NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F030935

Metagenome Family F030935

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F030935
Family Type Metagenome
Number of Sequences 184
Average Sequence Length 47 residues
Representative Sequence ARRLAELVPGSELALVPHVKHMTFWDGDGALIALQDFLQRHPIQ
Number of Associated Samples 158
Number of Associated Scaffolds 184

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 1.74 %
% of genes near scaffold ends (potentially truncated) 90.76 %
% of genes from short scaffolds (< 2000 bps) 84.24 %
Associated GOLD sequencing projects 153
AlphaFold2 3D model prediction Yes
3D model pTM-score0.40

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (90.761 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil
(8.696 % of family members)
Environment Ontology (ENVO) Unclassified
(33.696 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(29.348 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 22.22%    β-sheet: 8.33%    Coil/Unstructured: 69.44%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.40
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 184 Family Scaffolds
PF13343SBP_bac_6 16.85
PF13452MaoC_dehydrat_N 4.35
PF00561Abhydrolase_1 4.35
PF09084NMT1 3.26
PF00535Glycos_transf_2 2.72
PF00528BPD_transp_1 2.17
PF13416SBP_bac_8 2.17
PF00676E1_dh 1.63
PF00005ABC_tran 1.63
PF10094DUF2332 1.09
PF00171Aldedh 0.54
PF07690MFS_1 0.54
PF12697Abhydrolase_6 0.54
PF12161HsdM_N 0.54
PF04909Amidohydro_2 0.54
PF02780Transketolase_C 0.54
PF12146Hydrolase_4 0.54
PF00378ECH_1 0.54
PF01609DDE_Tnp_1 0.54
PF00903Glyoxalase 0.54
PF02538Hydantoinase_B 0.54
PF13489Methyltransf_23 0.54
PF03401TctC 0.54

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 184 Family Scaffolds
COG0715ABC-type nitrate/sulfonate/bicarbonate transport system, periplasmic componentInorganic ion transport and metabolism [P] 3.26
COG4521ABC-type taurine transport system, periplasmic componentInorganic ion transport and metabolism [P] 3.26
COG05672-oxoglutarate dehydrogenase complex, dehydrogenase (E1) component, and related enzymesEnergy production and conversion [C] 1.63
COG1071TPP-dependent pyruvate or acetoin dehydrogenase subunit alphaEnergy production and conversion [C] 1.63
COG0146N-methylhydantoinase B/oxoprolinase/acetone carboxylase, alpha subunitAmino acid transport and metabolism [E] 1.09
COG0014Gamma-glutamyl phosphate reductaseAmino acid transport and metabolism [E] 0.54
COG1012Acyl-CoA reductase or other NAD-dependent aldehyde dehydrogenaseLipid transport and metabolism [I] 0.54
COG3039Transposase and inactivated derivatives, IS5 familyMobilome: prophages, transposons [X] 0.54
COG3181Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctCEnergy production and conversion [C] 0.54
COG3293TransposaseMobilome: prophages, transposons [X] 0.54
COG3385IS4 transposase InsGMobilome: prophages, transposons [X] 0.54
COG4230Delta 1-pyrroline-5-carboxylate dehydrogenaseAmino acid transport and metabolism [E] 0.54
COG5421TransposaseMobilome: prophages, transposons [X] 0.54
COG5433Predicted transposase YbfD/YdcC associated with H repeatsMobilome: prophages, transposons [X] 0.54
COG5659SRSO17 transposaseMobilome: prophages, transposons [X] 0.54


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms90.76 %
UnclassifiedrootN/A9.24 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2170459014|G1P06HT01C69KUAll Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium610Open in IMG/M
3300000033|ICChiseqgaiiDRAFT_c2160206All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium773Open in IMG/M
3300000364|INPhiseqgaiiFebDRAFT_101839739All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium532Open in IMG/M
3300000364|INPhiseqgaiiFebDRAFT_101841766All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium826Open in IMG/M
3300000364|INPhiseqgaiiFebDRAFT_103935741All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria559Open in IMG/M
3300000559|F14TC_103151774All Organisms → cellular organisms → Bacteria779Open in IMG/M
3300000574|JGI1357J11328_10171806All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium600Open in IMG/M
3300000597|AF_2010_repII_A1DRAFT_10094558All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria740Open in IMG/M
3300000787|JGI11643J11755_11234703All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium584Open in IMG/M
3300000891|JGI10214J12806_10139215All Organisms → cellular organisms → Bacteria567Open in IMG/M
3300000953|JGI11615J12901_12001038All Organisms → cellular organisms → Bacteria759Open in IMG/M
3300001372|YBBDRAFT_1081047All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium821Open in IMG/M
3300002147|JGI24793J26633_1012635All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales2457Open in IMG/M
3300002147|JGI24793J26633_1061468All Organisms → cellular organisms → Bacteria620Open in IMG/M
3300002160|JGI24797J26694_1042556All Organisms → cellular organisms → Bacteria913Open in IMG/M
3300004114|Ga0062593_101789946All Organisms → cellular organisms → Bacteria674Open in IMG/M
3300004156|Ga0062589_100353802All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1167Open in IMG/M
3300004157|Ga0062590_101144017All Organisms → cellular organisms → Bacteria754Open in IMG/M
3300004463|Ga0063356_102443429All Organisms → cellular organisms → Bacteria800Open in IMG/M
3300004463|Ga0063356_103275441All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Curvibacter → Curvibacter gracilis698Open in IMG/M
3300004463|Ga0063356_104019682All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria633Open in IMG/M
3300004463|Ga0063356_104836258All Organisms → cellular organisms → Bacteria579Open in IMG/M
3300004782|Ga0062382_10567298All Organisms → cellular organisms → Bacteria552Open in IMG/M
3300005093|Ga0062594_102464962All Organisms → cellular organisms → Bacteria570Open in IMG/M
3300005167|Ga0066672_10920747All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria540Open in IMG/M
3300005178|Ga0066688_10478642All Organisms → cellular organisms → Bacteria803Open in IMG/M
3300005181|Ga0066678_10357848All Organisms → cellular organisms → Bacteria963Open in IMG/M
3300005290|Ga0065712_10004636All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales6158Open in IMG/M
3300005290|Ga0065712_10091366All Organisms → cellular organisms → Bacteria2344Open in IMG/M
3300005329|Ga0070683_101629737All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium620Open in IMG/M
3300005332|Ga0066388_108007652All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium528Open in IMG/M
3300005333|Ga0070677_10501083All Organisms → cellular organisms → Bacteria658Open in IMG/M
3300005467|Ga0070706_101882710All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria543Open in IMG/M
3300005536|Ga0070697_102044115All Organisms → cellular organisms → Bacteria513Open in IMG/M
3300005546|Ga0070696_100327526All Organisms → cellular organisms → Bacteria1180Open in IMG/M
3300005558|Ga0066698_10213803All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1322Open in IMG/M
3300005564|Ga0070664_102134731All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium532Open in IMG/M
3300005618|Ga0068864_102584451All Organisms → cellular organisms → Bacteria514Open in IMG/M
