| Basic Information | |
|---|---|
| Family ID | F031089 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 183 |
| Average Sequence Length | 45 residues |
| Representative Sequence | TTRMNRDGLPAVAGYCAEEAAALSAVLGYRQRGARQSRKAGAA |
| Number of Associated Samples | 168 |
| Number of Associated Scaffolds | 183 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.55 % |
| % of genes near scaffold ends (potentially truncated) | 98.36 % |
| % of genes from short scaffolds (< 2000 bps) | 97.27 % |
| Associated GOLD sequencing projects | 161 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.54 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (56.284 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (31.694 % of family members) |
| Environment Ontology (ENVO) | Unclassified (24.590 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (53.005 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 52.11% β-sheet: 0.00% Coil/Unstructured: 47.89% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.54 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 183 Family Scaffolds |
|---|---|---|
| PF02607 | B12-binding_2 | 84.70 |
| PF00809 | Pterin_bind | 6.56 |
| PF01266 | DAO | 1.09 |
| PF02222 | ATP-grasp | 0.55 |
| PF07796 | DUF1638 | 0.55 |
| PF01614 | IclR | 0.55 |
| PF00984 | UDPG_MGDP_dh | 0.55 |
| PF00512 | HisKA | 0.55 |
| PF00111 | Fer2 | 0.55 |
| PF14574 | RACo_C_ter | 0.55 |
| PF02922 | CBM_48 | 0.55 |
| PF16350 | FAO_M | 0.55 |
| PF07681 | DoxX | 0.55 |
| COG ID | Name | Functional Category | % Frequency in 183 Family Scaffolds |
|---|---|---|---|
| COG0677 | UDP-N-acetyl-D-mannosaminuronate dehydrogenase | Cell wall/membrane/envelope biogenesis [M] | 0.55 |
| COG1004 | UDP-glucose 6-dehydrogenase | Cell wall/membrane/envelope biogenesis [M] | 0.55 |
| COG1414 | DNA-binding transcriptional regulator, IclR family | Transcription [K] | 0.55 |
| COG2259 | Uncharacterized membrane protein YphA, DoxX/SURF4 family | Function unknown [S] | 0.55 |
| COG4270 | Uncharacterized membrane protein | Function unknown [S] | 0.55 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 56.28 % |
| Unclassified | root | N/A | 43.72 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2189573003|GZIR7W401BA0GH | Not Available | 513 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_100749081 | Not Available | 856 | Open in IMG/M |
| 3300004092|Ga0062389_104891006 | Not Available | 505 | Open in IMG/M |
| 3300004294|Ga0068945_1198137 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Eubacteriaceae → Eubacterium → Eubacterium limosum | 885 | Open in IMG/M |
| 3300004472|Ga0068974_1016717 | All Organisms → cellular organisms → Bacteria | 549 | Open in IMG/M |
| 3300004475|Ga0068969_1485166 | Not Available | 527 | Open in IMG/M |
| 3300004478|Ga0068972_1003454 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Eubacteriaceae → Eubacterium → Eubacterium limosum | 689 | Open in IMG/M |
| 3300005332|Ga0066388_107366805 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 552 | Open in IMG/M |
| 3300005435|Ga0070714_100232093 | All Organisms → cellular organisms → Bacteria | 1700 | Open in IMG/M |
| 3300005467|Ga0070706_102080563 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 513 | Open in IMG/M |
| 3300005468|Ga0070707_102258556 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 511 | Open in IMG/M |
| 3300005534|Ga0070735_10405071 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Eubacteriaceae → Eubacterium → Eubacterium limosum | 817 | Open in IMG/M |
| 3300005537|Ga0070730_11043814 | All Organisms → cellular organisms → Bacteria | 509 | Open in IMG/M |
| 3300005574|Ga0066694_10315516 | All Organisms → cellular organisms → Bacteria | 744 | Open in IMG/M |
| 3300005842|Ga0068858_101433574 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 680 | Open in IMG/M |
| 3300005921|Ga0070766_10206434 | All Organisms → cellular organisms → Bacteria | 1230 | Open in IMG/M |
| 3300005993|Ga0080027_10267268 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 677 | Open in IMG/M |
| 3300006047|Ga0075024_100214809 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Eubacteriaceae → Eubacterium → Eubacterium limosum | 908 | Open in IMG/M |
| 3300006573|Ga0074055_10017163 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1567 | Open in IMG/M |
| 3300006605|Ga0074057_10036861 | Not Available | 582 | Open in IMG/M |
| 3300006804|Ga0079221_10140374 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1249 | Open in IMG/M |
| 3300006854|Ga0075425_101329214 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → environmental samples → uncultured Nocardioidaceae bacterium | 814 | Open in IMG/M |
| 3300006893|Ga0073928_10864361 | Not Available | 622 | Open in IMG/M |
| 3300006903|Ga0075426_10643031 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 793 | Open in IMG/M |
| 3300007788|Ga0099795_10207682 | Not Available | 829 | Open in IMG/M |
| 3300009088|Ga0099830_11690850 | Not Available | 528 | Open in IMG/M |
| 3300009137|Ga0066709_103282297 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Eubacteriaceae → Eubacterium → Eubacterium limosum | 589 | Open in IMG/M |
| 3300009698|Ga0116216_10839825 | Not Available | 550 | Open in IMG/M |
| 3300009700|Ga0116217_10809712 | Not Available | 576 | Open in IMG/M |
| 3300010048|Ga0126373_12828984 | Not Available | 542 | Open in IMG/M |
| 3300010088|Ga0127476_1005003 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Eubacteriaceae → Eubacterium → Eubacterium limosum | 1073 | Open in IMG/M |
| 3300010113|Ga0127444_1052576 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → environmental samples → uncultured Nocardioidaceae bacterium | 689 | Open in IMG/M |
| 3300010118|Ga0127465_1125216 | Not Available | 599 | Open in IMG/M |
| 3300010123|Ga0127479_1093352 | Not Available | 587 | Open in IMG/M |
| 3300010139|Ga0127464_1131225 | Not Available | 547 | Open in IMG/M |
| 3300010159|Ga0099796_10223640 | Not Available | 772 | Open in IMG/M |
| 3300010333|Ga0134080_10409698 | Not Available | 628 | Open in IMG/M |
| 3300010358|Ga0126370_12645890 | Not Available | 502 | Open in IMG/M |
| 3300011021|Ga0138529_112312 | Not Available | 697 | Open in IMG/M |
| 3300011030|Ga0138603_108785 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Eubacteriaceae → Eubacterium → Eubacterium limosum | 967 | Open in IMG/M |
| 3300011033|Ga0138552_137326 | Not Available | 1115 | Open in IMG/M |
| 3300011038|Ga0138547_150092 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Eubacteriaceae → Eubacterium → Eubacterium limosum | 546 | Open in IMG/M |
| 3300011040|Ga0138587_118056 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Eubacteriaceae → Eubacterium → Eubacterium limosum | 845 | Open in IMG/M |
| 3300011057|Ga0138544_1097779 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Eubacteriaceae → Eubacterium → Eubacterium limosum | 683 | Open in IMG/M |
| 3300011079|Ga0138569_1004148 | Not Available | 512 | Open in IMG/M |
