| Basic Information | |
|---|---|
| Family ID | F030855 |
| Family Type | Metagenome |
| Number of Sequences | 184 |
| Average Sequence Length | 42 residues |
| Representative Sequence | MSIRIAPDNNQPSAAIEIPLEKPLPDYDLHQLEQPTPRDVDA |
| Number of Associated Samples | 150 |
| Number of Associated Scaffolds | 184 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 41.30 % |
| % of genes near scaffold ends (potentially truncated) | 98.91 % |
| % of genes from short scaffolds (< 2000 bps) | 88.04 % |
| Associated GOLD sequencing projects | 142 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.34 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (99.457 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (21.739 % of family members) |
| Environment Ontology (ENVO) | Unclassified (32.065 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (50.543 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 11.43% Coil/Unstructured: 88.57% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.34 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 184 Family Scaffolds |
|---|---|---|
| PF02590 | SPOUT_MTase | 54.89 |
| PF02954 | HTH_8 | 22.83 |
| PF01594 | AI-2E_transport | 4.89 |
| PF01467 | CTP_transf_like | 4.35 |
| PF02410 | RsfS | 2.72 |
| PF01016 | Ribosomal_L27 | 2.17 |
| PF00149 | Metallophos | 1.63 |
| PF02265 | S1-P1_nuclease | 0.54 |
| PF12850 | Metallophos_2 | 0.54 |
| PF00989 | PAS | 0.54 |
| PF02572 | CobA_CobO_BtuR | 0.54 |
| PF03795 | YCII | 0.54 |
| PF00171 | Aldedh | 0.54 |
| PF01926 | MMR_HSR1 | 0.54 |
| COG ID | Name | Functional Category | % Frequency in 184 Family Scaffolds |
|---|---|---|---|
| COG1576 | 23S rRNA pseudoU1915 N3-methylase RlmH | Translation, ribosomal structure and biogenesis [J] | 54.89 |
| COG0628 | Predicted PurR-regulated permease PerM | General function prediction only [R] | 4.89 |
| COG0799 | Ribosomal silencing factor RsfS, regulates association of 30S and 50S subunits | Translation, ribosomal structure and biogenesis [J] | 2.72 |
| COG0211 | Ribosomal protein L27 | Translation, ribosomal structure and biogenesis [J] | 2.17 |
| COG0014 | Gamma-glutamyl phosphate reductase | Amino acid transport and metabolism [E] | 0.54 |
| COG1012 | Acyl-CoA reductase or other NAD-dependent aldehyde dehydrogenase | Lipid transport and metabolism [I] | 0.54 |
| COG2109 | ATP:corrinoid adenosyltransferase | Coenzyme transport and metabolism [H] | 0.54 |
| COG2350 | YciI superfamily enzyme, includes 5-CHQ dehydrochlorinase, contains active-site pHis | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.54 |
| COG4230 | Delta 1-pyrroline-5-carboxylate dehydrogenase | Amino acid transport and metabolism [E] | 0.54 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 99.46 % |
| Unclassified | root | N/A | 0.54 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000651|AP72_2010_repI_A10DRAFT_1017187 | All Organisms → cellular organisms → Bacteria | 925 | Open in IMG/M |
| 3300002908|JGI25382J43887_10379503 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 597 | Open in IMG/M |
| 3300002917|JGI25616J43925_10033142 | All Organisms → cellular organisms → Bacteria | 2282 | Open in IMG/M |
| 3300003218|JGI26339J46600_10059126 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1006 | Open in IMG/M |
| 3300004092|Ga0062389_103153000 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 617 | Open in IMG/M |
| 3300004479|Ga0062595_100390939 | All Organisms → cellular organisms → Bacteria | 991 | Open in IMG/M |
| 3300004635|Ga0062388_102945804 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 502 | Open in IMG/M |
| 3300005172|Ga0066683_10076098 | All Organisms → cellular organisms → Bacteria | 2016 | Open in IMG/M |
| 3300005176|Ga0066679_10304052 | All Organisms → cellular organisms → Bacteria | 1037 | Open in IMG/M |
| 3300005179|Ga0066684_10102575 | All Organisms → cellular organisms → Bacteria | 1755 | Open in IMG/M |
| 3300005330|Ga0070690_100560659 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 862 | Open in IMG/M |
| 3300005434|Ga0070709_11032434 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 655 | Open in IMG/M |
| 3300005439|Ga0070711_100340674 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1203 | Open in IMG/M |
| 3300005439|Ga0070711_101829901 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 533 | Open in IMG/M |
| 3300005447|Ga0066689_10331905 | All Organisms → cellular organisms → Bacteria | 947 | Open in IMG/M |
| 3300005526|Ga0073909_10705501 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 506 | Open in IMG/M |
| 3300005569|Ga0066705_10512780 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 749 | Open in IMG/M |
| 3300005578|Ga0068854_100367883 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1181 | Open in IMG/M |
| 3300005618|Ga0068864_101950225 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 593 | Open in IMG/M |
| 3300005843|Ga0068860_100754338 | All Organisms → cellular organisms → Bacteria | 985 | Open in IMG/M |