3300005713|Ga0066905_101058337All Organisms → cellular organisms → Bacteria718Open in IMG/M
3300005829|Ga0074479_10462323All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium507Open in IMG/M
3300005836|Ga0074470_10485146All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium850Open in IMG/M
3300006853|Ga0075420_101007437All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium717Open in IMG/M
3300006853|Ga0075420_101118705All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium677Open in IMG/M
3300006853|Ga0075420_101796391All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria524Open in IMG/M
3300006871|Ga0075434_102384179Not Available531Open in IMG/M
3300006881|Ga0068865_101274599All Organisms → cellular organisms → Bacteria653Open in IMG/M
3300006904|Ga0075424_101340121All Organisms → cellular organisms → Bacteria761Open in IMG/M
3300006918|Ga0079216_10012039All Organisms → cellular organisms → Bacteria2988Open in IMG/M
3300006918|Ga0079216_10155979All Organisms → cellular organisms → Bacteria → Proteobacteria1196Open in IMG/M
3300009090|Ga0099827_11291946All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria635Open in IMG/M
3300009100|Ga0075418_10101984All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium3047Open in IMG/M
3300009147|Ga0114129_10641178All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria1372Open in IMG/M
3300009148|Ga0105243_10967170All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium852Open in IMG/M
3300009156|Ga0111538_11361961All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium895Open in IMG/M
3300009156|Ga0111538_13715384All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium529Open in IMG/M
3300009162|Ga0075423_11871203All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium648Open in IMG/M
3300009167|Ga0113563_12070916All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria681Open in IMG/M
3300009168|Ga0105104_10684317All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium589Open in IMG/M
3300009176|Ga0105242_12850464All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium534Open in IMG/M
3300009176|Ga0105242_13210692All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium508Open in IMG/M
3300009609|Ga0105347_1002532All Organisms → cellular organisms → Bacteria → Proteobacteria7134Open in IMG/M
3300009792|Ga0126374_10745288All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium742Open in IMG/M
3300009792|Ga0126374_11505843All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria552Open in IMG/M
3300009816|Ga0105076_1030179All Organisms → cellular organisms → Bacteria955Open in IMG/M
3300010043|Ga0126380_10517644All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria920Open in IMG/M
3300010046|Ga0126384_11691456All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria598Open in IMG/M
3300010047|Ga0126382_10380747All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1093Open in IMG/M
3300010047|Ga0126382_10398296All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1073Open in IMG/M
3300010304|Ga0134088_10281655All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria802Open in IMG/M
3300010359|Ga0126376_11834354All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium645Open in IMG/M
3300010362|Ga0126377_11526000All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria742Open in IMG/M
3300010366|Ga0126379_12907765All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium573Open in IMG/M
3300010376|Ga0126381_100699620All Organisms → cellular organisms → Bacteria1449Open in IMG/M
3300010400|Ga0134122_10391093All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1225Open in IMG/M
3300011417|Ga0137326_1142261All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria554Open in IMG/M
3300011432|Ga0137428_1004253All Organisms → cellular organisms → Bacteria → Proteobacteria4401Open in IMG/M
3300011435|Ga0137426_1062744All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium995Open in IMG/M
3300011437|Ga0137429_1061056Not Available1111Open in IMG/M
3300011437|Ga0137429_1115128All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium823Open in IMG/M
3300012038|Ga0137431_1105389All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium793Open in IMG/M
3300012096|Ga0137389_11670097All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria533Open in IMG/M
3300012202|Ga0137363_10007573All Organisms → cellular organisms → Bacteria6811Open in IMG/M
3300012351|Ga0137386_10086182All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria2205Open in IMG/M
3300012477|Ga0157336_1028883Not Available545Open in IMG/M
3300012493|Ga0157355_1001325All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1265Open in IMG/M
3300012685|Ga0137397_10807348All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium696Open in IMG/M
3300012910|Ga0157308_10299124All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium588Open in IMG/M
3300012948|Ga0126375_10631982All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium823Open in IMG/M
3300012948|Ga0126375_11461892All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium582Open in IMG/M
3300012960|Ga0164301_11226843All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium604Open in IMG/M
3300012972|Ga0134077_10072413All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria1302Open in IMG/M
3300013296|Ga0157374_10097695All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium2810Open in IMG/M
3300013306|Ga0163162_12183048All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium636Open in IMG/M
3300014311|Ga0075322_1110080All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium650Open in IMG/M
3300014868|Ga0180088_1048448All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium730Open in IMG/M
3300014883|Ga0180086_1065113All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria893Open in IMG/M
3300014884|Ga0180104_1274915All Organisms → cellular organisms → Bacteria → Proteobacteria500Open in IMG/M
3300014885|Ga0180063_1185887All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium666Open in IMG/M
3300015241|Ga0137418_10768479All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria727Open in IMG/M
3300015251|Ga0180070_1022255All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria762Open in IMG/M
3300015256|Ga0180073_1110807All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria592Open in IMG/M
3300015259|Ga0180085_1021722All Organisms → cellular organisms → Bacteria → Proteobacteria1784Open in IMG/M
3300015264|Ga0137403_10974913All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria695Open in IMG/M
3300015372|Ga0132256_100176249All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium2169Open in IMG/M
3300015372|Ga0132256_100550054All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1267Open in IMG/M
3300015373|Ga0132257_103240382All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium593Open in IMG/M
3300015374|Ga0132255_104388243All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria598Open in IMG/M
3300016319|Ga0182033_11462615All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria616Open in IMG/M