| 3300011081|Ga0138575_1140212 | Not Available | 515 | Open in IMG/M |
| 3300011088|Ga0138576_1120248 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Eubacteriaceae → Eubacterium → Eubacterium limosum | 868 | Open in IMG/M |
| 3300011090|Ga0138579_1244247 | Not Available | 679 | Open in IMG/M |
| 3300011110|Ga0138578_1136347 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Eubacteriaceae → Eubacterium → Eubacterium limosum | 685 | Open in IMG/M |
| 3300011120|Ga0150983_15273630 | Not Available | 722 | Open in IMG/M |
| 3300011269|Ga0137392_11269579 | Not Available | 595 | Open in IMG/M |
| 3300012198|Ga0137364_10507041 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Eubacteriaceae → Eubacterium → Eubacterium limosum | 907 | Open in IMG/M |
| 3300012204|Ga0137374_11065422 | Not Available | 578 | Open in IMG/M |
| 3300012207|Ga0137381_11727706 | Not Available | 516 | Open in IMG/M |
| 3300012212|Ga0150985_110455740 | Not Available | 605 | Open in IMG/M |
| 3300012350|Ga0137372_10894858 | Not Available | 630 | Open in IMG/M |
| 3300012361|Ga0137360_11861871 | Not Available | 507 | Open in IMG/M |
| 3300012380|Ga0134047_1045177 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Eubacteriaceae → Eubacterium → Eubacterium limosum | 548 | Open in IMG/M |
| 3300012386|Ga0134046_1023033 | Not Available | 653 | Open in IMG/M |
| 3300012391|Ga0134035_1110610 | Not Available | 598 | Open in IMG/M |
| 3300012393|Ga0134052_1020008 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 823 | Open in IMG/M |
| 3300012400|Ga0134048_1123202 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → environmental samples → uncultured Nocardioidaceae bacterium | 736 | Open in IMG/M |
| 3300012401|Ga0134055_1049906 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Asanoa → Asanoa ishikariensis | 1428 | Open in IMG/M |
| 3300012404|Ga0134024_1220454 | Not Available | 687 | Open in IMG/M |
| 3300012405|Ga0134041_1068192 | Not Available | 772 | Open in IMG/M |
| 3300012492|Ga0157335_1015230 | Not Available | 674 | Open in IMG/M |
| 3300012495|Ga0157323_1007531 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → environmental samples → uncultured Nocardioidaceae bacterium | 788 | Open in IMG/M |
| 3300012505|Ga0157339_1009716 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → environmental samples → uncultured Nocardioidaceae bacterium | 856 | Open in IMG/M |
| 3300012929|Ga0137404_11245666 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Eubacteriaceae → Eubacterium → Eubacterium limosum | 685 | Open in IMG/M |
| 3300014165|Ga0181523_10256963 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Asanoa | 996 | Open in IMG/M |
| 3300015241|Ga0137418_10843747 | Not Available | 681 | Open in IMG/M |
| 3300016319|Ga0182033_11738959 | Not Available | 565 | Open in IMG/M |
| 3300016341|Ga0182035_11747336 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Intrasporangiaceae → Phycicoccus → unclassified Phycicoccus → Phycicoccus sp. HDW14 | 563 | Open in IMG/M |
| 3300016387|Ga0182040_11937189 | Not Available | 506 | Open in IMG/M |
| 3300016404|Ga0182037_10291298 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Asanoa | 1308 | Open in IMG/M |
| 3300016422|Ga0182039_12149474 | Not Available | 515 | Open in IMG/M |
| 3300017924|Ga0187820_1253624 | Not Available | 566 | Open in IMG/M |
| 3300017924|Ga0187820_1331008 | Not Available | 506 | Open in IMG/M |
| 3300017932|Ga0187814_10144041 | Not Available | 887 | Open in IMG/M |
| 3300017933|Ga0187801_10186516 | Not Available | 818 | Open in IMG/M |
| 3300017937|Ga0187809_10037178 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Asanoa | 1560 | Open in IMG/M |
| 3300017961|Ga0187778_10722558 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Eubacteriaceae → Eubacterium → Eubacterium limosum | 675 | Open in IMG/M |
| 3300017972|Ga0187781_11131274 | Not Available | 575 | Open in IMG/M |
| 3300018001|Ga0187815_10142372 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Asanoa | 1014 | Open in IMG/M |
| 3300018085|Ga0187772_10551548 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Eubacteriaceae → Eubacterium → Eubacterium limosum | 816 | Open in IMG/M |
| 3300018090|Ga0187770_10635673 | Not Available | 850 | Open in IMG/M |
| 3300019284|Ga0187797_1606107 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Asanoa → Asanoa hainanensis | 1308 | Open in IMG/M |
| 3300020581|Ga0210399_11279946 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Eubacteriaceae → Eubacterium → Eubacterium limosum | 578 | Open in IMG/M |
| 3300020582|Ga0210395_11061332 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Eubacteriaceae → Eubacterium → Eubacterium limosum | 599 | Open in IMG/M |
| 3300021171|Ga0210405_10461749 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Asanoa | 997 | Open in IMG/M |
| 3300021178|Ga0210408_11432043 | Not Available | 519 | Open in IMG/M |
| 3300021181|Ga0210388_10034601 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Asanoa | 4167 | Open in IMG/M |
| 3300021374|Ga0213881_10097239 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1272 | Open in IMG/M |
| 3300021406|Ga0210386_11796755 | Not Available | 504 | Open in IMG/M |
| 3300021407|Ga0210383_11424068 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Eubacteriaceae → Eubacterium → Eubacterium limosum | 576 | Open in IMG/M |
| 3300021432|Ga0210384_11422872 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Eubacteriaceae → Eubacterium → Eubacterium limosum | 598 | Open in IMG/M |
| 3300021433|Ga0210391_10347527 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Asanoa | 1163 | Open in IMG/M |
| 3300021477|Ga0210398_10475911 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Asanoa | 1017 | Open in IMG/M |
| 3300022512|Ga0242676_1026525 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Eubacteriaceae → Eubacterium → Eubacterium limosum | 632 | Open in IMG/M |
| 3300022532|Ga0242655_10085238 | Not Available | 844 | Open in IMG/M |
| 3300022716|Ga0242673_1135965 | Not Available | 505 | Open in IMG/M |
| 3300022717|Ga0242661_1025153 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Asanoa | 990 | Open in IMG/M |
| 3300022726|Ga0242654_10121602 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → environmental samples → uncultured Nocardioidaceae bacterium | 843 | Open in IMG/M |
| 3300024271|Ga0224564_1018708 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Asanoa → Asanoa ishikariensis | 1243 | Open in IMG/M |
| 3300024275|Ga0247674_1016574 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → environmental samples → uncultured Nocardioidaceae bacterium | 845 | Open in IMG/M |
| 3300024288|Ga0179589_10123018 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Asanoa | 1083 | Open in IMG/M |
| 3300025494|Ga0207928_1063893 | Not Available | 691 | Open in IMG/M |
| 3300025898|Ga0207692_10277887 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1012 | Open in IMG/M |
| 3300026142|Ga0207698_12721402 | Not Available | 503 | Open in IMG/M |
