| Basic Information | |
|---|---|
| Family ID | F030935 |
| Family Type | Metagenome |
| Number of Sequences | 184 |
| Average Sequence Length | 47 residues |
| Representative Sequence | ARRLAELVPGSELALVPHVKHMTFWDGDGALIALQDFLQRHPIQ |
| Number of Associated Samples | 158 |
| Number of Associated Scaffolds | 184 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 1.74 % |
| % of genes near scaffold ends (potentially truncated) | 90.76 % |
| % of genes from short scaffolds (< 2000 bps) | 84.24 % |
| Associated GOLD sequencing projects | 153 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.40 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (90.761 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil (8.696 % of family members) |
| Environment Ontology (ENVO) | Unclassified (33.696 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (29.348 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 22.22% β-sheet: 8.33% Coil/Unstructured: 69.44% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.40 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 184 Family Scaffolds |
|---|---|---|
| PF13343 | SBP_bac_6 | 16.85 |
| PF13452 | MaoC_dehydrat_N | 4.35 |
| PF00561 | Abhydrolase_1 | 4.35 |
| PF09084 | NMT1 | 3.26 |
| PF00535 | Glycos_transf_2 | 2.72 |
| PF00528 | BPD_transp_1 | 2.17 |
| PF13416 | SBP_bac_8 | 2.17 |
| PF00676 | E1_dh | 1.63 |
| PF00005 | ABC_tran | 1.63 |
| PF10094 | DUF2332 | 1.09 |
| PF00171 | Aldedh | 0.54 |
| PF07690 | MFS_1 | 0.54 |
| PF12697 | Abhydrolase_6 | 0.54 |
| PF12161 | HsdM_N | 0.54 |
| PF04909 | Amidohydro_2 | 0.54 |
| PF02780 | Transketolase_C | 0.54 |
| PF12146 | Hydrolase_4 | 0.54 |
| PF00378 | ECH_1 | 0.54 |
| PF01609 | DDE_Tnp_1 | 0.54 |
| PF00903 | Glyoxalase | 0.54 |
| PF02538 | Hydantoinase_B | 0.54 |
| PF13489 | Methyltransf_23 | 0.54 |
| PF03401 | TctC | 0.54 |
| COG ID | Name | Functional Category | % Frequency in 184 Family Scaffolds |
|---|---|---|---|
| COG0715 | ABC-type nitrate/sulfonate/bicarbonate transport system, periplasmic component | Inorganic ion transport and metabolism [P] | 3.26 |
| COG4521 | ABC-type taurine transport system, periplasmic component | Inorganic ion transport and metabolism [P] | 3.26 |
| COG0567 | 2-oxoglutarate dehydrogenase complex, dehydrogenase (E1) component, and related enzymes | Energy production and conversion [C] | 1.63 |
| COG1071 | TPP-dependent pyruvate or acetoin dehydrogenase subunit alpha | Energy production and conversion [C] | 1.63 |
| COG0146 | N-methylhydantoinase B/oxoprolinase/acetone carboxylase, alpha subunit | Amino acid transport and metabolism [E] | 1.09 |
| COG0014 | Gamma-glutamyl phosphate reductase | Amino acid transport and metabolism [E] | 0.54 |
| COG1012 | Acyl-CoA reductase or other NAD-dependent aldehyde dehydrogenase | Lipid transport and metabolism [I] | 0.54 |
| COG3039 | Transposase and inactivated derivatives, IS5 family | Mobilome: prophages, transposons [X] | 0.54 |
| COG3181 | Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctC | Energy production and conversion [C] | 0.54 |
| COG3293 | Transposase | Mobilome: prophages, transposons [X] | 0.54 |
| COG3385 | IS4 transposase InsG | Mobilome: prophages, transposons [X] | 0.54 |
| COG4230 | Delta 1-pyrroline-5-carboxylate dehydrogenase | Amino acid transport and metabolism [E] | 0.54 |
| COG5421 | Transposase | Mobilome: prophages, transposons [X] | 0.54 |
| COG5433 | Predicted transposase YbfD/YdcC associated with H repeats | Mobilome: prophages, transposons [X] | 0.54 |
| COG5659 | SRSO17 transposase | Mobilome: prophages, transposons [X] | 0.54 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 90.76 % |
| Unclassified | root | N/A | 9.24 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2170459014|G1P06HT01C69KU | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 610 | Open in IMG/M |
| 3300000033|ICChiseqgaiiDRAFT_c2160206 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 773 | Open in IMG/M |
| 3300000364|INPhiseqgaiiFebDRAFT_101839739 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 532 | Open in IMG/M |
| 3300000364|INPhiseqgaiiFebDRAFT_101841766 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 826 | Open in IMG/M |
| 3300000364|INPhiseqgaiiFebDRAFT_103935741 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 559 | Open in IMG/M |
| 3300000559|F14TC_103151774 | All Organisms → cellular organisms → Bacteria | 779 | Open in IMG/M |
| 3300000574|JGI1357J11328_10171806 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 600 | Open in IMG/M |
| 3300000597|AF_2010_repII_A1DRAFT_10094558 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 740 | Open in IMG/M |
| 3300000787|JGI11643J11755_11234703 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 584 | Open in IMG/M |
| 3300000891|JGI10214J12806_10139215 | All Organisms → cellular organisms → Bacteria | 567 | Open in IMG/M |
| 3300000953|JGI11615J12901_12001038 | All Organisms → cellular organisms → Bacteria | 759 | Open in IMG/M |
| 3300001372|YBBDRAFT_1081047 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 821 | Open in IMG/M |
| 3300002147|JGI24793J26633_1012635 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 2457 | Open in IMG/M |
| 3300002147|JGI24793J26633_1061468 | All Organisms → cellular organisms → Bacteria | 620 | Open in IMG/M |
| 3300002160|JGI24797J26694_1042556 | All Organisms → cellular organisms → Bacteria | 913 | Open in IMG/M |
| 3300004114|Ga0062593_101789946 | All Organisms → cellular organisms → Bacteria | 674 | Open in IMG/M |
| 3300004156|Ga0062589_100353802 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1167 | Open in IMG/M |
| 3300004157|Ga0062590_101144017 | All Organisms → cellular organisms → Bacteria | 754 | Open in IMG/M |
| 3300004463|Ga0063356_102443429 | All Organisms → cellular organisms → Bacteria | 800 | Open in IMG/M |
| 3300004463|Ga0063356_103275441 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Curvibacter → Curvibacter gracilis | 698 | Open in IMG/M |
| 3300004463|Ga0063356_104019682 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 633 | Open in IMG/M |
| 3300004463|Ga0063356_104836258 | All Organisms → cellular organisms → Bacteria | 579 | Open in IMG/M |
| 3300004782|Ga0062382_10567298 | All Organisms → cellular organisms → Bacteria | 552 | Open in IMG/M |
| 3300005093|Ga0062594_102464962 | All Organisms → cellular organisms → Bacteria | 570 | Open in IMG/M |
| 3300005167|Ga0066672_10920747 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 540 | Open in IMG/M |
| 3300005178|Ga0066688_10478642 | All Organisms → cellular organisms → Bacteria | 803 | Open in IMG/M |
| 3300005181|Ga0066678_10357848 | All Organisms → cellular organisms → Bacteria | 963 | Open in IMG/M |
| 3300005290|Ga0065712_10004636 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 6158 | Open in IMG/M |
| 3300005290|Ga0065712_10091366 | All Organisms → cellular organisms → Bacteria | 2344 | Open in IMG/M |
| 3300005329|Ga0070683_101629737 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 620 | Open in IMG/M |
| 3300005332|Ga0066388_108007652 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 528 | Open in IMG/M |
| 3300005333|Ga0070677_10501083 | All Organisms → cellular organisms → Bacteria | 658 | Open in IMG/M |