3300017659|Ga0134083_10251634All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium739Open in IMG/M
3300018031|Ga0184634_10074851All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1445Open in IMG/M
3300018052|Ga0184638_1124018All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium943Open in IMG/M
3300018053|Ga0184626_10360983All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium589Open in IMG/M
3300018072|Ga0184635_10125963All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1019Open in IMG/M
3300018079|Ga0184627_10445141All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria673Open in IMG/M
3300018084|Ga0184629_10108415All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria1367Open in IMG/M
3300018084|Ga0184629_10185764All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria1069Open in IMG/M
3300018084|Ga0184629_10420559All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium701Open in IMG/M
3300018422|Ga0190265_11027913Not Available945Open in IMG/M
3300018429|Ga0190272_10545696Not Available999Open in IMG/M
3300018481|Ga0190271_10734499All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria1111Open in IMG/M
3300019889|Ga0193743_1104434All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria1056Open in IMG/M
3300020060|Ga0193717_1049075All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1507Open in IMG/M
3300020061|Ga0193716_1205898All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium744Open in IMG/M
3300020084|Ga0194110_10624687All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria679Open in IMG/M
3300021064|Ga0206225_1020236All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria1206Open in IMG/M
3300021088|Ga0210404_10248657All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium967Open in IMG/M
3300022534|Ga0224452_1195665All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium622Open in IMG/M
3300022694|Ga0222623_10076933All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1294Open in IMG/M
3300022756|Ga0222622_10700520All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium736Open in IMG/M
3300022756|Ga0222622_11356423All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria523Open in IMG/M
3300024232|Ga0247664_1163547All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium525Open in IMG/M
3300024241|Ga0233392_1006299All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1047Open in IMG/M
3300025157|Ga0209399_10021352All Organisms → cellular organisms → Bacteria → Proteobacteria2700Open in IMG/M
3300025164|Ga0209521_10031823All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium3670Open in IMG/M
3300025164|Ga0209521_10446448All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → environmental samples → uncultured delta proteobacterium Rifle_16ft_4_minimus_1997692Open in IMG/M
3300025319|Ga0209520_10636260All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium609Open in IMG/M
3300025537|Ga0210061_1044244All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium750Open in IMG/M
3300025893|Ga0207682_10610697All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium514Open in IMG/M
3300025899|Ga0207642_11125288All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium508Open in IMG/M
3300025911|Ga0207654_10514443All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium847Open in IMG/M
3300025914|Ga0207671_11227466All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium586Open in IMG/M
3300025922|Ga0207646_11157912All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria679Open in IMG/M
3300025953|Ga0210068_1061356All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria585Open in IMG/M
3300025971|Ga0210102_1002358All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium4031Open in IMG/M
3300026540|Ga0209376_1346445All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria562Open in IMG/M
3300026550|Ga0209474_10510097All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria609Open in IMG/M
3300027364|Ga0209967_1068319All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium554Open in IMG/M
3300027511|Ga0209843_1078883All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria564Open in IMG/M
3300027654|Ga0209799_1017381All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1570Open in IMG/M
3300027691|Ga0209485_1015951All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1661Open in IMG/M
3300027840|Ga0209683_10455839All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria586Open in IMG/M
3300027862|Ga0209701_10192884All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria1219Open in IMG/M
3300030006|Ga0299907_10080462All Organisms → cellular organisms → Bacteria2649Open in IMG/M
3300031538|Ga0310888_10313460All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium900Open in IMG/M
3300031538|Ga0310888_10774724All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium593Open in IMG/M
3300031720|Ga0307469_10404249All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1167Open in IMG/M
3300031820|Ga0307473_10612672All Organisms → cellular organisms → Bacteria753Open in IMG/M
3300031901|Ga0307406_10039109All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium2941Open in IMG/M
3300031965|Ga0326597_10189860All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium2419Open in IMG/M
3300032004|Ga0307414_11033741All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium757Open in IMG/M
3300032005|Ga0307411_12148954All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria523Open in IMG/M
3300032163|Ga0315281_10406449All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria1465Open in IMG/M
3300032174|Ga0307470_10236004All Organisms → cellular organisms → Bacteria1197Open in IMG/M
3300033233|Ga0334722_11154529All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria543Open in IMG/M
3300033433|Ga0326726_10288058All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria1538Open in IMG/M
3300033475|Ga0310811_10454128All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1369Open in IMG/M
3300033475|Ga0310811_10835368All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium850Open in IMG/M
3300033480|Ga0316620_10256637All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1501Open in IMG/M
3300033551|Ga0247830_11389345All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium561Open in IMG/M
3300033811|Ga0364924_148841All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium551Open in IMG/M
3300034177|Ga0364932_0173833All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria819Open in IMG/M
3300034417|Ga0364941_112253All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium664Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Soil8.70%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil7.07%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil7.07%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil6.52%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere5.98%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil4.89%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment4.35%
Arabidopsis Thaliana RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere2.72%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment2.17%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil2.17%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil2.17%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere2.17%
SedimentEnvironmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment2.17%
Natural And Restored WetlandsEnvironmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands1.63%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil1.63%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil1.63%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil1.63%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil1.63%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil1.63%
Rice Paddy SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil1.63%
Host-AssociatedHost-Associated → Porifera → Unclassified → Unclassified → Unclassified → Host-Associated1.63%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere1.63%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere1.63%
SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Sediment1.09%
Wetland SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Wetland Sediment1.09%
Sediment (Intertidal)Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal)1.09%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil1.09%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil1.09%
Natural And Restored WetlandsEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands1.09%
Groundwater SandEnvironmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand1.09%
Deep Subsurface SedimentEnvironmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface Sediment1.09%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere1.09%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere1.09%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere1.09%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere1.09%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere1.09%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere1.09%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment0.54%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake0.54%
Freshwater WetlandsEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands0.54%
GroundwaterEnvironmental → Aquatic → Freshwater → Groundwater → Contaminated → Groundwater0.54%
Marine EstuarineEnvironmental → Aquatic → Marine → Intertidal Zone → Sediment → Marine Estuarine0.54%
Thermal SpringsEnvironmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Thermal Springs0.54%
Unplanted SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Unplanted Soil0.54%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil0.54%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil0.54%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil0.54%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil0.54%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere0.54%
Peat SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil0.54%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.54%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere0.54%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.54%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.54%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere0.54%
Switchgrass, Maize And Mischanthus LitterEngineered → Solid Waste → Grass → Composting → Unclassified → Switchgrass, Maize And Mischanthus Litter0.54%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2170459014Litter degradation PV2EngineeredOpen in IMG/M
3300000033Soil microbial communities from Great Prairies - Iowa, Continuous Corn soilEnvironmentalOpen in IMG/M
3300000364Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300000559Amended soil microbial communities from Kansas Great Prairies, USA - control no BrdU total DNA F1.4 TC clc assemlyEnvironmentalOpen in IMG/M
3300000574Subsurface groundwater microbial communities from S. Glens Falls, New York, USA - GMW46 contaminated, 5.4 mEnvironmentalOpen in IMG/M
3300000597Forest soil microbial communities from Amazon forest - 2010 replicate II A1EnvironmentalOpen in IMG/M
3300000787Soil microbial communities from Great Prairies - Iowa, Continuous Corn soilEnvironmentalOpen in IMG/M
3300000891Soil microbial communities from Great Prairies - Wisconsin, Continuous corn soilEnvironmentalOpen in IMG/M
3300000953Soil microbial communities from Great Prairies - Kansas Corn soilEnvironmentalOpen in IMG/M
3300001372YB-Back-sedEnvironmentalOpen in IMG/M
3300002147Host-associated microbial community of the marine sponge Aplysina aerophoba from Gulf of Piran - sponge mesohyl, lysed by freeze-thaw cyclingHost-AssociatedOpen in IMG/M
3300002160Host-associated microbial community of the marine sponge Aplysina aerophoba from Gulf of Piran - sponge pinacoderm, lysed by proteinase K digestionHost-AssociatedOpen in IMG/M
3300004114Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5EnvironmentalOpen in IMG/M
3300004156Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1EnvironmentalOpen in IMG/M
3300004157Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2EnvironmentalOpen in IMG/M
3300004463Combined assembly of Arabidopsis thaliana microbial communitiesHost-AssociatedOpen in IMG/M
3300004782Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare2FreshEnvironmentalOpen in IMG/M
3300005093Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All BlocksEnvironmentalOpen in IMG/M
3300005167Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121EnvironmentalOpen in IMG/M
3300005178Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137EnvironmentalOpen in IMG/M
3300005181Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127EnvironmentalOpen in IMG/M
3300005290Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1Host-AssociatedOpen in IMG/M
3300005329Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaGEnvironmentalOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005333Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaGHost-AssociatedOpen in IMG/M
3300005467Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaGEnvironmentalOpen in IMG/M
3300005536Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaGEnvironmentalOpen in IMG/M
3300005546Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaGEnvironmentalOpen in IMG/M
3300005558Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147EnvironmentalOpen in IMG/M
3300005564Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaGHost-AssociatedOpen in IMG/M
3300005618Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2Host-AssociatedOpen in IMG/M
3300005713Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2)EnvironmentalOpen in IMG/M
3300005829Microbial communities from Cathlamet Bay sediment, Columbia River estuary, Oregon - S.190_CBCEnvironmentalOpen in IMG/M
3300005836Microbial communities from Youngs Bay mouth sediment, Columbia River estuary, Oregon - S.42_YBBEnvironmentalOpen in IMG/M
3300005879Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_25C_0N_301EnvironmentalOpen in IMG/M
3300005881Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_25C_0N_202EnvironmentalOpen in IMG/M
3300006853Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD4Host-AssociatedOpen in IMG/M
3300006871Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3Host-AssociatedOpen in IMG/M
