGMENGWNDAKCKEVFDSLMDKYLVSKDLK |
| Ga0244775_101087695 | 3300024346 | Estuarine | MNDLFWYSRQLREAVSTTGMENGWSDEKCKEVFDQLMDKYLVSKDLK |
| Ga0244775_101178773 | 3300024346 | Estuarine | MNKLFWYSRQLREAVSTTGMENGWNDAKCKEVFDELMDKYLVSKDLK |
| Ga0244775_101212263 | 3300024346 | Estuarine | MSGRILMNDLFWYKIKLREAVSATGMENGWDNEKCKEVFDELMAKYLEKRAGTNGI |
| Ga0244775_101213186 | 3300024346 | Estuarine | MNNLFWYSRQLREAVSTTGMENGWNDEKCKEVFDQLMDKYLVSKGLK |
| Ga0244775_102485404 | 3300024346 | Estuarine | MNDLFWYSRQLREAVSTTGMENGWNDAKCKEVFDELMDKYLISKDLK |
| Ga0244775_103258124 | 3300024346 | Estuarine | MNDLFWYSRQLREAVSTTGMENGWNDEKCKEVFDELMDRYLVSKGLK |
| Ga0244775_103754412 | 3300024346 | Estuarine | MNELFWYSRQLKEAVSTTAMENGWNDAKCKEVFDQLMDKYLISKDLK |
| Ga0244775_104107955 | 3300024346 | Estuarine | VYMNELFWYSRQLREAVSTTGMENGWNDAKCKEVFDKLMDKYLVSKDLK |
| Ga0244775_104479612 | 3300024346 | Estuarine | MNDLFWYSRKLREAVSTTGMENGWNDEKCKEVFDKLMDKYLISKGLS |
| Ga0244775_104948623 | 3300024346 | Estuarine | MNDLFWYKIKLREAVSTTGMENGWDDEKCKEVFDSLMNKYLVSRGLE |
| Ga0244775_108599551 | 3300024346 | Estuarine | MNSLFWYSRQLREAVSTTGMENGWNDEKCKEVFDQ |
| Ga0244775_111759881 | 3300024346 | Estuarine | MNDLFWYSRKLREAVSTTAMENGWDNEKCKEVFDELMDKYLVSKDLK |
| Ga0244776_100710635 | 3300024348 | Estuarine | MNDLFWYSRQLREAVSTTGMENGWDNEKCKEVFDQLMDKYLISKGLS |
| Ga0244776_102893432 | 3300024348 | Estuarine | MNELFWYSRQLKEAVSTTAMENGWNDAKCKEVFDELMDKYLIS |
| Ga0244776_107614122 | 3300024348 | Estuarine | MNDLFWYKIKLREAVSTTGMENGWDDAKCKEVFDQLMDKYLVSKGLKDDDMIAENHEL |
| Ga0244776_108638602 | 3300024348 | Estuarine | MNSLFWYSRLLREAVSTTGMENGWNDEKCKEVFDELMDKYLISKGLS |
| Ga0208566_11287252 | 3300025307 | Freshwater | MNDLFWYSRQLREAVSTTGMENGWDNEKCKEVFDKLMDKYLVSKDLK |
| Ga0208443_10600512 | 3300027084 | Estuarine | MNDLFWYSRQLKEAVSTTAMENGWNDEKCKEVFDKLMDKYLISKGLS |
| Ga0255074_10412823 | 3300027121 | Freshwater | MNELFWYSRQLKEAVSTTAMENGWNDAKCKEVFDQLM |
| Ga0255074_10534331 | 3300027121 | Freshwater | MNKLFWYSRQLREAVSTTAMENGWNDAKCKEVFDELMDKYLISKDLK |
| Ga0255090_10400133 | 3300027123 | Freshwater | MNDLFWYSRQLREAVSTTGMENGWDNDKCKEVFDELMDKYLVSKDLK |
| Ga0255067_10199121 | 3300027129 | Freshwater | MNELFWYSRQLKEAVSTTAMENGWNDAKCKEVFDELMDKYLVSKDLK |
| Ga0255082_10194952 | 3300027139 | Freshwater | MNELFWYSRQLKEAVSTTAMENGWNDAKCKEVFDELMDKYLVSK |
| Ga0255065_10799883 | 3300027142 | Freshwater | MNDLFWYSRKLKEAVSTTGMENGWNDEKCKEVFDELMDKYLVDKDLK |
| Ga0208922_10198425 | 3300027197 | Estuarine | MNDLFWYKIKLREAVSTTGMENGWNDEKCKEVFDQLMDK |
| Ga0208306_10777421 | 3300027214 | Estuarine | YSRQLREAVSTTGMENGWNDDKCKEVFDELMDKYLVSKDLK |
| Ga0208167_10337701 | 3300027219 | Estuarine | MNDIFWYKIKLREAVSTTAMENGWDNEKCKEVFDQLMDKYLISKGLS |