| 3300005467|Ga0070706_101882710 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 543 | Open in IMG/M |
| 3300005536|Ga0070697_102044115 | All Organisms → cellular organisms → Bacteria | 513 | Open in IMG/M |
| 3300005546|Ga0070696_100327526 | All Organisms → cellular organisms → Bacteria | 1180 | Open in IMG/M |
| 3300005558|Ga0066698_10213803 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1322 | Open in IMG/M |
| 3300005564|Ga0070664_102134731 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 532 | Open in IMG/M |
| 3300005618|Ga0068864_102584451 | All Organisms → cellular organisms → Bacteria | 514 | Open in IMG/M |
| 3300005713|Ga0066905_101058337 | All Organisms → cellular organisms → Bacteria | 718 | Open in IMG/M |
| 3300005829|Ga0074479_10462323 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 507 | Open in IMG/M |
| 3300005836|Ga0074470_10485146 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 850 | Open in IMG/M |
| 3300006853|Ga0075420_101007437 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 717 | Open in IMG/M |
| 3300006853|Ga0075420_101118705 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 677 | Open in IMG/M |
| 3300006853|Ga0075420_101796391 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 524 | Open in IMG/M |
| 3300006871|Ga0075434_102384179 | Not Available | 531 | Open in IMG/M |
| 3300006881|Ga0068865_101274599 | All Organisms → cellular organisms → Bacteria | 653 | Open in IMG/M |
| 3300006904|Ga0075424_101340121 | All Organisms → cellular organisms → Bacteria | 761 | Open in IMG/M |
| 3300006918|Ga0079216_10012039 | All Organisms → cellular organisms → Bacteria | 2988 | Open in IMG/M |
| 3300006918|Ga0079216_10155979 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1196 | Open in IMG/M |
| 3300009090|Ga0099827_11291946 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 635 | Open in IMG/M |
| 3300009100|Ga0075418_10101984 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 3047 | Open in IMG/M |
| 3300009147|Ga0114129_10641178 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1372 | Open in IMG/M |
| 3300009148|Ga0105243_10967170 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 852 | Open in IMG/M |
| 3300009156|Ga0111538_11361961 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 895 | Open in IMG/M |
| 3300009156|Ga0111538_13715384 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 529 | Open in IMG/M |
| 3300009162|Ga0075423_11871203 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 648 | Open in IMG/M |
| 3300009167|Ga0113563_12070916 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 681 | Open in IMG/M |
| 3300009168|Ga0105104_10684317 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 589 | Open in IMG/M |
| 3300009176|Ga0105242_12850464 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 534 | Open in IMG/M |
| 3300009176|Ga0105242_13210692 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 508 | Open in IMG/M |
| 3300009609|Ga0105347_1002532 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 7134 | Open in IMG/M |
| 3300009792|Ga0126374_10745288 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 742 | Open in IMG/M |
| 3300009792|Ga0126374_11505843 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 552 | Open in IMG/M |
| 3300009816|Ga0105076_1030179 | All Organisms → cellular organisms → Bacteria | 955 | Open in IMG/M |
| 3300010043|Ga0126380_10517644 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 920 | Open in IMG/M |
| 3300010046|Ga0126384_11691456 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 598 | Open in IMG/M |
| 3300010047|Ga0126382_10380747 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1093 | Open in IMG/M |
| 3300010047|Ga0126382_10398296 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1073 | Open in IMG/M |
| 3300010304|Ga0134088_10281655 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 802 | Open in IMG/M |
| 3300010359|Ga0126376_11834354 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 645 | Open in IMG/M |
| 3300010362|Ga0126377_11526000 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 742 | Open in IMG/M |
| 3300010366|Ga0126379_12907765 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 573 | Open in IMG/M |
| 3300010376|Ga0126381_100699620 | All Organisms → cellular organisms → Bacteria | 1449 | Open in IMG/M |
| 3300010400|Ga0134122_10391093 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1225 | Open in IMG/M |
| 3300011417|Ga0137326_1142261 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 554 | Open in IMG/M |
| 3300011432|Ga0137428_1004253 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4401 | Open in IMG/M |
| 3300011435|Ga0137426_1062744 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 995 | Open in IMG/M |
| 3300011437|Ga0137429_1061056 | Not Available | 1111 | Open in IMG/M |
| 3300011437|Ga0137429_1115128 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 823 | Open in IMG/M |
| 3300012038|Ga0137431_1105389 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 793 | Open in IMG/M |
| 3300012096|Ga0137389_11670097 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 533 | Open in IMG/M |
| 3300012202|Ga0137363_10007573 | All Organisms → cellular organisms → Bacteria | 6811 | Open in IMG/M |
| 3300012351|Ga0137386_10086182 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 2205 | Open in IMG/M |
| 3300012477|Ga0157336_1028883 | Not Available | 545 | Open in IMG/M |
| 3300012493|Ga0157355_1001325 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1265 | Open in IMG/M |
| 3300012685|Ga0137397_10807348 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 696 | Open in IMG/M |
| 3300012910|Ga0157308_10299124 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 588 | Open in IMG/M |
| 3300012948|Ga0126375_10631982 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 823 | Open in IMG/M |
| 3300012948|Ga0126375_11461892 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 582 | Open in IMG/M |
| 3300012960|Ga0164301_11226843 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 604 | Open in IMG/M |
| 3300012972|Ga0134077_10072413 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1302 | Open in IMG/M |
| 3300013296|Ga0157374_10097695 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 2810 | Open in IMG/M |
| 3300013306|Ga0163162_12183048 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 636 | Open in IMG/M |
| 3300014311|Ga0075322_1110080 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 650 | Open in IMG/M |
| 3300014868|Ga0180088_1048448 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 730 | Open in IMG/M |
| 3300014883|Ga0180086_1065113 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 893 | Open in IMG/M |
| 3300014884|Ga0180104_1274915 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 500 | Open in IMG/M |
| 3300014885|Ga0180063_1185887 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 666 | Open in IMG/M |
| 3300015241|Ga0137418_10768479 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 727 | Open in IMG/M |
| 3300015251|Ga0180070_1022255 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 762 | Open in IMG/M |
| 3300015256|Ga0180073_1110807 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 592 | Open in IMG/M |