3300006881Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2Host-AssociatedOpen in IMG/M
3300006904Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3Host-AssociatedOpen in IMG/M
3300006918Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS100EnvironmentalOpen in IMG/M
3300009090Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaGEnvironmentalOpen in IMG/M
3300009100Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2Host-AssociatedOpen in IMG/M
3300009147Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2)Host-AssociatedOpen in IMG/M
3300009148Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaGHost-AssociatedOpen in IMG/M
3300009156Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009162Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2Host-AssociatedOpen in IMG/M
3300009167Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 3 metaG - Illumina Assembly (version 2)EnvironmentalOpen in IMG/M
3300009168Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 19-21cm September2015EnvironmentalOpen in IMG/M
3300009176Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaGHost-AssociatedOpen in IMG/M
3300009609Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT890EnvironmentalOpen in IMG/M
3300009792Tropical forest soil microbial communities from Panama - MetaG Plot_12EnvironmentalOpen in IMG/M
3300009816Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_0_10EnvironmentalOpen in IMG/M
3300010043Tropical forest soil microbial communities from Panama - MetaG Plot_26EnvironmentalOpen in IMG/M
3300010046Tropical forest soil microbial communities from Panama - MetaG Plot_36EnvironmentalOpen in IMG/M
3300010047Tropical forest soil microbial communities from Panama - MetaG Plot_30EnvironmentalOpen in IMG/M
3300010304Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09182015EnvironmentalOpen in IMG/M
3300010359Tropical forest soil microbial communities from Panama - MetaG Plot_15EnvironmentalOpen in IMG/M
3300010362Tropical forest soil microbial communities from Panama - MetaG Plot_22EnvironmentalOpen in IMG/M
3300010366Tropical forest soil microbial communities from Panama - MetaG Plot_24EnvironmentalOpen in IMG/M
3300010376Tropical forest soil microbial communities from Panama - MetaG Plot_28EnvironmentalOpen in IMG/M
3300010400Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2EnvironmentalOpen in IMG/M
3300010403Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3EnvironmentalOpen in IMG/M
3300011417Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT500_2EnvironmentalOpen in IMG/M
3300011420Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT199_2EnvironmentalOpen in IMG/M
3300011432Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT718_2EnvironmentalOpen in IMG/M
3300011435Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT660_2EnvironmentalOpen in IMG/M
3300011437Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT736_2EnvironmentalOpen in IMG/M
3300012038Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT800_2EnvironmentalOpen in IMG/M
3300012096Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaGEnvironmentalOpen in IMG/M
3300012159Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT500_2EnvironmentalOpen in IMG/M
3300012202Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaGEnvironmentalOpen in IMG/M
3300012351Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaGEnvironmentalOpen in IMG/M
3300012477Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.3.yng.040610Host-AssociatedOpen in IMG/M
3300012493Unplanted soil (control) microbial communities from North Carolina - M.Soil.10.yng.090610EnvironmentalOpen in IMG/M
3300012685Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaGEnvironmentalOpen in IMG/M
3300012910Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S198-509B-2EnvironmentalOpen in IMG/M
3300012922Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaGEnvironmentalOpen in IMG/M
3300012948Tropical forest soil microbial communities from Panama - MetaG Plot_14EnvironmentalOpen in IMG/M
3300012960Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MGEnvironmentalOpen in IMG/M
3300012972Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_24_1 metaGEnvironmentalOpen in IMG/M
3300013296Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaGHost-AssociatedOpen in IMG/M
3300013306Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaGHost-AssociatedOpen in IMG/M
3300014268Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNE_CattailA_D1EnvironmentalOpen in IMG/M
3300014311Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailB_D1EnvironmentalOpen in IMG/M
3300014868Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT830_16_10DEnvironmentalOpen in IMG/M
3300014883Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT760_16_10DEnvironmentalOpen in IMG/M
3300014884Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT730_16_1DaEnvironmentalOpen in IMG/M
3300014885Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLIBT47_16_10DEnvironmentalOpen in IMG/M
3300015241Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300015251Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT293_16_10DEnvironmentalOpen in IMG/M
3300015256Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT333_16_10DEnvironmentalOpen in IMG/M
3300015259Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT730_16_10DEnvironmentalOpen in IMG/M
3300015264Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300015372Soil combined assemblyHost-AssociatedOpen in IMG/M
3300015373Combined assembly of cpr5 rhizosphereHost-AssociatedOpen in IMG/M
3300015374Col-0 rhizosphere combined assemblyHost-AssociatedOpen in IMG/M
3300016319Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00HEnvironmentalOpen in IMG/M
3300017659Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_5_24_1 metaGEnvironmentalOpen in IMG/M
3300018031Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b1EnvironmentalOpen in IMG/M
3300018052Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b2EnvironmentalOpen in IMG/M
3300018053Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_b1EnvironmentalOpen in IMG/M
3300018072Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b2EnvironmentalOpen in IMG/M
3300018079Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_127_b1EnvironmentalOpen in IMG/M
3300018084Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_b1EnvironmentalOpen in IMG/M
3300018422Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 TEnvironmentalOpen in IMG/M
3300018429Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 TEnvironmentalOpen in IMG/M
3300018481Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 356 TEnvironmentalOpen in IMG/M
3300019889Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L2c2EnvironmentalOpen in IMG/M
3300020060Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2c2EnvironmentalOpen in IMG/M
3300020061Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2c1EnvironmentalOpen in IMG/M
3300020084Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015032 Kigoma Deep Cast 1200mEnvironmentalOpen in IMG/M
3300021064Subsurface sediment microbial communities from Mancos shale, Colorado, United States - Mancos B2EnvironmentalOpen in IMG/M