| 3300026318|Ga0209471_1304271 | Not Available | 528 | Open in IMG/M |
| 3300026927|Ga0207744_1024783 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Eubacteriaceae → Eubacterium → Eubacterium limosum | 558 | Open in IMG/M |
| 3300027043|Ga0207800_1036867 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Eubacteriaceae → Eubacterium → Eubacterium limosum | 693 | Open in IMG/M |
| 3300027517|Ga0209113_1028408 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 773 | Open in IMG/M |
| 3300027725|Ga0209178_1054344 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1289 | Open in IMG/M |
| 3300027765|Ga0209073_10342584 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Eubacteriaceae → Eubacterium → Eubacterium limosum | 601 | Open in IMG/M |
| 3300027775|Ga0209177_10050004 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Asanoa | 1181 | Open in IMG/M |
| 3300027795|Ga0209139_10169854 | All Organisms → cellular organisms → Bacteria | 772 | Open in IMG/M |
| 3300027824|Ga0209040_10211092 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Asanoa → Asanoa ishikariensis | 999 | Open in IMG/M |
| 3300027824|Ga0209040_10221985 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 966 | Open in IMG/M |
| 3300027854|Ga0209517_10393232 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Eubacteriaceae → Eubacterium → Eubacterium limosum | 781 | Open in IMG/M |
| 3300027857|Ga0209166_10550227 | Not Available | 590 | Open in IMG/M |
| 3300027884|Ga0209275_10106471 | Not Available | 1442 | Open in IMG/M |
| 3300027903|Ga0209488_10274115 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1262 | Open in IMG/M |
| 3300027986|Ga0209168_10265717 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Eubacteriaceae → Eubacterium → Eubacterium limosum | 847 | Open in IMG/M |
| 3300028381|Ga0268264_10782820 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 952 | Open in IMG/M |
| 3300028773|Ga0302234_10283125 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 712 | Open in IMG/M |
| 3300029636|Ga0222749_10379255 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Eubacteriaceae → Eubacterium → Eubacterium limosum | 746 | Open in IMG/M |
| 3300029910|Ga0311369_10307138 | Not Available | 1413 | Open in IMG/M |
| 3300030057|Ga0302176_10116654 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Asanoa | 1049 | Open in IMG/M |
| 3300030580|Ga0311355_10963836 | Not Available | 769 | Open in IMG/M |
| 3300030598|Ga0210287_1190480 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Eubacteriaceae → Eubacterium → Eubacterium limosum | 559 | Open in IMG/M |
| 3300030629|Ga0210268_1205272 | Not Available | 632 | Open in IMG/M |
| 3300030738|Ga0265462_11497104 | Not Available | 628 | Open in IMG/M |
| 3300030739|Ga0302311_11068648 | Not Available | 506 | Open in IMG/M |
| 3300030743|Ga0265461_10741612 | Not Available | 900 | Open in IMG/M |
| 3300031027|Ga0302308_10171143 | Not Available | 1414 | Open in IMG/M |
| 3300031170|Ga0307498_10064699 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1034 | Open in IMG/M |
| 3300031236|Ga0302324_102488649 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Eubacteriaceae → Eubacterium → Eubacterium limosum | 632 | Open in IMG/M |
| 3300031525|Ga0302326_10881317 | Not Available | 1276 | Open in IMG/M |
| 3300031525|Ga0302326_11267848 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Asanoa | 1007 | Open in IMG/M |
| 3300031564|Ga0318573_10040354 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Asanoa → Asanoa hainanensis | 2233 | Open in IMG/M |
| 3300031564|Ga0318573_10079453 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1653 | Open in IMG/M |
| 3300031564|Ga0318573_10236143 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Asanoa → Asanoa hainanensis | 973 | Open in IMG/M |
| 3300031564|Ga0318573_10418627 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Eubacteriaceae → Eubacterium → Eubacterium limosum | 720 | Open in IMG/M |
| 3300031564|Ga0318573_10745545 | Not Available | 526 | Open in IMG/M |
| 3300031573|Ga0310915_10810615 | Not Available | 658 | Open in IMG/M |
| 3300031679|Ga0318561_10796979 | Not Available | 519 | Open in IMG/M |
| 3300031681|Ga0318572_10911964 | Not Available | 522 | Open in IMG/M |
| 3300031713|Ga0318496_10021067 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Asanoa | 3220 | Open in IMG/M |
| 3300031718|Ga0307474_10211030 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Asanoa | 1480 | Open in IMG/M |
| 3300031723|Ga0318493_10250289 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 946 | Open in IMG/M |
| 3300031751|Ga0318494_10232574 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Asanoa → Asanoa hainanensis | 1054 | Open in IMG/M |
| 3300031765|Ga0318554_10128731 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Asanoa → Asanoa hainanensis | 1432 | Open in IMG/M |
| 3300031768|Ga0318509_10120339 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Asanoa | 1431 | Open in IMG/M |
| 3300031769|Ga0318526_10273154 | Not Available | 691 | Open in IMG/M |
| 3300031771|Ga0318546_10655227 | Not Available | 739 | Open in IMG/M |
| 3300031778|Ga0318498_10101937 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Asanoa | 1301 | Open in IMG/M |
| 3300031778|Ga0318498_10159536 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1026 | Open in IMG/M |
| 3300031778|Ga0318498_10189386 | Not Available | 934 | Open in IMG/M |
| 3300031778|Ga0318498_10547856 | Not Available | 507 | Open in IMG/M |
| 3300031782|Ga0318552_10297503 | Not Available | 820 | Open in IMG/M |
| 3300031795|Ga0318557_10488556 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Eubacteriaceae → Eubacterium → Eubacterium limosum | 565 | Open in IMG/M |
| 3300031805|Ga0318497_10657757 | Not Available | 587 | Open in IMG/M |
| 3300031805|Ga0318497_10827158 | Not Available | 519 | Open in IMG/M |
| 3300031835|Ga0318517_10388624 | Not Available | 630 | Open in IMG/M |
| 3300031845|Ga0318511_10011561 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3009 | Open in IMG/M |
| 3300031860|Ga0318495_10054424 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Asanoa | 1774 | Open in IMG/M |
| 3300031860|Ga0318495_10513485 | Not Available | 522 | Open in IMG/M |
| 3300031879|Ga0306919_10468848 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 970 | Open in IMG/M |
| 3300031880|Ga0318544_10399348 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Eubacteriaceae → Eubacterium → Eubacterium limosum | 534 | Open in IMG/M |
| 3300031891|Ga0316039_104575 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Eubacteriaceae → Eubacterium → Eubacterium limosum | 844 | Open in IMG/M |
| 3300031894|Ga0318522_10387772 | Not Available | 529 | Open in IMG/M |
| 3300031945|Ga0310913_10569163 | Not Available | 804 | Open in IMG/M |
| 3300032008|Ga0318562_10293106 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 945 | Open in IMG/M |