| 3300015259|Ga0180085_1021722 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1784 | Open in IMG/M |
| 3300015264|Ga0137403_10974913 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 695 | Open in IMG/M |
| 3300015372|Ga0132256_100176249 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 2169 | Open in IMG/M |
| 3300015372|Ga0132256_100550054 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1267 | Open in IMG/M |
| 3300015373|Ga0132257_103240382 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 593 | Open in IMG/M |
| 3300015374|Ga0132255_104388243 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 598 | Open in IMG/M |
| 3300016319|Ga0182033_11462615 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 616 | Open in IMG/M |
| 3300017659|Ga0134083_10251634 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 739 | Open in IMG/M |
| 3300018031|Ga0184634_10074851 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1445 | Open in IMG/M |
| 3300018052|Ga0184638_1124018 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 943 | Open in IMG/M |
| 3300018053|Ga0184626_10360983 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 589 | Open in IMG/M |
| 3300018072|Ga0184635_10125963 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1019 | Open in IMG/M |
| 3300018079|Ga0184627_10445141 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 673 | Open in IMG/M |
| 3300018084|Ga0184629_10108415 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1367 | Open in IMG/M |
| 3300018084|Ga0184629_10185764 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1069 | Open in IMG/M |
| 3300018084|Ga0184629_10420559 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 701 | Open in IMG/M |
| 3300018422|Ga0190265_11027913 | Not Available | 945 | Open in IMG/M |
| 3300018429|Ga0190272_10545696 | Not Available | 999 | Open in IMG/M |
| 3300018481|Ga0190271_10734499 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1111 | Open in IMG/M |
| 3300019889|Ga0193743_1104434 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1056 | Open in IMG/M |
| 3300020060|Ga0193717_1049075 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1507 | Open in IMG/M |
| 3300020061|Ga0193716_1205898 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 744 | Open in IMG/M |
| 3300020084|Ga0194110_10624687 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 679 | Open in IMG/M |
| 3300021064|Ga0206225_1020236 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1206 | Open in IMG/M |
| 3300021088|Ga0210404_10248657 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 967 | Open in IMG/M |
| 3300022534|Ga0224452_1195665 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 622 | Open in IMG/M |
| 3300022694|Ga0222623_10076933 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1294 | Open in IMG/M |
| 3300022756|Ga0222622_10700520 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 736 | Open in IMG/M |
| 3300022756|Ga0222622_11356423 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 523 | Open in IMG/M |
| 3300024232|Ga0247664_1163547 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 525 | Open in IMG/M |
| 3300024241|Ga0233392_1006299 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1047 | Open in IMG/M |
| 3300025157|Ga0209399_10021352 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2700 | Open in IMG/M |
| 3300025164|Ga0209521_10031823 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 3670 | Open in IMG/M |
| 3300025164|Ga0209521_10446448 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → environmental samples → uncultured delta proteobacterium Rifle_16ft_4_minimus_1997 | 692 | Open in IMG/M |
| 3300025319|Ga0209520_10636260 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 609 | Open in IMG/M |
| 3300025537|Ga0210061_1044244 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 750 | Open in IMG/M |
| 3300025893|Ga0207682_10610697 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 514 | Open in IMG/M |
| 3300025899|Ga0207642_11125288 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 508 | Open in IMG/M |
| 3300025911|Ga0207654_10514443 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 847 | Open in IMG/M |
| 3300025914|Ga0207671_11227466 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 586 | Open in IMG/M |
| 3300025922|Ga0207646_11157912 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 679 | Open in IMG/M |
| 3300025953|Ga0210068_1061356 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 585 | Open in IMG/M |
| 3300025971|Ga0210102_1002358 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 4031 | Open in IMG/M |
| 3300026540|Ga0209376_1346445 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 562 | Open in IMG/M |
| 3300026550|Ga0209474_10510097 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 609 | Open in IMG/M |
| 3300027364|Ga0209967_1068319 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 554 | Open in IMG/M |
| 3300027511|Ga0209843_1078883 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 564 | Open in IMG/M |
| 3300027654|Ga0209799_1017381 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1570 | Open in IMG/M |
| 3300027691|Ga0209485_1015951 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1661 | Open in IMG/M |
| 3300027840|Ga0209683_10455839 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 586 | Open in IMG/M |
| 3300027862|Ga0209701_10192884 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1219 | Open in IMG/M |
| 3300030006|Ga0299907_10080462 | All Organisms → cellular organisms → Bacteria | 2649 | Open in IMG/M |
| 3300031538|Ga0310888_10313460 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 900 | Open in IMG/M |
| 3300031538|Ga0310888_10774724 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 593 | Open in IMG/M |
| 3300031720|Ga0307469_10404249 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1167 | Open in IMG/M |
| 3300031820|Ga0307473_10612672 | All Organisms → cellular organisms → Bacteria | 753 | Open in IMG/M |
| 3300031901|Ga0307406_10039109 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 2941 | Open in IMG/M |
| 3300031965|Ga0326597_10189860 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 2419 | Open in IMG/M |
| 3300032004|Ga0307414_11033741 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 757 | Open in IMG/M |
| 3300032005|Ga0307411_12148954 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 523 | Open in IMG/M |
| 3300032163|Ga0315281_10406449 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1465 | Open in IMG/M |
| 3300032174|Ga0307470_10236004 | All Organisms → cellular organisms → Bacteria | 1197 | Open in IMG/M |
| 3300033233|Ga0334722_11154529 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 543 | Open in IMG/M |
| 3300033433|Ga0326726_10288058 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1538 | Open in IMG/M |
| 3300033475|Ga0310811_10454128 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1369 | Open in IMG/M |
| 3300033475|Ga0310811_10835368 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 850 | Open in IMG/M |
| 3300033480|Ga0316620_10256637 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1501 | Open in IMG/M |