3300021088Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-MEnvironmentalOpen in IMG/M
3300022534Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30_b1EnvironmentalOpen in IMG/M
3300022694Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30_coexEnvironmentalOpen in IMG/M
3300022756Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1EnvironmentalOpen in IMG/M
3300024232Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK05EnvironmentalOpen in IMG/M
3300024241Subsurface microbial communities from Mancos shale, Colorado, United States - Mancos A_50_July_PBEnvironmentalOpen in IMG/M
3300025157Hot spring microbial communities from Beatty, Nevada to study Microbial Dark Matter (Phase II) - OV2 TP3 (SPAdes)EnvironmentalOpen in IMG/M
3300025164Soil microbial communities from Rifle, Colorado, USA - sediment 19ft 4EnvironmentalOpen in IMG/M
3300025319Soil microbial communities from Rifle, Colorado, USA - sediment 16ft 1EnvironmentalOpen in IMG/M
3300025537Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailC_D1 (SPAdes)EnvironmentalOpen in IMG/M
3300025893Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025899Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025911Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025914Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025922Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025953Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushOxbow_ThreeSqA_D2 (SPAdes)EnvironmentalOpen in IMG/M
3300025971Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushOxbow_ThreeSqC_D2 (SPAdes)EnvironmentalOpen in IMG/M
3300026011Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_25C_0N_301 (SPAdes)EnvironmentalOpen in IMG/M
3300026540Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 (SPAdes)EnvironmentalOpen in IMG/M
3300026550Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 (SPAdes)EnvironmentalOpen in IMG/M
3300027364Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes)Host-AssociatedOpen in IMG/M
3300027511Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_20_30 (SPAdes)EnvironmentalOpen in IMG/M
3300027654Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 MoBio (SPAdes)EnvironmentalOpen in IMG/M
3300027691Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS100 (SPAdes)EnvironmentalOpen in IMG/M
3300027840Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare2Fresh (SPAdes)EnvironmentalOpen in IMG/M
3300027862Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300030006Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT152D67EnvironmentalOpen in IMG/M
3300031538Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D1EnvironmentalOpen in IMG/M
3300031720Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515EnvironmentalOpen in IMG/M
3300031820Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515EnvironmentalOpen in IMG/M
3300031901Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2Host-AssociatedOpen in IMG/M
3300031965Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT100D185EnvironmentalOpen in IMG/M
3300032004Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3Host-AssociatedOpen in IMG/M
3300032005Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1Host-AssociatedOpen in IMG/M
3300032163Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G07_0EnvironmentalOpen in IMG/M
3300032174Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05EnvironmentalOpen in IMG/M
3300033233Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C3_bottomEnvironmentalOpen in IMG/M
3300033433Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MNEnvironmentalOpen in IMG/M
3300033475Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YCEnvironmentalOpen in IMG/M
3300033480Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D5_BEnvironmentalOpen in IMG/M
3300033551Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day5EnvironmentalOpen in IMG/M
3300033811Sediment microbial communities from East River floodplain, Colorado, United States - 28_j17EnvironmentalOpen in IMG/M
3300034177Sediment microbial communities from East River floodplain, Colorado, United States - 17_j17EnvironmentalOpen in IMG/M
3300034354Sediment microbial communities from East River floodplain, Colorado, United States - 23_s17EnvironmentalOpen in IMG/M
3300034417Sediment microbial communities from East River floodplain, Colorado, United States - 17_s17EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
2PV_038332402170459014Switchgrass, Maize And Mischanthus LitterRGSTPVGTARRLGELVPGAELALVPGVRHMTFWDGDGALKALQDFLARYPIRRT
ICChiseqgaiiDRAFT_216020613300000033SoilDVNRGGSTPVGTARKLGELVPGCELALVPNVKXMTFWDGDGALXALQDFLSRHPIR*
INPhiseqgaiiFebDRAFT_10183973913300000364SoilADDVNRGGSTPVGTARKLGELVPGSELALVPNVKHMTFWDGDGALIALQDFLQRHRIQ*
INPhiseqgaiiFebDRAFT_10184176623300000364SoilRLGELVPGAELALVPGVRHMTFWDGDGALKVLQDFLARHPIGDRQH*
INPhiseqgaiiFebDRAFT_10393574113300000364SoilVGTAKRLAELTLGSELFLIPNTKHMTFWDGAGGVNALQEFLLRHPMDSGR*
F14TC_10315177423300000559SoilGTARRLGELVPGAELALVPGVRHMTFWDGDGALLALRNFLEHHPVG*
JGI1357J11328_1017180613300000574GroundwaterKLGELVPGCELALVPGVKHMTFWDGDGALHALQDFLARHPIRK*
AF_2010_repII_A1DRAFT_1009455823300000597Forest SoilELALVPGVKHMTFWDSTAALAALEDFLARHPIAS*
JGI11643J11755_1123470323300000787SoilDDVNRGGSTPVGTARKLGELVPGCELALVPNVKXMTFWDGDGALXALQDFLSRHPIR*
JGI10214J12806_1013921513300000891SoilGSTPAATAKRLAPLIPGAELALIPNTRHMTFWDGDGALIALQDFLARHPIGRH*
JGI11615J12901_1200103813300000953SoilDDVNRGGSTPAGTARKLADLVPGCELALVPEVKHMTFWDGDGALMALESFLRRHPIR*
YBBDRAFT_108104723300001372Marine EstuarineGSTPVGTARKLGELVPGCELALVPDVKHMTFWDGDGALQALQDFLARYPINGS*
JGI24793J26633_101263513300002147Host-AssociatedRQGSTPVDTARRLGQATPGAELALIPGVRHMTFWDGTGAIEALEDFLARHPIG*
JGI24793J26633_106146813300002147Host-AssociatedVGTARMLGQAIPGAELALIPGVRHMTFWDGTGALTALQDFLKRHPIQ*
JGI24797J26694_104255623300002160Host-AssociatedGTARMLGQAIPGAELALIPGVRHMTFWDGTGALTALQDFLKRHPIQ*
Ga0062593_10178994623300004114SoilGTARKLSEMVPGCELALVPNVKHMTFWDGDGALHALEEFLLRHPIGDI*
Ga0062589_10035380213300004156SoilARRLAELVFGSELALVPDVKHMTFWDGEGALIALQNFLQRHPIR*
Ga0062590_10114401713300004157SoilVGTARKLAELLPGCELALVPSVKHMTFWDGDGALIALQDFLGRHPIGGS*
Ga0063356_10244342913300004463Arabidopsis Thaliana RhizosphereNRGGSTPVATARRLAELVPGSELVLVPNVKHMTFWDGDGALVALENFLQRHSIH*
Ga0063356_10327544113300004463Arabidopsis Thaliana RhizosphereLRRRSAELTPGAELCLVPNTKHMTFWDGSGGLTALEEFLLRHPIGHRGKHSV*
Ga0063356_10401968223300004463Arabidopsis Thaliana RhizosphereGSTPEATARRLAPLITGAELALIPGVRHMTFWDGDGAVKTLQEFIGRHPIGPK*
Ga0063356_10483625813300004463Arabidopsis Thaliana RhizosphereGSTPVGTARKLAELLPGCELALVPSVKHMTFWDGDGALIALQDFLGRHPIGGS*
Ga0062382_1056729823300004782Wetland SedimentARRLAPLIPGAELALVPGVRHMTFWDGDGALKTLQDFIGRHPIDVK*
Ga0062594_10246496213300005093SoilGSTPVGTARKLSEMVPGCELALVPNVKHMTFWDGDGALHALEEFLLRHPIGDI*
Ga0066672_1092074723300005167SoilGSTPVGTARRLGELVAGAELALIPGVRHMTFWDGDGALLALRNFLEHHPVG*
Ga0066688_1047864213300005178SoilGGSTPVGTARKLAERVPGCELALVPDVKHMTFWDGDGALIALEDFLQRHRIQ*
Ga0066678_1035784823300005181SoilELIPSAELILVPGVKHMTFWDGSAALEALQDFLARHPIGTS*
Ga0065712_1000463613300005290Miscanthus RhizosphereTARRLAELVPGCERALIPGVRHMTFWDGDGALIALQKFLQGHPIHA*