| 3300032025|Ga0318507_10049981 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1640 | Open in IMG/M |
| 3300032025|Ga0318507_10165629 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 949 | Open in IMG/M |
| 3300032039|Ga0318559_10553709 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Eubacteriaceae → Eubacterium → Eubacterium limosum | 536 | Open in IMG/M |
| 3300032055|Ga0318575_10501779 | Not Available | 616 | Open in IMG/M |
| 3300032089|Ga0318525_10034466 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Asanoa | 2480 | Open in IMG/M |
| 3300032089|Ga0318525_10525052 | Not Available | 605 | Open in IMG/M |
| 3300032261|Ga0306920_103700890 | Not Available | 561 | Open in IMG/M |
| 3300032261|Ga0306920_103972336 | Not Available | 537 | Open in IMG/M |
| 3300032828|Ga0335080_10816966 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 962 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 31.69% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 9.84% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 7.65% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 7.10% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 4.37% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 4.92% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 3.28% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 2.19% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 2.19% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 2.19% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 2.19% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.64% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.64% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 1.64% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.64% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere | 1.64% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.09% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 1.09% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 1.09% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 1.09% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.09% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.09% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 0.55% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 0.55% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.55% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grass Soil | 0.55% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 0.55% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.55% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.55% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.55% |
| Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland | 0.55% |
| Prmafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Prmafrost Soil | 0.55% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.55% |
| Exposed Rock | Environmental → Terrestrial → Rock-Dwelling (Subaerial Biofilms) → Unclassified → Unclassified → Exposed Rock | 0.55% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 0.55% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.55% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2189573003 | Grass soil microbial communities from Rothamsted Park, UK - FE2 (NaCl 30g/L 5ml) | Environmental | Open in IMG/M |
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300004294 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 33 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004472 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 71 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004475 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 62 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004478 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 69 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
| 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
| 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
| 3300005534 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1 | Environmental | Open in IMG/M |
| 3300005537 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 | Environmental | Open in IMG/M |
| 3300005574 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_143 | Environmental | Open in IMG/M |
| 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Host-Associated | Open in IMG/M |
| 3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
| 3300005993 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-046 | Environmental | Open in IMG/M |
| 3300006047 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 | Environmental | Open in IMG/M |
| 3300006573 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLAC (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006605 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHAB (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006893 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG | Environmental | Open in IMG/M |
| 3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
| 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009698 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG | Environmental | Open in IMG/M |
| 3300009700 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010088 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_20_5_24_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010113 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_20_5_24_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010118 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_20_2_16_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010123 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_20_5_8_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010139 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_20_2_8_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Environmental | Open in IMG/M |
| 3300010333 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300011021 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 7 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300011030 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 83 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300011033 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 33 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300011038 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 28 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300011040 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 79 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300011057 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 25 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300011079 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 54 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300011081 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 60 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300011088 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 62 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300011090 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 69 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300011110 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 65 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012204 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