| 3300033551|Ga0247830_11389345 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 561 | Open in IMG/M |
| 3300033811|Ga0364924_148841 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 551 | Open in IMG/M |
| 3300034177|Ga0364932_0173833 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 819 | Open in IMG/M |
| 3300034417|Ga0364941_112253 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 664 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 8.70% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 7.07% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 7.07% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 6.52% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 5.98% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 4.89% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 4.35% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 2.72% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 2.17% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 2.17% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 2.17% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.17% |
| Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 2.17% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 1.63% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.63% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.63% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.63% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.63% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 1.63% |
| Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 1.63% |
| Host-Associated | Host-Associated → Porifera → Unclassified → Unclassified → Unclassified → Host-Associated | 1.63% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 1.63% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.63% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 1.09% |
| Wetland Sediment | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Wetland Sediment | 1.09% |
| Sediment (Intertidal) | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal) | 1.09% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.09% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.09% |
| Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 1.09% |
| Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 1.09% |
| Deep Subsurface Sediment | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface Sediment | 1.09% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.09% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.09% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 1.09% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.09% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 1.09% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 1.09% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 0.54% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 0.54% |
| Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 0.54% |
| Groundwater | Environmental → Aquatic → Freshwater → Groundwater → Contaminated → Groundwater | 0.54% |
| Marine Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Sediment → Marine Estuarine | 0.54% |
| Thermal Springs | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Thermal Springs | 0.54% |
| Unplanted Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Unplanted Soil | 0.54% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.54% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.54% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.54% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.54% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.54% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.54% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.54% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere | 0.54% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.54% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.54% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.54% |
| Switchgrass, Maize And Mischanthus Litter | Engineered → Solid Waste → Grass → Composting → Unclassified → Switchgrass, Maize And Mischanthus Litter | 0.54% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2170459014 | Litter degradation PV2 | Engineered | Open in IMG/M |
| 3300000033 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
| 3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000559 | Amended soil microbial communities from Kansas Great Prairies, USA - control no BrdU total DNA F1.4 TC clc assemly | Environmental | Open in IMG/M |
| 3300000574 | Subsurface groundwater microbial communities from S. Glens Falls, New York, USA - GMW46 contaminated, 5.4 m | Environmental | Open in IMG/M |
| 3300000597 | Forest soil microbial communities from Amazon forest - 2010 replicate II A1 | Environmental | Open in IMG/M |
| 3300000787 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
| 3300000891 | Soil microbial communities from Great Prairies - Wisconsin, Continuous corn soil | Environmental | Open in IMG/M |
| 3300000953 | Soil microbial communities from Great Prairies - Kansas Corn soil | Environmental | Open in IMG/M |
| 3300001372 | YB-Back-sed | Environmental | Open in IMG/M |
| 3300002147 | Host-associated microbial community of the marine sponge Aplysina aerophoba from Gulf of Piran - sponge mesohyl, lysed by freeze-thaw cycling | Host-Associated | Open in IMG/M |
| 3300002160 | Host-associated microbial community of the marine sponge Aplysina aerophoba from Gulf of Piran - sponge pinacoderm, lysed by proteinase K digestion | Host-Associated | Open in IMG/M |
| 3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
| 3300004156 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1 | Environmental | Open in IMG/M |
| 3300004157 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2 | Environmental | Open in IMG/M |
| 3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
| 3300004782 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare2Fresh | Environmental | Open in IMG/M |
| 3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
| 3300005167 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 | Environmental | Open in IMG/M |
| 3300005178 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 | Environmental | Open in IMG/M |
| 3300005181 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 | Environmental | Open in IMG/M |
| 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 | Host-Associated | Open in IMG/M |
| 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Host-Associated | Open in IMG/M |
| 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
| 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
| 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Environmental | Open in IMG/M |
| 3300005558 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 | Environmental | Open in IMG/M |
| 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Host-Associated | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005829 | Microbial communities from Cathlamet Bay sediment, Columbia River estuary, Oregon - S.190_CBC | Environmental | Open in IMG/M |
| 3300005836 | Microbial communities from Youngs Bay mouth sediment, Columbia River estuary, Oregon - S.42_YBB | Environmental | Open in IMG/M |