Ga0065712_1009136643300005290Miscanthus RhizosphereKRLAELVPGAELALVPETRHMTFWDGTGALDALLHFLNRHPMEPK*
Ga0070683_10162973713300005329Corn RhizosphereVGTARRLAELVPGCERALIPGVRHMTFWDGDGALIALQKFLQGHPIHA*
Ga0066388_10800765223300005332Tropical Forest SoilVPGAELALVPGVRHMTFWDGDGALKILQDFLARHPIRRS*
Ga0070677_1050108333300005333Miscanthus RhizosphereVGTARRLAELVPGCERALIPGVRHMTFWDGDGALIALQDFLQRHRMGG*
Ga0070706_10188271013300005467Corn, Switchgrass And Miscanthus RhizosphereGSTPVGTARRLGELVPGAELALVPGVKHMTFWDSTGALAALDDFLARHPIVS*
Ga0070697_10204411523300005536Corn, Switchgrass And Miscanthus RhizosphereDVNRGGSTPVGTARKLAERVPGCELALVPDVKHMTFWDGDGALIALEDFLQRHRIQ*
Ga0070696_10032752613300005546Corn, Switchgrass And Miscanthus RhizosphereARRLAELVPGCERALIPGVRHMTFWDGDGALIALQDFLQRHPIGG*
Ga0066698_1021380333300005558SoilCEVALIPGVRHMTFWDSDGALTALQDFLERHPINRT*
Ga0070664_10213473123300005564Corn RhizosphereCERALIPGVRHMTFWDGDGALIALQKFLQSHPIHA*
Ga0068864_10258445113300005618Switchgrass RhizosphereDVNRRGSTPVGTARRLAELVPGCERALIPGVRHMTFWDGDGALIALQKFLQGHPIHA*
Ga0066905_10105833723300005713Tropical Forest SoilVGTARRLAELTPGCELFLIPNVKHMTFWDGTGGLAALEHFLVRHPIGASR*
Ga0066905_10224849723300005713Tropical Forest SoilAKLALVPGVKHMTFWDGTGALAALEDFLARHPIAS*
Ga0074479_1046232323300005829Sediment (Intertidal)RGGSTPVGTARKLGELVPGCELALVPNVKHMTFWDGDGALHALQEFMLRHPIGGI*
Ga0074470_1048514613300005836Sediment (Intertidal)STPVGTARRLAELTPGAELFLIPNTKHMTFWDGGGGLMALEEFLLRHPIVVRG*
Ga0075295_100502413300005879Rice Paddy SoilPGCELALVPNCKHMTFWDGNGALNVLQDFLQRHPIPKI*
Ga0075294_102133313300005881Rice Paddy SoilLVLVPDVKHMTFWDGVGALKALQDFLARHPITPK*
Ga0075420_10100743713300006853Populus RhizosphereAEDDVNRGGSTPVATARRLAELVPGSELALVPNVKHMTFWDGDGALIALENFLQRH*
Ga0075420_10106711523300006853Populus RhizosphereRRLAELTPGAELHLIPDTKHMTFWDGDGGLIALEDFLLRHPIGSKR*
Ga0075420_10111870523300006853Populus RhizosphereLAELVPGSELALMPHVKHMTFWDGEGALIALQDFLQRHPIK*
Ga0075420_10179639123300006853Populus RhizosphereTPVGTAKRLAEATPGAELFLIPNVKHMTFWDGTGGLTALQEFLLRHPIATNR*
Ga0075434_10238417923300006871Populus RhizosphereISGAELALIPKTKHMIFWDGEGALKALQDFLTRHPIG*
Ga0068865_10127459913300006881Miscanthus RhizosphereELALVPETRHMTFWDGTGALDALLHFLNRHPMEPK*
Ga0075424_10134012123300006904Populus RhizospherePVGTARRLAELIPGCERALIPGVRHMTFWDSDGALIALQDFLQRHPIGR*
Ga0079216_1001203913300006918Agricultural SoilTPVATARRLAELVPGSELALVPNIKHMTFWDGDGALIALENFLQRHPITSH*
Ga0079216_1015597913300006918Agricultural SoilLIPGAELALIPNTRHMTFWDGDGALIALQDFLARHPIA*
Ga0099827_1129194613300009090Vadose Zone SoilVPGCELALVPGVKHMTFWDGDGALRALQDFLERHPITSRQTQS*
Ga0075418_1010198433300009100Populus RhizosphereGGSTPVATARRLAELVPGSELALVANVKHMTFWDGDGALIALENFLQRHSIH*
Ga0114129_1064117823300009147Populus RhizosphereLAPLIPGAELALIPKTRHMIFWDGDSAVIALQDFLARHPIRTH*
Ga0105243_1096717033300009148Miscanthus RhizosphereGTARRLAELVPGCERALIPGVRHMTFWDGDGALIALQDFLQRHPIGG*
Ga0111538_1136196123300009156Populus RhizosphereVGTARRLAELIPGCERALIPGVRHMTFWDSDGALIALQDFLQRHPIGR*
Ga0111538_1371538423300009156Populus RhizosphereVNRGGSTPVGTARKLGELVPGSELALVPNVKHMTFWDGDGALIALQDFLQRHRIQ*
Ga0075423_1187120333300009162Populus RhizosphereGSTPVGTARRLAELVPGCERALIPGVRHMTFWDGDGALIALQDFLQRHPIGG*
Ga0113563_1207091623300009167Freshwater WetlandsLAPLIPGAELALVPGVRHMTFWDGDGALKALQEFLGRHAMGAK*
Ga0105104_1068431723300009168Freshwater SedimentVPGAELALVPNVRHMTFWDGDGALKALQSFLARHPIRGS*
Ga0105242_1285046413300009176Miscanthus RhizosphereAGTARRLAELIPVAELNLVPNVKHMTFWDSDAALIVLQDFLQRHPIA*
Ga0105242_1321069213300009176Miscanthus RhizosphereTPVGTARKLGELVPGCELALVPDVKHMTFWDGDGALQALQEFLTRHPIQR*
Ga0105347_100253213300009609SoilNRRGSTPVDTAKRLGALTPAAELFLIPKTKHMTFWDGTGGLTALQGFLALHPIGTSR*
Ga0126374_1074528813300009792Tropical Forest SoilAELALVPGVRHMTFWDSDGALKVLQDFLARHSIGRN*
Ga0126374_1150584323300009792Tropical Forest SoilARRLAELTPGCELFLIPNVKHMTFWDGTGGLAALQDFLVRHPIGASR*
Ga0105076_103017913300009816Groundwater SandRRLGELVPGAELALVPRVRHMTFWDGDGALLALQNFLKHHPVG*
Ga0126380_1051764433300010043Tropical Forest SoilRGSTPVGTAKRLAEVTPGCELFLIPNTKHMTFWDGTGGLAALRDFLLRHPIGMSR*
Ga0126384_1169145613300010046Tropical Forest SoilRLGELVPGAELALVPGVKHMTFWDSDGALAALENFLARHPIGVS*
Ga0126382_1038074713300010047Tropical Forest SoilGTAKRLAELTPGCELFLIPNVKHMTFWDGTGGLVALQDFLLRHPIATNR*
Ga0126382_1039829623300010047Tropical Forest SoilARRLGELVPGAELVLVPSVRHMTFWDGAGALKVLQDFFARHSIGRN*
Ga0134088_1028165523300010304Grasslands SoilLSELIPSAELILVPGVKHMTFWDGSAALEALQDFLARHPIGTS*
Ga0126376_1183435423300010359Tropical Forest SoilTARRLGELVPGAELVLVPSVRHMTFWDGDGALKVLQDFFARHSIGRN*
Ga0126377_1152600013300010362Tropical Forest SoilTARRLAELTPGCELFLIPNVKHMTFWDGTGGLAALQDFLVRHPIGASR*
Ga0126379_1290776513300010366Tropical Forest SoilLVPGAELALVPGVRHMTFWDGDGALKVLQDFLARHSIGRN*
Ga0126381_10069962033300010376Tropical Forest SoilGAELALVPGVKHMTFWDGDGGLKALQNFLTKHPIR*
Ga0134122_1039109313300010400Terrestrial SoilSTPVGTATRLAEALPGCELFLIPHTKHMTFWDGTGGLIALQGFLERHPIGASR*
Ga0134123_1335950923300010403Terrestrial SoilARRLAELTPGAELCLIPDTKHMTFWDGTGGLIALEDFLLRHPINSNR*
Ga0137326_114226113300011417SoilRRGSTPVDTAKRLGALTPAAELFLIPNTKHMTFWDGTGGLTALQDFLARHPIGASR*
Ga0137314_114829123300011420SoilRLAELTPGAELCLIPDTKHMTFWDGNGGLIALEDFLLRHPIDSNR*
Ga0137428_100425313300011432SoilRLGELVPGAELALIPGVRHMTFWDGDGAIKALLDFLVRHPIHQI*
Ga0137426_106274423300011435SoilLALIPGVRHMTFWDGDGAIKALLDFLVRHPIHQI*
Ga0137429_106105623300011437SoilVGTARKLGELVPGCELALVPDVKHMTFWDGDGALSALQEFLERRPIMSRQTQS*
Ga0137429_111512813300011437SoilVNRGGSTPVGTARKLGELVPGCELALVPEVKHMTFWDGDGALRTLQDFLERHPITSRQTQS*
Ga0137431_110538933300012038SoilDVNRGGSTPVGTARKLGELMPGCELMLVPDVKHMTFWDGDGALKALQVFLGRHPIREI*
Ga0137389_1167009723300012096Vadose Zone SoilRGSTPVGTARRLAELVPGAELALIPDVKHMTFWDGNGALTALEDFLARHPIATR*
Ga0137344_106834213300012159SoilRRLAELTPGCELFLIPNVKHMTFWDGTGGLSALQDFLTRHPI*
Ga0137363_1000757373300012202Vadose Zone SoilVGTARRLAEATPGAELFLIPNVKHMTIWDGTGGLTALPEFLARHPIGVDNFSVQALL*
Ga0137386_1008618213300012351Vadose Zone SoilIPSAELILVPGVKHMTFWDGSAALEALQDFLARHPIGTS*
Ga0157336_102888323300012477Arabidopsis RhizosphereVGARRGSTPAATAKMLAPLIPGAELALIPKTRHMTFWDGDGALIALQGFLARHPIEPRRK
Ga0157355_100132533300012493Unplanted SoilVERRDSTPAATAKMLAPLIPGAQLALIPKTRHMTFWDGDGALIALQGFLARHPIRTH*
Ga0137397_1080734813300012685Vadose Zone SoilLAERVPGCELALVPDVKHMTFWDGDGALIALEDFLQRHRIQ*
Ga0157308_1029912433300012910SoilTPVGTARRLAELVPGCERALISGVRHMTFWDGDGALIALQDFLQRHPIGG*
Ga0137394_1126632823300012922Vadose Zone SoilELAFVPNVKHMTFWDGDGALVALQDFLARHPIQA*
Ga0126375_1063198213300012948Tropical Forest SoilGCELALVPGVKHMTFWDSDRALVALQDFLRRHPIRV*
Ga0126375_1146189223300012948Tropical Forest SoilGAELVLVPSVRHMTFWDGDGALKVLQDFLARHSIGRN*
Ga0164301_1122684323300012960SoilVPGSELALVPNVKHMTFWAGDGALIALQDFLQRHRIQ*
Ga0134077_1007241313300012972Grasslands SoilRRGSTPIGTARRLAELIPSAELILAPGVKHMTFWDGSAALEALQDFLARHPIGTS*
Ga0157374_1009769543300013296Miscanthus RhizosphereGTARRLAELVPGCERALIPGVRHMTFWDGDGALIALQDFLQRHRMGG*
Ga0163162_1218304833300013306Switchgrass RhizosphereDVNRRGSTPVGTARRLAELVPGCERALIPGVRHMTFWDGDGALIALQDFLQRHPIGG*
Ga0075309_121369923300014268Natural And Restored WetlandsGCELALVPDVKHMTFWDGDGALLVLQDFLQRHPLGKT*
Ga0075322_111008013300014311Natural And Restored WetlandsDVNRGGSTPAGTARRLAELVPGCELALVPNCKHMTFWDGNGALNVLQDFLQRHPIPKI*
Ga0180088_104844813300014868SoilTARRLGELVPGAELALISGVRHMTFWDGDGAIKALLDFLVRHPIHQI*