| 3300012350 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012380 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_2_0_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012386 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_2_24_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012391 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_5_16_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012393 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_5_0_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012400 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_2_4_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012401 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_5_16_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012404 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_2_8_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012405 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_5_24_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012492 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.yng.030610 | Host-Associated | Open in IMG/M |
| 3300012495 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.5.old.040610 | Host-Associated | Open in IMG/M |
| 3300012505 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.yng.090610 | Host-Associated | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300014165 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_30_metaG | Environmental | Open in IMG/M |
| 3300015241 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
| 3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
| 3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
| 3300017924 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_5 | Environmental | Open in IMG/M |
| 3300017932 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_4 | Environmental | Open in IMG/M |
| 3300017933 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_1 | Environmental | Open in IMG/M |
| 3300017937 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_4 | Environmental | Open in IMG/M |
| 3300017961 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_20_MG | Environmental | Open in IMG/M |
| 3300017972 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300018001 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_5 | Environmental | Open in IMG/M |
| 3300018085 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018090 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300019284 | Metatranscriptome of tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_10_MT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
| 3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
| 3300021374 | Barbacenia macrantha exposed rock microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - ER_R08 | Environmental | Open in IMG/M |
| 3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
| 3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
| 3300021477 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O | Environmental | Open in IMG/M |
| 3300022512 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022532 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-4-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022716 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022717 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-11-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022726 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-30-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300024271 | Soil microbial communities from Bohemian Forest, Czech Republic ? CSU5 | Environmental | Open in IMG/M |
| 3300024275 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK15 | Environmental | Open in IMG/M |
| 3300024288 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300025494 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-2 shallow-072012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026318 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 (SPAdes) | Environmental | Open in IMG/M |
| 3300026927 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 56 (SPAdes) | Environmental | Open in IMG/M |
| 3300027043 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 11 (SPAdes) | Environmental | Open in IMG/M |
| 3300027517 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_RefH0_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027725 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 (SPAdes) | Environmental | Open in IMG/M |
| 3300027765 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 (SPAdes) | Environmental | Open in IMG/M |
| 3300027775 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control (SPAdes) | Environmental | Open in IMG/M |
| 3300027795 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027824 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027854 | Peat soil microbial communities from Weissenstadt, Germany - SII-2010 (SPAdes) | Environmental | Open in IMG/M |
| 3300027857 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027884 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027986 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028773 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N3_2 | Environmental | Open in IMG/M |
| 3300029636 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300029910 | III_Palsa_E2 coassembly | Environmental | Open in IMG/M |
| 3300030057 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E1_1 | Environmental | Open in IMG/M |
| 3300030580 | II_Palsa_N1 coassembly | Environmental | Open in IMG/M |
| 3300030598 | Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO747-VDE048SO (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030629 | Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO153-ARE093SO (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030738 | Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada VDE Co-assembly | Environmental | Open in IMG/M |
| 3300030739 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N1_3 | Environmental | Open in IMG/M |
| 3300030743 | Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada VCO Co-assembly | Environmental | Open in IMG/M |
| 3300031027 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E3_3 | Environmental | Open in IMG/M |
| 3300031170 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 12_S | Environmental | Open in IMG/M |
| 3300031236 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1 | Environmental | Open in IMG/M |
| 3300031525 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_3 | Environmental | Open in IMG/M |
| 3300031564 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21 | Environmental | Open in IMG/M |
| 3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