| Ga0208024_10866771 | 3300027222 | Estuarine | MNDLFWYSRKLREAVSTTGMENGWNDEKCKEVFDQLMDKYLISKGLS |
| Ga0208806_10414321 | 3300027242 | Estuarine | MNDLFWYSRQLREAVSTTGMENGWDNEKCKEVFDQL |
| Ga0208806_10883641 | 3300027242 | Estuarine | LKEAVSTTAMENGWNDAKCKEVFDQLMEKYLVSKDIK |
| Ga0208027_10064422 | 3300027260 | Estuarine | MHGRILMNDIFWYKIKLREAVSTTAMENGWDNEKCKEVFDSLMNQYLASRGLE |
| Ga0208027_10397321 | 3300027260 | Estuarine | MHGWILMNDLFWYSRQLREAVSTTGMENGWDNEKCKEVFDQLMDKYLISKGLS |
| Ga0208812_10799802 | 3300027311 | Estuarine | MNNLFWYSRQLREAVSTTGMENGWNDEKCKEVFDELMDKYLVSKDLK |
| Ga0208923_10184351 | 3300027320 | Estuarine | MNDLFWYKIKLREAVSTTGMENGWSDEKCKEVFDQLMDKY |
| Ga0208923_10611902 | 3300027320 | Estuarine | MNDLFWYSRQLKEAVSTTGMENGWNDEKCKEVFDQLMDKYLVSKGLE |
| Ga0208923_10680833 | 3300027320 | Estuarine | MNDLFWYKIKLREAVSTTGMENGWDDEKCKEVFDQLMDKYLVSK |
| Ga0208022_10566604 | 3300027418 | Estuarine | WYSRQLREAVSTTAMENGWSDEKCKEVFDKLMDKYLISKGLK |
| Ga0255077_10189471 | 3300027529 | Freshwater | ISYSQRMYGRILMNDLFWYSRQLREAVSTTGMENGWNDDKCKEVFDHLMDKYLVSKGLE |
| Ga0209552_10549754 | 3300027563 | Freshwater Lake | MNDLFWYSRQLREAVSNTGMENGWNDEKCKEVFDNLMDKYLVSKDLK |
| Ga0208897_10002821 | 3300027571 | Estuarine | MNDLFWYSRKLREAVSTTGMENGWNDEKCKEVFDQLMDKYL |
| Ga0209651_11483531 | 3300027581 | Freshwater Lake | QLREAVSTTGMENGWNDEKCKEVFDQLMDKYLVSKDLK |
| Ga0208966_100009256 | 3300027586 | Freshwater Lentic | MNELFWYSRQLKEAVSTTAMENGWNDAKCKEVFDELMEKYLVSKDLK |
| Ga0208942_10958493 | 3300027627 | Freshwater Lentic | MNDLFWYGRQLREAVSTTGMENGWNDEKCKEVFDQMMDKYLVDKDLK |
| Ga0208133_10140492 | 3300027631 | Estuarine | MNDIFWYKIKLREAISTTAMENGWDNEKCKEVFDSLMNQYLASRGLE |
| Ga0208133_10559391 | 3300027631 | Estuarine | MNELFWYSRQLREAVSTTGMENGWNDAKCKEVFDKLMDKYLVSKDLK |
| Ga0208133_11435592 | 3300027631 | Estuarine | MNDLFWYGRQLREAVNSTGMENGWSDEKCKQVFDELMDKYLVSKGLK |
| Ga0209356_10678021 | 3300027644 | Freshwater Lake | MNDLFWYSRQLREAVSTTGMENGWNDEKCKEVFDHLMDKYLVSKDLK |
| Ga0209356_12002512 | 3300027644 | Freshwater Lake | MNDLFWYSRQLREAVSTTGMENGWNDEKCKEVFDQLMDKYLVSKDLR |
| Ga0209357_10713434 | 3300027656 | Freshwater Lake | MSGWILMNDLFWYSRQLREAVSTTGMENGWNDEKCKEVFDHLMDKYLVSKDLK |
| Ga0209551_10113236 | 3300027689 | Freshwater Lake | MSWGILMNDLFWYSRQLREAVSTTGMENGWNDEKCKEVFDQLMDKYLVSKDLK |
| Ga0209355_13467352 | 3300027744 | Freshwater Lake | MNDLFWYSRQLREAVSTTGMENGWNNEKCKEVFDQLMDKYLVSKDLK |
| Ga0208304_101154153 | 3300027751 | Estuarine | MYGWILMNDLFWYSRQLREAVSTTGMENGWNDEKCKEVFDQLMDKYLVSKGLE |
| Ga0209444_101609941 | 3300027756 | Freshwater Lake | MNDLFWYGRQLREAVNSTGMENGWNDEKCKEVFDQLMDKYIELCHLSK |
| Ga0209107_100799274 | 3300027797 | Freshwater And Sediment | MNDLFWYSRKLREAVSTTGMENGWNDEKCKEVFDDLMDKYLVSKDLK |
| ⦗Top⦘ |