Ga0180086_106511323300014883SoilKRLAQLTPGVELFLIPNVKHMTFWDGTGGLTALQDFLARHPIDSNR*
Ga0180104_127491513300014884SoilSTPVGTARKLGELVPGCELALVPNVKHMTFWDGDGALHTLQEFLGRHPSG*
Ga0180063_118588723300014885SoilPVGTARRLAELVPGCELALIPNVKHMTFWDGARALHALQDFLARHPIPGNQPVRSLKTEP
Ga0137418_1076847923300015241Vadose Zone SoilPDAELALIPKTRHMIFWDGDSALIALQDFLARYPIRTH*
Ga0180070_102225513300015251SoilPAATARRLAPLISGAELALVPGVRHMTFWDGDGALQVLQDFLVRHPMGAK*
Ga0180073_111080713300015256SoilGGSTPVGTARRLAELIPGCELALIPEVKHMTFWDGDGGLAALQDFLARHPIDAH*
Ga0180085_102172233300015259SoilLAELIPGCELALVPDVKHMTFWDGDGALAALQDFLGCHPIGSP*
Ga0137403_1097491323300015264Vadose Zone SoilERRGSTPAATAKRLAPLIPGAELALIPKTRHMIFWDGDSALIALQDFLARHPIRTH*
Ga0132256_10017624913300015372Arabidopsis RhizosphereGELVPGAELALVSGVRHMTFWDGDGALKALQDFLSRHPIAGS*
Ga0132256_10055005413300015372Arabidopsis RhizosphereVRGCERALIPGVRHMTFWDGDGALIALQKFLQSHPIHA*
Ga0132257_10324038213300015373Arabidopsis RhizospherePVGTARRLAELVPGCERALIPGVRHMTFWDGDGALIAMQKFLQGHPIHA*
Ga0132255_10438824323300015374Arabidopsis RhizosphereSTPAGTARRLAELVPAAELNLVPNVKHMTFWDSDAALIVLQDFLQRHPIA*
Ga0182033_1146261513300016319SoilGTARRLAELTPGCELFLIPNVKHMTFWDGTGGLTALQDFLARHPIGVSQ
Ga0134083_1025163423300017659Grasslands SoilVGTARRLAELVPGCEVALIPGVRHMTFWDSAGALTALQDFLERHPINRT
Ga0184634_1007485113300018031Groundwater SedimentRLGELVPGCELALVPNVKHMTFWDGDGALIALQDFLARHPIGTG
Ga0184638_112401823300018052Groundwater SedimentELVPGAELALIPGVRHMTFWDGDRALKALQDFLARHPIR
Ga0184626_1036098313300018053Groundwater SedimentTPVGTARKLGELVPGCELALVPDVKHMTFWDSDGALHALQDFLARHPIKR
Ga0184635_1012596323300018072Groundwater SedimentELVPGSELALVPNVKHMTFWDGDGALIALQDFLQGHRIQ
Ga0184627_1044514113300018079Groundwater SedimentELALVPGVRHMTFWDSTGALDALQSFLARHPISAK
Ga0184629_1010841513300018084Groundwater SedimentGSTPVGTARCIAELTPGAELRLIPNTKHMTFWDGSGGLAALQEFLLRHPIAKNS
Ga0184629_1018576413300018084Groundwater SedimentGSTPVGTANRLAELTPGAELFLIPNTKHMTFWDGNGGLVALEKFLVRHPIDSRR
Ga0184629_1042055923300018084Groundwater SedimentTPVGTARKLAELVPGCELALVPNVKHMTFWDGDGALRTLQEFLGRHPIG
Ga0190265_1102791323300018422SoilVERRGSTPAATAKRLAPLIPGAELALISSTRHMTFWDGDGALIALQDFLARHPIA
Ga0190272_1054569613300018429SoilELALIPNTRHMTFWDGDGALIALQNFLTRHPIGRN
Ga0190271_1073449923300018481SoilVNRGGSTPAATARQLAELVPGSELALVPNVKHMTFWDGDGALSALENFLQRHPIQ
Ga0193743_110443413300019889SoilPLIPGAELALIPNTRHMTFWDGDGALIALQDFLTRHPIGTR
Ga0193717_104907533300020060SoilGTARKLGELVPGCELALVPNVKHMTFWDGDGALAALQDFLARHPIQ
Ga0193717_118922713300020060SoilPGCELALVPNVKHMTFWDGSGALIALQDFLQRHPIHKT
Ga0193716_120589813300020061SoilVPGAELALIPKTRHMTFWDGTGALDALQDFLTRHPIDTK
Ga0194110_1062468723300020084Freshwater LakeRKLGELVPGAELNLVPNVKHMTFWDGEGALHALRGFLGRHPI
Ga0206225_102023623300021064Deep Subsurface SedimentTARKLAVLIPGAELALIPGAKHIVFWDGTGAISCLEDFLARHPIEGI
Ga0210404_1024865713300021088SoilVGAARRLGELVPGAELALVPGVKHMTFWDNTGALAALEDFLVRHPIVS
Ga0224452_119566513300022534Groundwater SedimentTPAGTARRLGELVPGCELVLVPNVKHMTFWDGAGALAALQDFLLRHSIRTA
Ga0222623_1007693313300022694Groundwater SedimentQVALIPGVRHMTFWDSDGALTALQDFLERHPINRT
Ga0222622_1070052013300022756Groundwater SedimentLAELVPGCQVALIPGVRHMTFWDSDGALTALQDFLERHPINRT
Ga0222622_1135642313300022756Groundwater SedimentELVPGAELALVPKTRHMTFWDGTGALDALRDFLDRHPIEPK
Ga0247664_116354723300024232SoilPVGTARKLAELVPGCELALVPDVKHMTFWDGDGALRALQEFLSRHPIKS
Ga0233392_100629923300024241Deep Subsurface SedimentAKRLGELVPGCELALVPNVKHMTLWDGDGALVALQDFLLRHPIEKL
Ga0209399_1002135233300025157Thermal SpringsGTARRLAELTPGCELALIPDVKHMTFWDGGGALIALQNFLARHPIGAS
Ga0209521_1003182343300025164SoilTPVGTARRLAELVPGCELALIPEVKHMTFWDGDGALHALQDFLARHPIRGI
Ga0209521_1044644813300025164SoilPLATARCLAELIPGSELALVPGVKHMTFWDGTQALPILMDFLGRHPITAIP
Ga0209520_1063626023300025319SoilAELVPGCELALIPEVKHMTFWDGDGALHALQDFLARHPIRGI
Ga0210061_104424423300025537Natural And Restored WetlandsTPVGTARRLAEATAGAELFLIPNTKHMTFWDGIGGVIALEEFLARHPIGASR
Ga0207682_1061069733300025893Miscanthus RhizosphereVGTARRLAELVPGCERALIPGVRHMTFWDGDGALIALQDFLQRHRMGG
Ga0207642_1112528833300025899Miscanthus RhizosphereGCERALIPGVRHMTFWDGDGALIALQDFLQRHPIGG
Ga0207654_1051444333300025911Corn RhizosphereLVPGCERALISGVRHMTFWDGDGALIALQDFLQRHPIGG
Ga0207671_1122746613300025914Corn RhizospherePVGTARRLAELVPGCERALISGVRHMTFWDGDGALIALQKFLQGHPIHA
Ga0207646_1115791223300025922Corn, Switchgrass And Miscanthus RhizosphereRRLAEVVPGAELALIPDVRHMTFWDGNGALTALEDFLARHPIATR
Ga0210068_106135613300025953Natural And Restored WetlandsAELATVPGVRHMTFWDGDGALKTLQDFLDRYPMGEK
Ga0210102_100235843300025971Natural And Restored WetlandsLAELIPGCELALVPDVKHMTFWDGDGALRALQDFLQRHPIGGG
Ga0208532_100094313300026011Rice Paddy SoilPGCELALVPNCKHMTFWDGNGALNVLQDFLQRHPIPKI
Ga0209376_134644513300026540SoilGTARRLAELIPSAELILAPGVKHMTFWDGSAAPEALQDFLARHPIGTS
Ga0209474_1051009723300026550SoilELIPSAELILVPGVKHMTFWDGSAALEALQDFLARHPIGTS
Ga0209967_106831923300027364Arabidopsis Thaliana RhizosphereARRLAELVPGSELALVPHVKHMTFWDGDGALIALQDFLQRHPIQ
Ga0209843_107888313300027511Groundwater SandGSTPVGTARRLGELVPGAELALVPRVRHMTFWDGDGALLALQNFLKHHPVG
Ga0209799_101738113300027654Tropical Forest SoilELVPGAELVLVPSVRHMTFWDGDGALKVLQDFLARHSIGRN
Ga0209485_101595133300027691Agricultural SoilLAELVPGSELALVPNVKHMTFWDGDGALSAFIDFLSRHSIEKA
Ga0209683_1045583923300027840Wetland SedimentGVERRGSTPEATARRLAPLIPGAELALVPGVRHMTFWDGDGALKTLQDFIGRHPIDVK
Ga0209701_1019288413300027862Vadose Zone SoilAELVPGAELALIPDVKHMTFWDGNGALTALEDFLARHPIATR
Ga0299907_1008046243300030006SoilPAGTARKLGELVPGCELALVPNVKHMTFWDGDGALKALENFLQRHPIQ
Ga0310888_1031346013300031538SoilVGTARRLAELVPGCERALIPGVRHMTFWDGDGALIALQKFLQSHPIHA
Ga0310888_1077472413300031538SoilARKLSEMVPGCELALVPNVKHMTFWDGDGALHALEEFLLRHPIGDI
Ga0307469_1040424933300031720Hardwood Forest SoilTPAATAKMLAPLIPGAELALIPKTRHMTFWEGDGALIALQGFLARHPIRTH
Ga0307473_1061267223300031820Hardwood Forest SoilRRLGELVAGAELALIPGVRHMTFWDGDGALLALRNFLEHHPVG
Ga0307406_1003910933300031901RhizosphereTARKLSELLPGSELKLVPDVKHMTFWDGDGALHALQDFLARHPISGS
Ga0326597_1018986013300031965SoilPGGELALIPKVKHMTFWDGDGALHALQDFLARHPIRGNQPV
Ga0307414_1103374123300032004RhizosphereDVNRGGSTPVGTARRLAELVPGSELALVPNVKHMTFWDGDGALIALENFLQRH
Ga0307411_1214895413300032005RhizosphereGSTPVGTALRLAELTPGAELCLVPNTKHMTFWDGNGGLTALEEFLLRHPIGPRGEHSV
Ga0315281_1040644913300032163SedimentALVPGVRHMTFWDGDGALTTLEDFLARHAIVGWCKKY
Ga0307470_1023600413300032174Hardwood Forest SoilLVAGAELALIPGVRHMTFWDGDRALLALRNFLEHHPVG
Ga0334722_1115452913300033233SedimentIPDAELALVPGVRHMTFWDGKVAVSRLGDFLRRHPTANNRQRVQ
Ga0326726_1028805813300033433Peat SoilAPLIAGAELALVPGVRHMTFWDGDGALIVLQDFIGRHVIGAK
Ga0310811_1045412833300033475SoilLAELVPGCERALIPGVRHMTFWDGDGALIALQDFLQRHPIGG
Ga0310811_1083536823300033475SoilRLAELVPGCERALIPGVRHMTFWDGDGALIALQKFLQSHPIHA
Ga0316620_1025663713300033480SoilGCELALVPNVKHMTFWDGDGALKVLQDFLQRHPIRRA
Ga0247830_1138934523300033551SoilSTPVGTARRLAELVPGCERALIPGVRHMTFWDGDGALIALQKFLQGHPIHA
Ga0364924_148841_2_1483300033811SedimentVGTARRLGELVPGAELALVPNVKHMTFWDGDGALAALQDFLDRHPIGK
Ga0364932_0173833_646_7983300034177SedimentVGTARRLAELTPGAELCLIPNTKHMTFWDGSGGLIALEDFLLRHPIGGGQ
Ga0364943_0166613_1_1383300034354SedimentRLAELTPGCELFLIPNVKHMTFWDGTGGLTALQDFLTRHPIGTSQ
Ga0364941_112253_544_6633300034417SedimentVPGCELALVPDVKHMTFWDGDGALIALEEFFRRHPIEKL


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.