| 3300031679 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23 | Environmental | Open in IMG/M |
| 3300031681 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20 | Environmental | Open in IMG/M |
| 3300031713 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f22 | Environmental | Open in IMG/M |
| 3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
| 3300031723 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f23 | Environmental | Open in IMG/M |
| 3300031751 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f24 | Environmental | Open in IMG/M |
| 3300031765 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22 | Environmental | Open in IMG/M |
| 3300031768 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f22 | Environmental | Open in IMG/M |
| 3300031769 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f24 | Environmental | Open in IMG/M |
| 3300031771 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19 | Environmental | Open in IMG/M |
| 3300031778 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f24 | Environmental | Open in IMG/M |
| 3300031782 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f20 | Environmental | Open in IMG/M |
| 3300031795 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f19 | Environmental | Open in IMG/M |
| 3300031805 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f23 | Environmental | Open in IMG/M |
| 3300031835 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f21 | Environmental | Open in IMG/M |
| 3300031845 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f18 | Environmental | Open in IMG/M |
| 3300031860 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f25 | Environmental | Open in IMG/M |
| 3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
| 3300031880 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f25 | Environmental | Open in IMG/M |
| 3300031891 | Spruce litter microbial communities from Bohemian Forest, Czech Republic ? CLA3 metaT (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300031894 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f18 | Environmental | Open in IMG/M |
| 3300031945 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082 | Environmental | Open in IMG/M |
| 3300032008 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f18 | Environmental | Open in IMG/M |
| 3300032025 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f20 | Environmental | Open in IMG/M |
| 3300032039 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f21 | Environmental | Open in IMG/M |
| 3300032055 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f23 | Environmental | Open in IMG/M |
| 3300032089 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f23 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| FE2_01071080 | 2189573003 | Grass Soil | GAVVAALSVSGPTTRMNRDGLRAMAGYCAEEAAALSAVLGYRQRGARQHRKAG |
| JGIcombinedJ26739_1007490811 | 3300002245 | Forest Soil | PASRMARDALAAAASQCAEEAAGLSAVLGYRQRAARQNRKAG* |
| Ga0062389_1048910061 | 3300004092 | Bog Forest Soil | TRMSREGMTTVAGYCAEEAAGLSAVLGYRQRTSKQNRKAG* |
| Ga0068945_11981372 | 3300004294 | Peatlands Soil | APTTRMNREGMTTVAGYCAEEAAGLSAVLGYRQRASKQNRKAGAA* |
| Ga0068974_10167171 | 3300004472 | Peatlands Soil | RGYDGAVVAALSVSAPTTRMTREGMTTVAGYCAEEAAGLSAVLGYRQRASKQNRKAGAA* |
| Ga0068969_14851661 | 3300004475 | Peatlands Soil | RMTREGMTTVAGYCAEEAAGLSAVLGYRQRASKQNRKAGAA* |
| Ga0068972_10034542 | 3300004478 | Peatlands Soil | PATRMTRDRLTATAGHCVAEAAGLSAVLGYRQRAARQTRKAG* |
| Ga0066388_1073668052 | 3300005332 | Tropical Forest Soil | GYDGAVVAALSVSGPTTRMSRDGVPAIAGYCAEEAAGLSAVLGYRQRGVKQTRKAG* |
| Ga0070714_1002320931 | 3300005435 | Agricultural Soil | LSVSAPATRMTRDRLTVAAGHCVAEAAGLSAVLGYRQRAARPRKAG* |
| Ga0070706_1020805632 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | VVAALSVSGPTTRMNRDGLPAMAGYCAEEAAALSAVLGYRQRGARQHRKAG* |
| Ga0070707_1022585561 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | VVAALSVSGPTTRMSRDGLPAMAGYCAEEAAALSAVLGYRQRASRQNRKAG* |
| Ga0070735_104050712 | 3300005534 | Surface Soil | SGPTTRMNRDGLPAVAGYCAEEAAGLSAVLGYRQRGIRQSRKAGAA* |
| Ga0070730_110438141 | 3300005537 | Surface Soil | ALSVSAPTTRLTRDRVPAVAGHCAEEAAGLSAALGYRQRAARQTRKAG* |
| Ga0066694_103155161 | 3300005574 | Soil | GYDGAVVAALSVSAPTIRMSKDSVSTVAGYCTEEAAGLSAVLGYRQRGARQNRKAG* |
| Ga0068858_1014335742 | 3300005842 | Switchgrass Rhizosphere | AVVAALSVSGPTTRMNRDGLPAMAGYCAEEAAALSAVLGYRQRGARQHRKAG* |
| Ga0070766_102064343 | 3300005921 | Soil | VAALSVSAPAARMTRDRLTVAAGHCVSEAAGLSAVLGYRQRAARQTRKAG* |
| Ga0080027_102672681 | 3300005993 | Prmafrost Soil | GYDGAVVAALSVSAPTNRLSRDGVPAIAGFCAEEAAGLSAVLGYRQRGAKQTRKAG* |
| Ga0075024_1002148091 | 3300006047 | Watersheds | EGLPAVAGYCAEEAAALSAVLGYRQRGARQHRKAG* |
| Ga0074055_100171631 | 3300006573 | Soil | DGAVVAALSVSGPTTRMNRDGLPAVAGYCAEEAAALSAVLGYRQRGARPHRKAG* |
| Ga0074057_100368611 | 3300006605 | Soil | GPTTRMNRDGLPAMAGYCAEEAAALSAVLGYRQRGARPHRKAG* |
| Ga0079221_101403743 | 3300006804 | Agricultural Soil | SVSGPTTRMNRDGLPAMAGYCAEEAAALSAVLGYRQRGARQHRKAG* |
| Ga0075425_1013292142 | 3300006854 | Populus Rhizosphere | TTRMNRDGLPAMAGYCAEEAAALSAVLGYRQRGARQHRKAG* |
| Ga0073928_108643611 | 3300006893 | Iron-Sulfur Acid Spring | NRMTSGGVTAAAGHCAAEAAGLSAVLGYRQRAAKQNRKAG* |
| Ga0075426_106430312 | 3300006903 | Populus Rhizosphere | AALSVSGPTNRMTRDGVPAIVGYCTEEAAALSAVLGYRQRGAKQTRKAG* |
| Ga0099795_102076821 | 3300007788 | Vadose Zone Soil | VAALSVSGPTTRMSRDGLPAVAGYCAEEAAALSAVLGYRQRGARQNRKAG* |
| Ga0099830_116908501 | 3300009088 | Vadose Zone Soil | EGVATVAGYCAEEAAGLSAVLGYRQRASRANRKAGVA* |
| Ga0066709_1032822971 | 3300009137 | Grasslands Soil | TTRMNRDGLPAVAGYCAEEAAALSAVLGYRQRGARQSRKAGAA* |
| Ga0116216_108398252 | 3300009698 | Peatlands Soil | RGYDGAVVAALSVSAPTNRMSRDGVAAVAGYCAEEAAGLSAVLGYRQRASRQNRKAGAA* |
| Ga0116217_108097121 | 3300009700 | Peatlands Soil | RMARDWVSAAAGYCVAEAAGLSAVLGYRQRASRQNRKAGAA* |
| Ga0126373_128289841 | 3300010048 | Tropical Forest Soil | SVSGPTNRMTRDGVPAIAGYCTEEAAGLSAVLGYRQRGAKQTRKAGAA* |
| Ga0127476_10050031 | 3300010088 | Grasslands Soil | GLPAVAGYCAEEAAALSAVLGYRQRGIRQSRKAGAA* |
| Ga0127444_10525762 | 3300010113 | Grasslands Soil | VSGPTTSMNRDGLPAVAGYCAEEAAALSAVLGYRQRGARQSRKAGAA* |
| Ga0127465_11252162 | 3300010118 | Grasslands Soil | ALAVSGPTNRMTRDGVPAIAGYCMEEAAALSAVLGYRQRGARQSRKVGAA* |
| Ga0127479_10933522 | 3300010123 | Grasslands Soil | VHGYDGAVVAALAVSGPTNRMTRDGVPAIAGYCTEEATALSAVLGYRQRGIRQSRKAGAA |
| Ga0127464_11312252 | 3300010139 | Grasslands Soil | RDGLPAVAGYCAEEAAALSAVLGYRQRGARQSRKAGAA* |
| Ga0099796_102236402 | 3300010159 | Vadose Zone Soil | GYDGAVVAALSVSGPTTRMSRDGLPAVAGYCAEEAAALSAVLGYRQRGARQHRKAG* |
| Ga0134080_104096981 | 3300010333 | Grasslands Soil | DGLPAVAGYCAEEAAALSAVLGYRQRGARQNRKAG* |
| Ga0126370_126458901 | 3300010358 | Tropical Forest Soil | VVAALSVSSPTNRMTMDNVPAIAGYCAEEAAGLSAVLGYRQRGAKTTRKAG* |
| Ga0138529_1123122 | 3300011021 | Peatlands Soil | AVVAALSVSAPTNRMSRDGVAAVVGYCAEEAAGLSAVLGYRQRAARQTRKAG* |