| 3300005879 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_25C_0N_301 | Environmental | Open in IMG/M |
| 3300005881 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_25C_0N_202 | Environmental | Open in IMG/M |
| 3300006853 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD4 | Host-Associated | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Host-Associated | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300006918 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS100 | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009167 | Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 3 metaG - Illumina Assembly (version 2) | Environmental | Open in IMG/M |
| 3300009168 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 19-21cm September2015 | Environmental | Open in IMG/M |
| 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009609 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT890 | Environmental | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300009816 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_0_10 | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010304 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09182015 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
| 3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
| 3300011417 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT500_2 | Environmental | Open in IMG/M |
| 3300011420 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT199_2 | Environmental | Open in IMG/M |
| 3300011432 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT718_2 | Environmental | Open in IMG/M |
| 3300011435 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT660_2 | Environmental | Open in IMG/M |
| 3300011437 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT736_2 | Environmental | Open in IMG/M |
| 3300012038 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT800_2 | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012159 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT500_2 | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012477 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.3.yng.040610 | Host-Associated | Open in IMG/M |
| 3300012493 | Unplanted soil (control) microbial communities from North Carolina - M.Soil.10.yng.090610 | Environmental | Open in IMG/M |
| 3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
| 3300012910 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S198-509B-2 | Environmental | Open in IMG/M |
| 3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
| 3300012972 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Host-Associated | Open in IMG/M |
| 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
| 3300014268 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNE_CattailA_D1 | Environmental | Open in IMG/M |
| 3300014311 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailB_D1 | Environmental | Open in IMG/M |
| 3300014868 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT830_16_10D | Environmental | Open in IMG/M |
| 3300014883 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT760_16_10D | Environmental | Open in IMG/M |
| 3300014884 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT730_16_1Da | Environmental | Open in IMG/M |
| 3300014885 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLIBT47_16_10D | Environmental | Open in IMG/M |
| 3300015241 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015251 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT293_16_10D | Environmental | Open in IMG/M |
| 3300015256 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT333_16_10D | Environmental | Open in IMG/M |
| 3300015259 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT730_16_10D | Environmental | Open in IMG/M |
| 3300015264 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
| 3300017659 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300018031 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b1 | Environmental | Open in IMG/M |
| 3300018052 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b2 | Environmental | Open in IMG/M |
| 3300018053 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_b1 | Environmental | Open in IMG/M |
| 3300018072 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b2 | Environmental | Open in IMG/M |
| 3300018079 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_127_b1 | Environmental | Open in IMG/M |
| 3300018084 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_b1 | Environmental | Open in IMG/M |
| 3300018422 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 T | Environmental | Open in IMG/M |
| 3300018429 | Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 T | Environmental | Open in IMG/M |
| 3300018481 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 356 T | Environmental | Open in IMG/M |
| 3300019889 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L2c2 | Environmental | Open in IMG/M |
| 3300020060 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2c2 | Environmental | Open in IMG/M |
| 3300020061 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2c1 | Environmental | Open in IMG/M |
| 3300020084 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015032 Kigoma Deep Cast 1200m | Environmental | Open in IMG/M |
| 3300021064 | Subsurface sediment microbial communities from Mancos shale, Colorado, United States - Mancos B2 | Environmental | Open in IMG/M |
| 3300021088 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M | Environmental | Open in IMG/M |
| 3300022534 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30_b1 | Environmental | Open in IMG/M |
| 3300022694 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30_coex | Environmental | Open in IMG/M |
| 3300022756 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1 | Environmental | Open in IMG/M |
| 3300024232 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK05 | Environmental | Open in IMG/M |
| 3300024241 | Subsurface microbial communities from Mancos shale, Colorado, United States - Mancos A_50_July_PB | Environmental | Open in IMG/M |
| 3300025157 | Hot spring microbial communities from Beatty, Nevada to study Microbial Dark Matter (Phase II) - OV2 TP3 (SPAdes) | Environmental | Open in IMG/M |
| 3300025164 | Soil microbial communities from Rifle, Colorado, USA - sediment 19ft 4 | Environmental | Open in IMG/M |
| 3300025319 | Soil microbial communities from Rifle, Colorado, USA - sediment 16ft 1 | Environmental | Open in IMG/M |
| 3300025537 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailC_D1 (SPAdes) | Environmental | Open in IMG/M |
| 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025953 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushOxbow_ThreeSqA_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025971 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushOxbow_ThreeSqC_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300026011 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_25C_0N_301 (SPAdes) | Environmental | Open in IMG/M |
| 3300026540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 (SPAdes) | Environmental | Open in IMG/M |
| 3300026550 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 (SPAdes) | Environmental | Open in IMG/M |