| Ga0138603_1087853 | 3300011030 | Peatlands Soil | VVAALSVSAPTTRMTREGMTTVAGYCAEEAAGLSAVLGYRQRASKQNRKAGAA* |
| Ga0138552_1373261 | 3300011033 | Peatlands Soil | SAPTTRMTREGMTTVAGYCAEEAAGLSAVLGYRQRASKQNRKAGAA* |
| Ga0138547_1500921 | 3300011038 | Peatlands Soil | TNRMSRDGVAAVVGCCAEEAAGLSAVLGYRQRASRQTRKAGAA* |
| Ga0138587_1180562 | 3300011040 | Peatlands Soil | APTTRMTREGMTTVAGYCAEEAAGLSAVLGYRQRASKQNRKAGAA* |
| Ga0138544_10977792 | 3300011057 | Peatlands Soil | APTTRMSREGMTTVAGYCVEEAAGLSAVLGFRQRASKQNRKAGAA* |
| Ga0138569_10041481 | 3300011079 | Peatlands Soil | VSAPATRMTRDRLTTAAGHCVAEAAGLSAVLGYRQRAARQTSKAG* |
| Ga0138575_11402122 | 3300011081 | Peatlands Soil | DGAVVAALSVSAPTTRMTREGMTTVAGYCAEEAAGLSAVLGYRQRASKQNRKAGAA* |
| Ga0138576_11202481 | 3300011088 | Peatlands Soil | TTRMTREGMTTVAGYCAEEAAGLSAVLGYRQRASKQNRKAGAA* |
| Ga0138579_12442472 | 3300011090 | Peatlands Soil | GYDGAVVAALSVSAPSYRMNRDGVAAVVGCCAEEAAGLSAVLGYRQRASRQTRKAGAA* |
| Ga0138578_11363471 | 3300011110 | Peatlands Soil | RMSRDGVAAVVGCCAEEAAGLSAVLGYRQRASRQTRKAGAA* |
| Ga0150983_152736302 | 3300011120 | Forest Soil | VAALSVSAPTNRMSRNEVAVAAEACTNEAASLSAVLGHRQRTARQTRKAG* |
| Ga0137392_112695791 | 3300011269 | Vadose Zone Soil | IRGYDGAVVAALSVSAPTTRMRRDGVAAVAGQCAEEAAGLSAVLGYRQRAVRQNRKAGAA |
| Ga0137364_105070412 | 3300012198 | Vadose Zone Soil | TRMSRDGLPAMAGYCTEEAAALSAVLGYRQRSARQSRKVGVA* |
| Ga0137374_110654221 | 3300012204 | Vadose Zone Soil | GAVVAALSVSGPTTRMNRDGLPAMAGYCAEEAAALSAVLGYRQRGARPHRKAG* |
| Ga0137381_117277062 | 3300012207 | Vadose Zone Soil | YDGAVVAALSVSAPTTRLGREGVATVAGYCAEEAAGLSAVLGYRQRASRANRKAGVA* |
| Ga0150985_1104557402 | 3300012212 | Avena Fatua Rhizosphere | DGLPAMAGYCAEEAAALSAVLGYRQRGARQHRKAG* |
| Ga0137372_108948582 | 3300012350 | Vadose Zone Soil | TTRMSRDSVAAVAGYCTEEAAGLSAVLGYRQRASRQTRKAG* |
| Ga0137360_118618711 | 3300012361 | Vadose Zone Soil | VVAALSVSGPTTRMSRDGLPAVAGYCAEEAAALSAVLGYRQRGVRQNRKAG* |
| Ga0134047_10451772 | 3300012380 | Grasslands Soil | AVVAALSVSGPTTRMSREGLPAVAGYCAEEAAALSAVLGYRQRGARPHRKAG* |
| Ga0134046_10230332 | 3300012386 | Grasslands Soil | RGYDGAVVAALSVSAPTTRMSRDGLPAVAGYCAEEAAALSAVLGYRQRGARQNRKAG* |
| Ga0134035_11106102 | 3300012391 | Grasslands Soil | RMNRDGLPAVAGYCAEEAAALSAVLGYRQRGARQSRKAGAA* |
| Ga0134052_10200081 | 3300012393 | Grasslands Soil | AALSVSGPTTRMNRDGLPAVAGYCAEEAAALSAVLGYRQRGARPHRKAG* |
| Ga0134048_11232022 | 3300012400 | Grasslands Soil | GYDGAVVAALSVSGPTTRMNRDGLPAMAGYCAEEAAALSAVLGYRQRGARPHRKAG* |
| Ga0134055_10499063 | 3300012401 | Grasslands Soil | MSRDGLPAMAGYCTEEAAALSAVLGYRQRSGRQQRKAG* |
| Ga0134024_12204541 | 3300012404 | Grasslands Soil | GLPAMAGYCAEEAAALSAVLGYRQRGARQNRKAG* |
| Ga0134041_10681922 | 3300012405 | Grasslands Soil | SVSGPTTRMNRDGLPAVAGYCAEEAAALSAVLGYRQRGARQSRKAGAA* |
| Ga0157335_10152301 | 3300012492 | Arabidopsis Rhizosphere | GYDGAVVAALSVSGPTTSMNRDGLPAVAGYCAEEAAALSAVLGYRQRGARPHRKAG* |
| Ga0157323_10075311 | 3300012495 | Arabidopsis Rhizosphere | NRMTRDGVPAIAGYCTEEAAALSAVLGYRQRGAKQTRKAG* |
| Ga0157339_10097161 | 3300012505 | Arabidopsis Rhizosphere | TTRMNRDGLPAVAGYCAEEAAALSAVLGYRQRGARPHRKAG* |
| Ga0137404_112456661 | 3300012929 | Vadose Zone Soil | AALSVSGPTNRMTRDGVPAIAGYCAEEAAGLSAVLGYRQRGAKQTRKAG* |
| Ga0181523_102569633 | 3300014165 | Bog | AALSVSGPTNRMSRDGVAAVAGYCAEEAAGLSAVLGYRQRASRQNRKAGAA* |
| Ga0137418_108437474 | 3300015241 | Vadose Zone Soil | VAALSVSAPTTRLSRDGLPAVAGYCAEEAAALSAVLGYRQRGARQNRKAG* |
| Ga0182033_117389592 | 3300016319 | Soil | LTTAAGHCVAEAAGLSAVLGYRQRAARQARKAGAA |
| Ga0182035_117473361 | 3300016341 | Soil | GFDGAVVAALSVSAPTTRMTRDRLSTTAGHCVAEATGLSAVLGYRQRAARQTRKAGAA |
| Ga0182040_119371892 | 3300016387 | Soil | TAEGVTAAAAHCVEEAAGLSAVLGYRQRAARQTRKAGAA |
| Ga0182037_102912982 | 3300016404 | Soil | VIAALSVSGPTTRMNRDGLPAVAGYCAEEAAALSAVLGYRQRGARQSRKAGAA |
| Ga0182039_121494742 | 3300016422 | Soil | APTTRMSKDSVATVAGYCTEEAAGLSAVLGYRQRASRQNRKAGAA |
| Ga0187820_12536241 | 3300017924 | Freshwater Sediment | MTKDRVPAAAGHCAQEAAGLSAVLGYRQRAARQTRKAGAA |
| Ga0187820_13310082 | 3300017924 | Freshwater Sediment | VVAALSVSAPATRMTRDRLSTAAGHCVAEAAGLSAVLGYRQRAGRQTRKAGAA |
| Ga0187814_101440412 | 3300017932 | Freshwater Sediment | TRDRVSATAGYCVAEAAGLSAVLGYRQRAARQNRKAGAA |
| Ga0187801_101865162 | 3300017933 | Freshwater Sediment | SVSAPTTRMTRDRLTTTAGHCVAEAMGLSAVLGYRQRAARQTRKAG |
| Ga0187809_100371781 | 3300017937 | Freshwater Sediment | TRMTRDRLTATAGHCVAEAAGLSAVLGYRQRAARQTRKAG |
| Ga0187778_107225581 | 3300017961 | Tropical Peatland | PTTRMTRDRVAVAAGHCAQEAAGLSAVLGYRQRAARQSRKAGAA |
| Ga0187781_111312742 | 3300017972 | Tropical Peatland | DEVTAAAGHCVQEAAGLSAVLGYRQRAARQSRKAGAA |
| Ga0187815_101423723 | 3300018001 | Freshwater Sediment | CRDGVAAVAGYCAEEAAGLSAVLGYRQRASRQTRKAGAA |
| Ga0187772_105515482 | 3300018085 | Tropical Peatland | SAPTTRMSRDGLPTVAGYCAEEAAGLSAVLGYRERAARQNRKAG |
| Ga0187770_106356731 | 3300018090 | Tropical Peatland | TRMTGDRLTTAAGHCVTEAAGLSAVLGYRQRAARQTRKAG |
| Ga0187797_16061071 | 3300019284 | Peatland | GYDGAVIAALSVSAPTTRMTEDRVPVAAGHCSQEAAALSAVLGYRQRAARQTRKAGAA |
| Ga0210399_112799462 | 3300020581 | Soil | LPAVAGYCAEEAAALSAVLGYRQRGARQSRKAGAA |
| Ga0210395_110613322 | 3300020582 | Soil | RMSREGMTTVAGYCAEEAAGLSAVLGYRQRTSKQNRKAGAA |
| Ga0210405_104617493 | 3300021171 | Soil | TTRMSREGMTTVAGYCAEEAAGLSAVLGYRQRTSKQNRKAGAA |
| Ga0210408_114320432 | 3300021178 | Soil | MAALSVSGPTTRMNRDGLPAVAGYCAEEAAALSAVLGYRQRGIRQSRKAGAA |
| Ga0210388_100346011 | 3300021181 | Soil | MTRDRLTVAAGHCVSEAAGLSAVLGYRQRAARQTRKAG |
| Ga0213881_100972391 | 3300021374 | Exposed Rock | LSVSAPTTRLSRDSVATVAGYCTEEAAGLSAVLGYRQRANRQTRKAGVA |
| Ga0210386_117967551 | 3300021406 | Soil | SAPAARMTRDRLTVAAGHCVAEAAGLSAVLGYRQRAARQTRKAG |
| Ga0210383_114240681 | 3300021407 | Soil | NRMSREQVAAAAEACTGEAAGLSAVLGYRQRAARQTRKAG |
| Ga0210384_114228722 | 3300021432 | Soil | NRDGLPAVAGYCAEEAAALSAVLGYRQRGIRQSRKAGAA |
| Ga0210391_103475271 | 3300021433 | Soil | VSAPAARMTRDRLTVAAGHCVSEAAGLSAVLGYRQRAARQTRKAG |
| Ga0210398_104759113 | 3300021477 | Soil | RGYDGAVVAALSVSAPTTRMTRDGMTTVAGYCAEEAVGLSAVLGYRQRAGKQNRKAGAA |
| Ga0242676_10265252 | 3300022512 | Soil | MTRDRLTVAAGHCVAEAAGLSAVLGYRQRAARQTRKAG |
| Ga0242655_100852381 | 3300022532 | Soil | AALSVSGPTTRLSRDGLPAVAGYCAEEAAALSAVLGYRQRGVRQNRKAG |
| Ga0242673_11359652 | 3300022716 | Soil | RNEVAAAAEACTNEAASLSAVLGHRQRTARQTRKEG |
| Ga0242661_10251533 | 3300022717 | Soil | KDSVATVAGYCMEEAAGLSAVLGYRQRASRQNRKAGAA |
| Ga0242654_101216021 | 3300022726 | Soil | DGAVVAALSVSGPTTRMSRDGLPAVAGYCAEEAAALSAVLGYRQRGARQHRKAG |
| Ga0224564_10187083 | 3300024271 | Soil | TTRMTRDGMTTVAGYCAEEAVGLSAVLGYRQRAGKQNRKAGAA |
| Ga0247674_10165742 | 3300024275 | Soil | SVSGPTTRMNRDGLPAMAGYCAEEAAALSAVLGYRQRGARQHRKAG |
| Ga0179589_101230183 | 3300024288 | Vadose Zone Soil | DGLPAVAGYCAEEAAALAAVRGYRQRGARQHRKAG |
| Ga0207928_10638931 | 3300025494 | Arctic Peat Soil | EGAIAAAGHCADEAAGLSAVLGYRQRASKQNRKAGMS |
| Ga0207692_102778873 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | TTRMNRDGLPAVAGYCAEEAAALSAVLGYRQRGIRQSRKAGAA |
| Ga0207698_127214021 | 3300026142 | Corn Rhizosphere | RMNRDGLPAMAGYCAEEAAALSAVLGYRQRGARQHRKAG |
| Ga0209471_13042712 | 3300026318 | Soil | SVSGPTTRMSRDGLPAVAGYCAEEAAALSAVLGYRQRGARQNRKAG |
| Ga0207744_10247831 | 3300026927 | Tropical Forest Soil | SVSAPTTRMTRERVPGAAGHCVQEAVGLSAVLGYRQRAARQNRKAGAA |
| Ga0207800_10368671 | 3300027043 | Tropical Forest Soil | LSVSAPTTRMTRDRLTEAVGNCVAEAAGLSAVLGYRQRAARQARKAG |
| Ga0209113_10284081 | 3300027517 | Forest Soil | GAVVAALSVSGPTTRMNRDGLPAMAGYCAEEAAALSAVLGYRQRGARQHRKAG |
| Ga0209178_10543441 | 3300027725 | Agricultural Soil | LSVSGPTTRMNRDGLPAMAGYCAEEAAALSAVLGYRQRGARQHRKAG |
| Ga0209073_103425841 | 3300027765 | Agricultural Soil | LSVSGPTTRMNRDGLPAVAGYCAEEAAALSAVLGYRQRGTRQSRKAGAA |
| Ga0209177_100500043 | 3300027775 | Agricultural Soil | ALSVSGPTTRMNRDGLSAMAGYCAEEAAALSAVLGYRQRGARPHRKAG |
| Ga0209139_101698542 | 3300027795 | Bog Forest Soil | VVAALSVSAPAARMTRDRLTVAAGHCVAEAAGLSAVLGYRQRAARQTRKAG |
| Ga0209040_102110921 | 3300027824 | Bog Forest Soil | DRLTATAGHCVAEAAGLSAVLGYRQRAARQTRKAG |
| Ga0209040_102219853 | 3300027824 | Bog Forest Soil | DGVAAVAGYCAEEAAGLSAVLGYRQRASRQNRKAGAA |
| Ga0209517_103932321 | 3300027854 | Peatlands Soil | AVVAALSVSAPTNRMSRDGVAAVAGYCAEEAAGLSAVLGYRQRANRQTRKAG |
| Ga0209166_105502271 | 3300027857 | Surface Soil | VAALSVSAPATRMTRDRLTVAAGHCVAEAAGLSAVLGYRQRAARARKAG |
| Ga0209275_101064712 | 3300027884 | Soil | RDGLAAAAGQCTEEAAGLSAVLGYRQRAARQNRKAG |
| Ga0209488_102741152 | 3300027903 | Vadose Zone Soil | MNTIMPKCSAPAARMTRDRLTVAAGHCVAEAAGLSAVLGYRQRAARQTRKQG |
| Ga0209168_102657172 | 3300027986 | Surface Soil | SGPTTRMNRDGLPAVAGYCAEEAAGLSAVLGYRQRGIRQSRKAGAA |
| Ga0268264_107828203 | 3300028381 | Switchgrass Rhizosphere | TTRMKRDGLPAMAGYCAEEAAALSAVLGYRQRGARQHRKAG |
| Ga0302234_102831252 | 3300028773 | Palsa | LSVSAPAARMTRDRLTAAAGHCVAEAAGLSAVLGYRQRAARQTRKEG |
| Ga0222749_103792552 | 3300029636 | Soil | GLPAVAGYCAEEAAALSAVLGYRQRGIRQSRKAGAA |
| Ga0311369_103071381 | 3300029910 | Palsa | SVSGPASRLARDGLAAAAGQCAEEAAGLSAVLGYRQRAARQNRKAG |
| Ga0302176_101166543 | 3300030057 | Palsa | SVSAPAARMTRDRLTAAAGHCVAEAAGLSAVLGYRQRAARQTRKAG |
| Ga0311355_109638361 | 3300030580 | Palsa | NRMSREGAITAAGHCTDEAAALSAVLGYRQRASKQNRKAGMS |
| Ga0210287_11904801 | 3300030598 | Soil | RDRLTAAAGHCVTETAGLSAVLGYRQRAARQTRKAG |
| Ga0210268_12052721 | 3300030629 | Soil | AALSVSAPATRMTRDRVSATAGYCVAEAAGLSAVLGYRQRASRQNRKAGAA |
| Ga0265462_114971041 | 3300030738 | Soil | IRGYDGAVVAALSVSAPTTRMTRDGMTTVAGYCAEEAVGLSAVLGYRQRTSKQNRKAG |
| Ga0302311_110686482 | 3300030739 | Palsa | AIAAAGHCTDEAAALSAVLGYRQRASKQNRKAGMS |
| Ga0265461_107416123 | 3300030743 | Soil | PTNRMSRHEVAAAAEACTNEAASLSAVLGHRQRTARQTRKAG |
| Ga0302308_101711431 | 3300031027 | Palsa | RVVAALSVSGPASRLARDGLAAAAGQCTEEAAGLSAVLGYRQRAARQNRKAG |
| Ga0307498_100646993 | 3300031170 | Soil | FDGAVVAALSVSGPTTRMNRDGLPAMAGYCAEEAAALSAVLGYRQRGARPHRKAG |
| Ga0302324_1024886492 | 3300031236 | Palsa | APVNRMSREGAIAAAGHCTDEAAALSAVLGYRQRASKQNRKAGMS |
| Ga0302326_108813172 | 3300031525 | Palsa | RMTRDRLAAAAGHCVAEAAALSGALGYQRAAREPRKAG |
| Ga0302326_112678481 | 3300031525 | Palsa | GAIAAAGHCTDEAAALSAVLGYRQRASKQNRKAGMS |
| Ga0318573_100403541 | 3300031564 | Soil | TRMTRDRLTAAAGQCVGEAAGLSAVLGYRQRAARQTRKAGAA |
| Ga0318573_100794531 | 3300031564 | Soil | AVVAALSVSAPTTRMSQDGVATAAGYCAEESAGLSAVLGYRQRASRQNRKAGAA |
| Ga0318573_102361431 | 3300031564 | Soil | RERVPVAAGHCVQEAAGLSAVLGYRQRAARQNRKAGAA |
| Ga0318573_104186271 | 3300031564 | Soil | GYDGAVVAALSVSAPTTRMSGDSVATVAGYCAEEAAGLSAVLGYRQRAARQNRKAG |
| Ga0318573_107455452 | 3300031564 | Soil | TRDRLSTTAGHCVAEATGLSAVLGYRQRAARQTRKAGAA |
| Ga0310915_108106151 | 3300031573 | Soil | MNRDGLPAVAGYCAEEAAALSAVLGYRQRGARQSRKAGAA |
| Ga0318561_107969791 | 3300031679 | Soil | RMTRDRLSTTAGHCVAEATGLSAVLGYRQRAARQTRKAGAA |
| Ga0318572_109119641 | 3300031681 | Soil | DGAVVAALSVSAPTTRMSGDSVATVAGYCAEEAAGLSAVLGYRQRAARQNRKAG |
| Ga0318496_100210671 | 3300031713 | Soil | ALSVSAPTTRMTRERAPAAAGHCVQEAAGLSAVLGYRQRAARQTRKAGAA |
| Ga0307474_102110303 | 3300031718 | Hardwood Forest Soil | VAALSVSAPATRMTKERATVAAERCMEEAAGLSAVLGYRQRGAKNRKAGAA |
| Ga0318493_102502891 | 3300031723 | Soil | SQDSVATVAGYCTEEAAGLSAVLGYRQRASRQNRKAGAA |
| Ga0318494_102325741 | 3300031751 | Soil | TTRMNRDGLPAVAGYCAEEAAALSAVLGYRQRGARQSRKVGAA |
| Ga0318554_101287311 | 3300031765 | Soil | TTRMTRERAPAAAGHCVQEAAGLSAVLGYRQRAARQTRKAGAA |
| Ga0318509_101203393 | 3300031768 | Soil | PVDRLTAAAGQCVGEAAGLSAVLGYRQRAARQTRKAGAA |
| Ga0318526_102731541 | 3300031769 | Soil | RDRLTAAAGQCVGEAAGLSAVLGYRQRAARQTRKAGAA |
| Ga0318546_106552272 | 3300031771 | Soil | SLLILVVGYCTEEAAGLSAVLGYRHRAARQNRRAGVA |
| Ga0318498_101019373 | 3300031778 | Soil | TRDRLTATAGQCVGEAAGLSAVLGYRQRAARQTRKAGAA |
| Ga0318498_101595363 | 3300031778 | Soil | MNRDGLPAVAGYCAEEAAALSAVLGYRQRGARQSRKVGAA |
| Ga0318498_101893862 | 3300031778 | Soil | YDGAVVAALSVSAPTTRMSKDSVATVAGYCTEEAAGLSAVLGYRQRAGRQNRKAGAA |
| Ga0318498_105478561 | 3300031778 | Soil | RLTTTAGHCVAEATGLSAVLGYRQRAARQTRKAGAA |
| Ga0318552_102975031 | 3300031782 | Soil | TTRMTRDRLTTTAGHCVAEATGLSAVLGYRQRAARQTRKAGAA |
| Ga0318557_104885562 | 3300031795 | Soil | RDRLTATAGQCVGEAAGLSAVLGYRQRAARQTRKAGAA |
| Ga0318497_106577572 | 3300031805 | Soil | MTRERAPAAAGHCVQEAAGLSAVLGYRQRAARQTRKAGAA |
| Ga0318497_108271582 | 3300031805 | Soil | RDRLTTTAGHCVAEATGLSAVLGYRQRAARQTRKAGAA |
| Ga0318517_103886241 | 3300031835 | Soil | MTRDRLSTTAGHCVAEATGLSAVLGYRQRAARQTRKAGAA |
| Ga0318511_100115614 | 3300031845 | Soil | YDGAVIAALSVSGPTTRMNRDGLPAVAGYCAEEAAALSAVLGYRQRGARQSRKVGAA |
| Ga0318495_100544241 | 3300031860 | Soil | APTTRMTRERAPAAAGHCVQEAAGLSAVLGYRQRAARQTRKAGAA |
| Ga0318495_105134851 | 3300031860 | Soil | VAALSVSAPTTRMTRDRLSTTAGHCVAEATGLSAVLGYRQRAARQTRKAGAA |
| Ga0306919_104688481 | 3300031879 | Soil | GPTTRMNRDGLPAVAGYCAEEAAALSAVLGYRQRGARQSRKVGAA |
| Ga0318544_103993481 | 3300031880 | Soil | APTTRMTRDRLSTTAGHCVAEATGLSAVLGYRQRAARQTRKAGAA |
| Ga0316039_1045752 | 3300031891 | Soil | GMTTVAGYCAEEAVGLSAVLGYRQRAGKQNRKAGAA |
| Ga0318522_103877722 | 3300031894 | Soil | MSKDSVATVACYCTEEAAGLSAVLGYRQRASRQNRKAGAA |
| Ga0310913_105691631 | 3300031945 | Soil | AALSVSAPTTRMTRDRVTTVAGHCVAEAAGLSAVLGYRQRAARQTRKAG |
| Ga0318562_102931061 | 3300032008 | Soil | RDGLPAVAGYCAEEAAALSAVLGYRQRGARQSRKAGAA |
| Ga0318507_100499813 | 3300032025 | Soil | VVAALSVSAPTTRMTRDRLTGTAGHCVAEAAGLSAVLGYRQRAARQTRKAG |
| Ga0318507_101656291 | 3300032025 | Soil | ERVPVAAGHCVQEAAGLSAVLGYRQRTARQNRKAGAA |
| Ga0318559_105537091 | 3300032039 | Soil | TRERVPVAAGHCVQEAAGLSAVLGYRQRAARQNRKAGAA |
| Ga0318575_105017792 | 3300032055 | Soil | AVVAALSVSAPTTRMTRDRVTTVAGHCVAEAAGLSAVLGYRQRAARQTRKAG |
| Ga0318525_100344664 | 3300032089 | Soil | ALSVSAPTTRMTRDRLTATAGQCVGEAAGLSAVLGYRQRAARQTRKAGAA |
| Ga0318525_105250522 | 3300032089 | Soil | AALSVSAPTTRMSRDGLAVVAGYCAEEAAGLSAVLGYRQRAARQNRKAG |
| Ga0306920_1037008901 | 3300032261 | Soil | DSVATVAGYCAEEAAGLSAVLGYRQRAARQNRKAG |
| Ga0306920_1039723362 | 3300032261 | Soil | PTTRMSKDSVATVAGYCTEEAAGLSAVLGYRQRASRQNRKAGAA |
| Ga0335080_108169663 | 3300032828 | Soil | VSGPTTRMNRDGLPAVAGYCAEEAAALSAVLGYRQRGARQSRKAGAA |
| ⦗Top⦘ |