| 3300027364 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027511 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_20_30 (SPAdes) | Environmental | Open in IMG/M |
| 3300027654 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 MoBio (SPAdes) | Environmental | Open in IMG/M |
| 3300027691 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS100 (SPAdes) | Environmental | Open in IMG/M |
| 3300027840 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare2Fresh (SPAdes) | Environmental | Open in IMG/M |
| 3300027862 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300030006 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT152D67 | Environmental | Open in IMG/M |
| 3300031538 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D1 | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
| 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Host-Associated | Open in IMG/M |
| 3300031965 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT100D185 | Environmental | Open in IMG/M |
| 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Host-Associated | Open in IMG/M |
| 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Host-Associated | Open in IMG/M |
| 3300032163 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G07_0 | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300033233 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C3_bottom | Environmental | Open in IMG/M |
| 3300033433 | Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MN | Environmental | Open in IMG/M |
| 3300033475 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YC | Environmental | Open in IMG/M |
| 3300033480 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D5_B | Environmental | Open in IMG/M |
| 3300033551 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day5 | Environmental | Open in IMG/M |
| 3300033811 | Sediment microbial communities from East River floodplain, Colorado, United States - 28_j17 | Environmental | Open in IMG/M |
| 3300034177 | Sediment microbial communities from East River floodplain, Colorado, United States - 17_j17 | Environmental | Open in IMG/M |
| 3300034354 | Sediment microbial communities from East River floodplain, Colorado, United States - 23_s17 | Environmental | Open in IMG/M |
| 3300034417 | Sediment microbial communities from East River floodplain, Colorado, United States - 17_s17 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| 2PV_03833240 | 2170459014 | Switchgrass, Maize And Mischanthus Litter | RGSTPVGTARRLGELVPGAELALVPGVRHMTFWDGDGALKALQDFLARYPIRRT |
| ICChiseqgaiiDRAFT_21602061 | 3300000033 | Soil | DVNRGGSTPVGTARKLGELVPGCELALVPNVKXMTFWDGDGALXALQDFLSRHPIR* |
| INPhiseqgaiiFebDRAFT_1018397391 | 3300000364 | Soil | ADDVNRGGSTPVGTARKLGELVPGSELALVPNVKHMTFWDGDGALIALQDFLQRHRIQ* |
| INPhiseqgaiiFebDRAFT_1018417662 | 3300000364 | Soil | RLGELVPGAELALVPGVRHMTFWDGDGALKVLQDFLARHPIGDRQH* |
| INPhiseqgaiiFebDRAFT_1039357411 | 3300000364 | Soil | VGTAKRLAELTLGSELFLIPNTKHMTFWDGAGGVNALQEFLLRHPMDSGR* |
| F14TC_1031517742 | 3300000559 | Soil | GTARRLGELVPGAELALVPGVRHMTFWDGDGALLALRNFLEHHPVG* |
| JGI1357J11328_101718061 | 3300000574 | Groundwater | KLGELVPGCELALVPGVKHMTFWDGDGALHALQDFLARHPIRK* |
| AF_2010_repII_A1DRAFT_100945582 | 3300000597 | Forest Soil | ELALVPGVKHMTFWDSTAALAALEDFLARHPIAS* |
| JGI11643J11755_112347032 | 3300000787 | Soil | DDVNRGGSTPVGTARKLGELVPGCELALVPNVKXMTFWDGDGALXALQDFLSRHPIR* |
| JGI10214J12806_101392151 | 3300000891 | Soil | GSTPAATAKRLAPLIPGAELALIPNTRHMTFWDGDGALIALQDFLARHPIGRH* |
| JGI11615J12901_120010381 | 3300000953 | Soil | DDVNRGGSTPAGTARKLADLVPGCELALVPEVKHMTFWDGDGALMALESFLRRHPIR* |
| YBBDRAFT_10810472 | 3300001372 | Marine Estuarine | GSTPVGTARKLGELVPGCELALVPDVKHMTFWDGDGALQALQDFLARYPINGS* |
| JGI24793J26633_10126351 | 3300002147 | Host-Associated | RQGSTPVDTARRLGQATPGAELALIPGVRHMTFWDGTGAIEALEDFLARHPIG* |
| JGI24793J26633_10614681 | 3300002147 | Host-Associated | VGTARMLGQAIPGAELALIPGVRHMTFWDGTGALTALQDFLKRHPIQ* |
| JGI24797J26694_10425562 | 3300002160 | Host-Associated | GTARMLGQAIPGAELALIPGVRHMTFWDGTGALTALQDFLKRHPIQ* |
| Ga0062593_1017899462 | 3300004114 | Soil | GTARKLSEMVPGCELALVPNVKHMTFWDGDGALHALEEFLLRHPIGDI* |
| Ga0062589_1003538021 | 3300004156 | Soil | ARRLAELVFGSELALVPDVKHMTFWDGEGALIALQNFLQRHPIR* |
| Ga0062590_1011440171 | 3300004157 | Soil | VGTARKLAELLPGCELALVPSVKHMTFWDGDGALIALQDFLGRHPIGGS* |
| Ga0063356_1024434291 | 3300004463 | Arabidopsis Thaliana Rhizosphere | NRGGSTPVATARRLAELVPGSELVLVPNVKHMTFWDGDGALVALENFLQRHSIH* |
| Ga0063356_1032754411 | 3300004463 | Arabidopsis Thaliana Rhizosphere | LRRRSAELTPGAELCLVPNTKHMTFWDGSGGLTALEEFLLRHPIGHRGKHSV* |
| Ga0063356_1040196822 | 3300004463 | Arabidopsis Thaliana Rhizosphere | GSTPEATARRLAPLITGAELALIPGVRHMTFWDGDGAVKTLQEFIGRHPIGPK* |
| Ga0063356_1048362581 | 3300004463 | Arabidopsis Thaliana Rhizosphere | GSTPVGTARKLAELLPGCELALVPSVKHMTFWDGDGALIALQDFLGRHPIGGS* |
| Ga0062382_105672982 | 3300004782 | Wetland Sediment | ARRLAPLIPGAELALVPGVRHMTFWDGDGALKTLQDFIGRHPIDVK* |
| Ga0062594_1024649621 | 3300005093 | Soil | GSTPVGTARKLSEMVPGCELALVPNVKHMTFWDGDGALHALEEFLLRHPIGDI* |
| Ga0066672_109207472 | 3300005167 | Soil | GSTPVGTARRLGELVAGAELALIPGVRHMTFWDGDGALLALRNFLEHHPVG* |
| Ga0066688_104786421 | 3300005178 | Soil | GGSTPVGTARKLAERVPGCELALVPDVKHMTFWDGDGALIALEDFLQRHRIQ* |
| Ga0066678_103578482 | 3300005181 | Soil | ELIPSAELILVPGVKHMTFWDGSAALEALQDFLARHPIGTS* |
| Ga0065712_100046361 | 3300005290 | Miscanthus Rhizosphere | TARRLAELVPGCERALIPGVRHMTFWDGDGALIALQKFLQGHPIHA* |
| Ga0065712_100913664 | 3300005290 | Miscanthus Rhizosphere | KRLAELVPGAELALVPETRHMTFWDGTGALDALLHFLNRHPMEPK* |
| Ga0070683_1016297371 | 3300005329 | Corn Rhizosphere | VGTARRLAELVPGCERALIPGVRHMTFWDGDGALIALQKFLQGHPIHA* |
| Ga0066388_1080076522 | 3300005332 | Tropical Forest Soil | VPGAELALVPGVRHMTFWDGDGALKILQDFLARHPIRRS* |
| Ga0070677_105010833 | 3300005333 | Miscanthus Rhizosphere | VGTARRLAELVPGCERALIPGVRHMTFWDGDGALIALQDFLQRHRMGG* |
| Ga0070706_1018827101 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | GSTPVGTARRLGELVPGAELALVPGVKHMTFWDSTGALAALDDFLARHPIVS* |
| Ga0070697_1020441152 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | DVNRGGSTPVGTARKLAERVPGCELALVPDVKHMTFWDGDGALIALEDFLQRHRIQ* |
| Ga0070696_1003275261 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | ARRLAELVPGCERALIPGVRHMTFWDGDGALIALQDFLQRHPIGG* |
| Ga0066698_102138033 | 3300005558 | Soil | CEVALIPGVRHMTFWDSDGALTALQDFLERHPINRT* |
| Ga0070664_1021347312 | 3300005564 | Corn Rhizosphere | CERALIPGVRHMTFWDGDGALIALQKFLQSHPIHA* |
| Ga0068864_1025844511 | 3300005618 | Switchgrass Rhizosphere | DVNRRGSTPVGTARRLAELVPGCERALIPGVRHMTFWDGDGALIALQKFLQGHPIHA* |
| Ga0066905_1010583372 | 3300005713 | Tropical Forest Soil | VGTARRLAELTPGCELFLIPNVKHMTFWDGTGGLAALEHFLVRHPIGASR* |
| Ga0066905_1022484972 | 3300005713 | Tropical Forest Soil | AKLALVPGVKHMTFWDGTGALAALEDFLARHPIAS* |
| Ga0074479_104623232 | 3300005829 | Sediment (Intertidal) | RGGSTPVGTARKLGELVPGCELALVPNVKHMTFWDGDGALHALQEFMLRHPIGGI* |
| Ga0074470_104851461 | 3300005836 | Sediment (Intertidal) | STPVGTARRLAELTPGAELFLIPNTKHMTFWDGGGGLMALEEFLLRHPIVVRG* |
| Ga0075295_10050241 | 3300005879 | Rice Paddy Soil | PGCELALVPNCKHMTFWDGNGALNVLQDFLQRHPIPKI* |
| Ga0075294_10213331 | 3300005881 | Rice Paddy Soil | LVLVPDVKHMTFWDGVGALKALQDFLARHPITPK* |
| Ga0075420_1010074371 | 3300006853 | Populus Rhizosphere | AEDDVNRGGSTPVATARRLAELVPGSELALVPNVKHMTFWDGDGALIALENFLQRH* |
| Ga0075420_1010671152 | 3300006853 | Populus Rhizosphere | RRLAELTPGAELHLIPDTKHMTFWDGDGGLIALEDFLLRHPIGSKR* |
| Ga0075420_1011187052 | 3300006853 | Populus Rhizosphere | LAELVPGSELALMPHVKHMTFWDGEGALIALQDFLQRHPIK* |
| Ga0075420_1017963912 | 3300006853 | Populus Rhizosphere | TPVGTAKRLAEATPGAELFLIPNVKHMTFWDGTGGLTALQEFLLRHPIATNR* |
| Ga0075434_1023841792 | 3300006871 | Populus Rhizosphere | ISGAELALIPKTKHMIFWDGEGALKALQDFLTRHPIG* |
| Ga0068865_1012745991 | 3300006881 | Miscanthus Rhizosphere | ELALVPETRHMTFWDGTGALDALLHFLNRHPMEPK* |
| Ga0075424_1013401212 | 3300006904 | Populus Rhizosphere | PVGTARRLAELIPGCERALIPGVRHMTFWDSDGALIALQDFLQRHPIGR* |
| Ga0079216_100120391 | 3300006918 | Agricultural Soil | TPVATARRLAELVPGSELALVPNIKHMTFWDGDGALIALENFLQRHPITSH* |
| Ga0079216_101559791 | 3300006918 | Agricultural Soil | LIPGAELALIPNTRHMTFWDGDGALIALQDFLARHPIA* |
| Ga0099827_112919461 | 3300009090 | Vadose Zone Soil | VPGCELALVPGVKHMTFWDGDGALRALQDFLERHPITSRQTQS* |
| Ga0075418_101019843 | 3300009100 | Populus Rhizosphere | GGSTPVATARRLAELVPGSELALVANVKHMTFWDGDGALIALENFLQRHSIH* |
| Ga0114129_106411782 | 3300009147 | Populus Rhizosphere | LAPLIPGAELALIPKTRHMIFWDGDSAVIALQDFLARHPIRTH* |
| Ga0105243_109671703 | 3300009148 | Miscanthus Rhizosphere | GTARRLAELVPGCERALIPGVRHMTFWDGDGALIALQDFLQRHPIGG* |
| Ga0111538_113619612 | 3300009156 | Populus Rhizosphere | VGTARRLAELIPGCERALIPGVRHMTFWDSDGALIALQDFLQRHPIGR* |
| Ga0111538_137153842 | 3300009156 | Populus Rhizosphere | VNRGGSTPVGTARKLGELVPGSELALVPNVKHMTFWDGDGALIALQDFLQRHRIQ* |
| Ga0075423_118712033 | 3300009162 | Populus Rhizosphere | GSTPVGTARRLAELVPGCERALIPGVRHMTFWDGDGALIALQDFLQRHPIGG* |
| Ga0113563_120709162 | 3300009167 | Freshwater Wetlands | LAPLIPGAELALVPGVRHMTFWDGDGALKALQEFLGRHAMGAK* |
| Ga0105104_106843172 | 3300009168 | Freshwater Sediment | VPGAELALVPNVRHMTFWDGDGALKALQSFLARHPIRGS* |
| Ga0105242_128504641 | 3300009176 | Miscanthus Rhizosphere | AGTARRLAELIPVAELNLVPNVKHMTFWDSDAALIVLQDFLQRHPIA* |
| Ga0105242_132106921 | 3300009176 | Miscanthus Rhizosphere | TPVGTARKLGELVPGCELALVPDVKHMTFWDGDGALQALQEFLTRHPIQR* |
| Ga0105347_10025321 | 3300009609 | Soil | NRRGSTPVDTAKRLGALTPAAELFLIPKTKHMTFWDGTGGLTALQGFLALHPIGTSR* |
| Ga0126374_107452881 | 3300009792 | Tropical Forest Soil | AELALVPGVRHMTFWDSDGALKVLQDFLARHSIGRN* |
| Ga0126374_115058432 | 3300009792 | Tropical Forest Soil | ARRLAELTPGCELFLIPNVKHMTFWDGTGGLAALQDFLVRHPIGASR* |
| Ga0105076_10301791 | 3300009816 | Groundwater Sand | RRLGELVPGAELALVPRVRHMTFWDGDGALLALQNFLKHHPVG* |
| Ga0126380_105176443 | 3300010043 | Tropical Forest Soil | RGSTPVGTAKRLAEVTPGCELFLIPNTKHMTFWDGTGGLAALRDFLLRHPIGMSR* |
| Ga0126384_116914561 | 3300010046 | Tropical Forest Soil | RLGELVPGAELALVPGVKHMTFWDSDGALAALENFLARHPIGVS* |
| Ga0126382_103807471 | 3300010047 | Tropical Forest Soil | GTAKRLAELTPGCELFLIPNVKHMTFWDGTGGLVALQDFLLRHPIATNR* |
| Ga0126382_103982962 | 3300010047 | Tropical Forest Soil | ARRLGELVPGAELVLVPSVRHMTFWDGAGALKVLQDFFARHSIGRN* |
| Ga0134088_102816552 | 3300010304 | Grasslands Soil | LSELIPSAELILVPGVKHMTFWDGSAALEALQDFLARHPIGTS* |
| Ga0126376_118343542 | 3300010359 | Tropical Forest Soil | TARRLGELVPGAELVLVPSVRHMTFWDGDGALKVLQDFFARHSIGRN* |
| Ga0126377_115260001 | 3300010362 | Tropical Forest Soil | TARRLAELTPGCELFLIPNVKHMTFWDGTGGLAALQDFLVRHPIGASR* |
| Ga0126379_129077651 | 3300010366 | Tropical Forest Soil | LVPGAELALVPGVRHMTFWDGDGALKVLQDFLARHSIGRN* |
| Ga0126381_1006996203 | 3300010376 | Tropical Forest Soil | GAELALVPGVKHMTFWDGDGGLKALQNFLTKHPIR* |
| Ga0134122_103910931 | 3300010400 | Terrestrial Soil | STPVGTATRLAEALPGCELFLIPHTKHMTFWDGTGGLIALQGFLERHPIGASR* |
| Ga0134123_133595092 | 3300010403 | Terrestrial Soil | ARRLAELTPGAELCLIPDTKHMTFWDGTGGLIALEDFLLRHPINSNR* |
| Ga0137326_11422611 | 3300011417 | Soil | RRGSTPVDTAKRLGALTPAAELFLIPNTKHMTFWDGTGGLTALQDFLARHPIGASR* |
| Ga0137314_11482912 | 3300011420 | Soil | RLAELTPGAELCLIPDTKHMTFWDGNGGLIALEDFLLRHPIDSNR* |
| Ga0137428_10042531 | 3300011432 | Soil | RLGELVPGAELALIPGVRHMTFWDGDGAIKALLDFLVRHPIHQI* |
| Ga0137426_10627442 | 3300011435 | Soil | LALIPGVRHMTFWDGDGAIKALLDFLVRHPIHQI* |
| Ga0137429_10610562 | 3300011437 | Soil | VGTARKLGELVPGCELALVPDVKHMTFWDGDGALSALQEFLERRPIMSRQTQS* |
| Ga0137429_11151281 | 3300011437 | Soil | VNRGGSTPVGTARKLGELVPGCELALVPEVKHMTFWDGDGALRTLQDFLERHPITSRQTQS* |
| Ga0137431_11053893 | 3300012038 | Soil | DVNRGGSTPVGTARKLGELMPGCELMLVPDVKHMTFWDGDGALKALQVFLGRHPIREI* |
| Ga0137389_116700972 | 3300012096 | Vadose Zone Soil | RGSTPVGTARRLAELVPGAELALIPDVKHMTFWDGNGALTALEDFLARHPIATR* |
| Ga0137344_10683421 | 3300012159 | Soil | RRLAELTPGCELFLIPNVKHMTFWDGTGGLSALQDFLTRHPI* |
| Ga0137363_100075737 | 3300012202 | Vadose Zone Soil | VGTARRLAEATPGAELFLIPNVKHMTIWDGTGGLTALPEFLARHPIGVDNFSVQALL* |
| Ga0137386_100861821 | 3300012351 | Vadose Zone Soil | IPSAELILVPGVKHMTFWDGSAALEALQDFLARHPIGTS* |
| Ga0157336_10288832 | 3300012477 | Arabidopsis Rhizosphere | VGARRGSTPAATAKMLAPLIPGAELALIPKTRHMTFWDGDGALIALQGFLARHPIEPRRK |
| Ga0157355_10013253 | 3300012493 | Unplanted Soil | VERRDSTPAATAKMLAPLIPGAQLALIPKTRHMTFWDGDGALIALQGFLARHPIRTH* |
| Ga0137397_108073481 | 3300012685 | Vadose Zone Soil | LAERVPGCELALVPDVKHMTFWDGDGALIALEDFLQRHRIQ* |
| Ga0157308_102991243 | 3300012910 | Soil | TPVGTARRLAELVPGCERALISGVRHMTFWDGDGALIALQDFLQRHPIGG* |
| Ga0137394_112663282 | 3300012922 | Vadose Zone Soil | ELAFVPNVKHMTFWDGDGALVALQDFLARHPIQA* |
| Ga0126375_106319821 | 3300012948 | Tropical Forest Soil | GCELALVPGVKHMTFWDSDRALVALQDFLRRHPIRV* |
| Ga0126375_114618922 | 3300012948 | Tropical Forest Soil | GAELVLVPSVRHMTFWDGDGALKVLQDFLARHSIGRN* |
| Ga0164301_112268432 | 3300012960 | Soil | VPGSELALVPNVKHMTFWAGDGALIALQDFLQRHRIQ* |
| Ga0134077_100724131 | 3300012972 | Grasslands Soil | RRGSTPIGTARRLAELIPSAELILAPGVKHMTFWDGSAALEALQDFLARHPIGTS* |
| Ga0157374_100976954 | 3300013296 | Miscanthus Rhizosphere | GTARRLAELVPGCERALIPGVRHMTFWDGDGALIALQDFLQRHRMGG* |
| Ga0163162_121830483 | 3300013306 | Switchgrass Rhizosphere | DVNRRGSTPVGTARRLAELVPGCERALIPGVRHMTFWDGDGALIALQDFLQRHPIGG* |
| Ga0075309_12136992 | 3300014268 | Natural And Restored Wetlands | GCELALVPDVKHMTFWDGDGALLVLQDFLQRHPLGKT* |
| Ga0075322_11100801 | 3300014311 | Natural And Restored Wetlands | DVNRGGSTPAGTARRLAELVPGCELALVPNCKHMTFWDGNGALNVLQDFLQRHPIPKI* |
| Ga0180088_10484481 | 3300014868 | Soil | TARRLGELVPGAELALISGVRHMTFWDGDGAIKALLDFLVRHPIHQI* |
| Ga0180086_10651132 | 3300014883 | Soil | KRLAQLTPGVELFLIPNVKHMTFWDGTGGLTALQDFLARHPIDSNR* |
| Ga0180104_12749151 | 3300014884 | Soil | STPVGTARKLGELVPGCELALVPNVKHMTFWDGDGALHTLQEFLGRHPSG* |
| Ga0180063_11858872 | 3300014885 | Soil | PVGTARRLAELVPGCELALIPNVKHMTFWDGARALHALQDFLARHPIPGNQPVRSLKTEP |
| Ga0137418_107684792 | 3300015241 | Vadose Zone Soil | PDAELALIPKTRHMIFWDGDSALIALQDFLARYPIRTH* |
| Ga0180070_10222551 | 3300015251 | Soil | PAATARRLAPLISGAELALVPGVRHMTFWDGDGALQVLQDFLVRHPMGAK* |
| Ga0180073_11108071 | 3300015256 | Soil | GGSTPVGTARRLAELIPGCELALIPEVKHMTFWDGDGGLAALQDFLARHPIDAH* |
| Ga0180085_10217223 | 3300015259 | Soil | LAELIPGCELALVPDVKHMTFWDGDGALAALQDFLGCHPIGSP* |
| Ga0137403_109749132 | 3300015264 | Vadose Zone Soil | ERRGSTPAATAKRLAPLIPGAELALIPKTRHMIFWDGDSALIALQDFLARHPIRTH* |
| Ga0132256_1001762491 | 3300015372 | Arabidopsis Rhizosphere | GELVPGAELALVSGVRHMTFWDGDGALKALQDFLSRHPIAGS* |
| Ga0132256_1005500541 | 3300015372 | Arabidopsis Rhizosphere | VRGCERALIPGVRHMTFWDGDGALIALQKFLQSHPIHA* |
| Ga0132257_1032403821 | 3300015373 | Arabidopsis Rhizosphere | PVGTARRLAELVPGCERALIPGVRHMTFWDGDGALIAMQKFLQGHPIHA* |
| Ga0132255_1043882432 | 3300015374 | Arabidopsis Rhizosphere | STPAGTARRLAELVPAAELNLVPNVKHMTFWDSDAALIVLQDFLQRHPIA* |
| Ga0182033_114626151 | 3300016319 | Soil | GTARRLAELTPGCELFLIPNVKHMTFWDGTGGLTALQDFLARHPIGVSQ |
| Ga0134083_102516342 | 3300017659 | Grasslands Soil | VGTARRLAELVPGCEVALIPGVRHMTFWDSAGALTALQDFLERHPINRT |
| Ga0184634_100748511 | 3300018031 | Groundwater Sediment | RLGELVPGCELALVPNVKHMTFWDGDGALIALQDFLARHPIGTG |
| Ga0184638_11240182 | 3300018052 | Groundwater Sediment | ELVPGAELALIPGVRHMTFWDGDRALKALQDFLARHPIR |
| Ga0184626_103609831 | 3300018053 | Groundwater Sediment | TPVGTARKLGELVPGCELALVPDVKHMTFWDSDGALHALQDFLARHPIKR |
| Ga0184635_101259632 | 3300018072 | Groundwater Sediment | ELVPGSELALVPNVKHMTFWDGDGALIALQDFLQGHRIQ |
| Ga0184627_104451411 | 3300018079 | Groundwater Sediment | ELALVPGVRHMTFWDSTGALDALQSFLARHPISAK |
| Ga0184629_101084151 | 3300018084 | Groundwater Sediment | GSTPVGTARCIAELTPGAELRLIPNTKHMTFWDGSGGLAALQEFLLRHPIAKNS |
| Ga0184629_101857641 | 3300018084 | Groundwater Sediment | GSTPVGTANRLAELTPGAELFLIPNTKHMTFWDGNGGLVALEKFLVRHPIDSRR |
| Ga0184629_104205592 | 3300018084 | Groundwater Sediment | TPVGTARKLAELVPGCELALVPNVKHMTFWDGDGALRTLQEFLGRHPIG |
| Ga0190265_110279132 | 3300018422 | Soil | VERRGSTPAATAKRLAPLIPGAELALISSTRHMTFWDGDGALIALQDFLARHPIA |
| Ga0190272_105456961 | 3300018429 | Soil | ELALIPNTRHMTFWDGDGALIALQNFLTRHPIGRN |
| Ga0190271_107344992 | 3300018481 | Soil | VNRGGSTPAATARQLAELVPGSELALVPNVKHMTFWDGDGALSALENFLQRHPIQ |
| Ga0193743_11044341 | 3300019889 | Soil | PLIPGAELALIPNTRHMTFWDGDGALIALQDFLTRHPIGTR |
| Ga0193717_10490753 | 3300020060 | Soil | GTARKLGELVPGCELALVPNVKHMTFWDGDGALAALQDFLARHPIQ |
| Ga0193717_11892271 | 3300020060 | Soil | PGCELALVPNVKHMTFWDGSGALIALQDFLQRHPIHKT |
| Ga0193716_12058981 | 3300020061 | Soil | VPGAELALIPKTRHMTFWDGTGALDALQDFLTRHPIDTK |
| Ga0194110_106246872 | 3300020084 | Freshwater Lake | RKLGELVPGAELNLVPNVKHMTFWDGEGALHALRGFLGRHPI |
| Ga0206225_10202362 | 3300021064 | Deep Subsurface Sediment | TARKLAVLIPGAELALIPGAKHIVFWDGTGAISCLEDFLARHPIEGI |
| Ga0210404_102486571 | 3300021088 | Soil | VGAARRLGELVPGAELALVPGVKHMTFWDNTGALAALEDFLVRHPIVS |
| Ga0224452_11956651 | 3300022534 | Groundwater Sediment | TPAGTARRLGELVPGCELVLVPNVKHMTFWDGAGALAALQDFLLRHSIRTA |
| Ga0222623_100769331 | 3300022694 | Groundwater Sediment | QVALIPGVRHMTFWDSDGALTALQDFLERHPINRT |
| Ga0222622_107005201 | 3300022756 | Groundwater Sediment | LAELVPGCQVALIPGVRHMTFWDSDGALTALQDFLERHPINRT |
| Ga0222622_113564231 | 3300022756 | Groundwater Sediment | ELVPGAELALVPKTRHMTFWDGTGALDALRDFLDRHPIEPK |
| Ga0247664_11635472 | 3300024232 | Soil | PVGTARKLAELVPGCELALVPDVKHMTFWDGDGALRALQEFLSRHPIKS |
| Ga0233392_10062992 | 3300024241 | Deep Subsurface Sediment | AKRLGELVPGCELALVPNVKHMTLWDGDGALVALQDFLLRHPIEKL |
| Ga0209399_100213523 | 3300025157 | Thermal Springs | GTARRLAELTPGCELALIPDVKHMTFWDGGGALIALQNFLARHPIGAS |
| Ga0209521_100318234 | 3300025164 | Soil | TPVGTARRLAELVPGCELALIPEVKHMTFWDGDGALHALQDFLARHPIRGI |
| Ga0209521_104464481 | 3300025164 | Soil | PLATARCLAELIPGSELALVPGVKHMTFWDGTQALPILMDFLGRHPITAIP |
| Ga0209520_106362602 | 3300025319 | Soil | AELVPGCELALIPEVKHMTFWDGDGALHALQDFLARHPIRGI |
| Ga0210061_10442442 | 3300025537 | Natural And Restored Wetlands | TPVGTARRLAEATAGAELFLIPNTKHMTFWDGIGGVIALEEFLARHPIGASR |
| Ga0207682_106106973 | 3300025893 | Miscanthus Rhizosphere | VGTARRLAELVPGCERALIPGVRHMTFWDGDGALIALQDFLQRHRMGG |
| Ga0207642_111252883 | 3300025899 | Miscanthus Rhizosphere | GCERALIPGVRHMTFWDGDGALIALQDFLQRHPIGG |
| Ga0207654_105144433 | 3300025911 | Corn Rhizosphere | LVPGCERALISGVRHMTFWDGDGALIALQDFLQRHPIGG |
| Ga0207671_112274661 | 3300025914 | Corn Rhizosphere | PVGTARRLAELVPGCERALISGVRHMTFWDGDGALIALQKFLQGHPIHA |
| Ga0207646_111579122 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | RRLAEVVPGAELALIPDVRHMTFWDGNGALTALEDFLARHPIATR |
| Ga0210068_10613561 | 3300025953 | Natural And Restored Wetlands | AELATVPGVRHMTFWDGDGALKTLQDFLDRYPMGEK |
| Ga0210102_10023584 | 3300025971 | Natural And Restored Wetlands | LAELIPGCELALVPDVKHMTFWDGDGALRALQDFLQRHPIGGG |
| Ga0208532_10009431 | 3300026011 | Rice Paddy Soil | PGCELALVPNCKHMTFWDGNGALNVLQDFLQRHPIPKI |
| Ga0209376_13464451 | 3300026540 | Soil | GTARRLAELIPSAELILAPGVKHMTFWDGSAAPEALQDFLARHPIGTS |
| Ga0209474_105100972 | 3300026550 | Soil | ELIPSAELILVPGVKHMTFWDGSAALEALQDFLARHPIGTS |
| Ga0209967_10683192 | 3300027364 | Arabidopsis Thaliana Rhizosphere | ARRLAELVPGSELALVPHVKHMTFWDGDGALIALQDFLQRHPIQ |
| Ga0209843_10788831 | 3300027511 | Groundwater Sand | GSTPVGTARRLGELVPGAELALVPRVRHMTFWDGDGALLALQNFLKHHPVG |
| Ga0209799_10173811 | 3300027654 | Tropical Forest Soil | ELVPGAELVLVPSVRHMTFWDGDGALKVLQDFLARHSIGRN |
| Ga0209485_10159513 | 3300027691 | Agricultural Soil | LAELVPGSELALVPNVKHMTFWDGDGALSAFIDFLSRHSIEKA |
| Ga0209683_104558392 | 3300027840 | Wetland Sediment | GVERRGSTPEATARRLAPLIPGAELALVPGVRHMTFWDGDGALKTLQDFIGRHPIDVK |
| Ga0209701_101928841 | 3300027862 | Vadose Zone Soil | AELVPGAELALIPDVKHMTFWDGNGALTALEDFLARHPIATR |
| Ga0299907_100804624 | 3300030006 | Soil | PAGTARKLGELVPGCELALVPNVKHMTFWDGDGALKALENFLQRHPIQ |
| Ga0310888_103134601 | 3300031538 | Soil | VGTARRLAELVPGCERALIPGVRHMTFWDGDGALIALQKFLQSHPIHA |
| Ga0310888_107747241 | 3300031538 | Soil | ARKLSEMVPGCELALVPNVKHMTFWDGDGALHALEEFLLRHPIGDI |
| Ga0307469_104042493 | 3300031720 | Hardwood Forest Soil | TPAATAKMLAPLIPGAELALIPKTRHMTFWEGDGALIALQGFLARHPIRTH |
| Ga0307473_106126722 | 3300031820 | Hardwood Forest Soil | RRLGELVAGAELALIPGVRHMTFWDGDGALLALRNFLEHHPVG |
| Ga0307406_100391093 | 3300031901 | Rhizosphere | TARKLSELLPGSELKLVPDVKHMTFWDGDGALHALQDFLARHPISGS |
| Ga0326597_101898601 | 3300031965 | Soil | PGGELALIPKVKHMTFWDGDGALHALQDFLARHPIRGNQPV |
| Ga0307414_110337412 | 3300032004 | Rhizosphere | DVNRGGSTPVGTARRLAELVPGSELALVPNVKHMTFWDGDGALIALENFLQRH |
| Ga0307411_121489541 | 3300032005 | Rhizosphere | GSTPVGTALRLAELTPGAELCLVPNTKHMTFWDGNGGLTALEEFLLRHPIGPRGEHSV |
| Ga0315281_104064491 | 3300032163 | Sediment | ALVPGVRHMTFWDGDGALTTLEDFLARHAIVGWCKKY |
| Ga0307470_102360041 | 3300032174 | Hardwood Forest Soil | LVAGAELALIPGVRHMTFWDGDRALLALRNFLEHHPVG |
| Ga0334722_111545291 | 3300033233 | Sediment | IPDAELALVPGVRHMTFWDGKVAVSRLGDFLRRHPTANNRQRVQ |
| Ga0326726_102880581 | 3300033433 | Peat Soil | APLIAGAELALVPGVRHMTFWDGDGALIVLQDFIGRHVIGAK |
| Ga0310811_104541283 | 3300033475 | Soil | LAELVPGCERALIPGVRHMTFWDGDGALIALQDFLQRHPIGG |
| Ga0310811_108353682 | 3300033475 | Soil | RLAELVPGCERALIPGVRHMTFWDGDGALIALQKFLQSHPIHA |
| Ga0316620_102566371 | 3300033480 | Soil | GCELALVPNVKHMTFWDGDGALKVLQDFLQRHPIRRA |
| Ga0247830_113893452 | 3300033551 | Soil | STPVGTARRLAELVPGCERALIPGVRHMTFWDGDGALIALQKFLQGHPIHA |
| Ga0364924_148841_2_148 | 3300033811 | Sediment | VGTARRLGELVPGAELALVPNVKHMTFWDGDGALAALQDFLDRHPIGK |
| Ga0364932_0173833_646_798 | 3300034177 | Sediment | VGTARRLAELTPGAELCLIPNTKHMTFWDGSGGLIALEDFLLRHPIGGGQ |
| Ga0364943_0166613_1_138 | 3300034354 | Sediment | RLAELTPGCELFLIPNVKHMTFWDGTGGLTALQDFLTRHPIGTSQ |
| Ga0364941_112253_544_663 | 3300034417 | Sediment | VPGCELALVPDVKHMTFWDGDGALIALEEFFRRHPIEKL |
| ⦗Top⦘ |