| 3300005921|Ga0070766_10569050 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 758 | Open in IMG/M |
| 3300005921|Ga0070766_10937833 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 594 | Open in IMG/M |
| 3300006031|Ga0066651_10021403 | All Organisms → cellular organisms → Bacteria | 2792 | Open in IMG/M |
| 3300006032|Ga0066696_10243182 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales | 1161 | Open in IMG/M |
| 3300006046|Ga0066652_100257473 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1531 | Open in IMG/M |
| 3300006162|Ga0075030_101366458 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 555 | Open in IMG/M |
| 3300006173|Ga0070716_100409287 | All Organisms → cellular organisms → Bacteria | 977 | Open in IMG/M |
| 3300006755|Ga0079222_11742094 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 599 | Open in IMG/M |
| 3300006796|Ga0066665_10616766 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 869 | Open in IMG/M |
| 3300006797|Ga0066659_11388233 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 586 | Open in IMG/M |
| 3300006854|Ga0075425_100678085 | All Organisms → cellular organisms → Bacteria | 1184 | Open in IMG/M |
| 3300006854|Ga0075425_102774209 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 539 | Open in IMG/M |
| 3300007255|Ga0099791_10077287 | All Organisms → cellular organisms → Bacteria | 1515 | Open in IMG/M |
| 3300009012|Ga0066710_103162777 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 634 | Open in IMG/M |
| 3300009089|Ga0099828_10257546 | All Organisms → cellular organisms → Bacteria | 1565 | Open in IMG/M |
| 3300009089|Ga0099828_11339566 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 633 | Open in IMG/M |
| 3300009143|Ga0099792_10069642 | All Organisms → cellular organisms → Bacteria | 1770 | Open in IMG/M |
| 3300009552|Ga0116138_1041581 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1339 | Open in IMG/M |
| 3300010046|Ga0126384_12066476 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 546 | Open in IMG/M |
| 3300010048|Ga0126373_10323619 | All Organisms → cellular organisms → Bacteria | 1546 | Open in IMG/M |
| 3300010048|Ga0126373_10498740 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales | 1260 | Open in IMG/M |
| 3300010159|Ga0099796_10118392 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1015 | Open in IMG/M |
| 3300010322|Ga0134084_10430581 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 521 | Open in IMG/M |
| 3300010343|Ga0074044_10446982 | All Organisms → cellular organisms → Bacteria | 845 | Open in IMG/M |
| 3300010358|Ga0126370_11383270 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 664 | Open in IMG/M |
| 3300010359|Ga0126376_10756262 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 943 | Open in IMG/M |
| 3300010359|Ga0126376_12682240 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 547 | Open in IMG/M |
| 3300010360|Ga0126372_10477936 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1163 | Open in IMG/M |
| 3300010366|Ga0126379_13426315 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 531 | Open in IMG/M |
| 3300010376|Ga0126381_101739174 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 901 | Open in IMG/M |
| 3300010379|Ga0136449_101678332 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 959 | Open in IMG/M |
| 3300010398|Ga0126383_10518315 | All Organisms → cellular organisms → Bacteria | 1253 | Open in IMG/M |
| 3300011271|Ga0137393_10577840 | All Organisms → cellular organisms → Bacteria | 964 | Open in IMG/M |
| 3300012189|Ga0137388_10035932 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3906 | Open in IMG/M |
| 3300012189|Ga0137388_10414732 | All Organisms → cellular organisms → Bacteria | 1247 | Open in IMG/M |
| 3300012198|Ga0137364_10265274 | All Organisms → cellular organisms → Bacteria | 1270 | Open in IMG/M |
| 3300012199|Ga0137383_10544724 | All Organisms → cellular organisms → Bacteria | 849 | Open in IMG/M |
| 3300012203|Ga0137399_10047790 | All Organisms → cellular organisms → Bacteria | 3087 | Open in IMG/M |
| 3300012203|Ga0137399_11078913 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 676 | Open in IMG/M |
| 3300012361|Ga0137360_10115117 | All Organisms → cellular organisms → Bacteria | 2082 | Open in IMG/M |
| 3300012582|Ga0137358_10415471 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 909 | Open in IMG/M |
| 3300012582|Ga0137358_10585583 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 749 | Open in IMG/M |
| 3300012582|Ga0137358_10627972 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 720 | Open in IMG/M |
| 3300012918|Ga0137396_10191753 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1501 | Open in IMG/M |
| 3300012918|Ga0137396_10949953 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 626 | Open in IMG/M |
| 3300012923|Ga0137359_10410267 | All Organisms → cellular organisms → Bacteria | 1201 | Open in IMG/M |
| 3300012924|Ga0137413_11562381 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 538 | Open in IMG/M |
| 3300012925|Ga0137419_10282306 | All Organisms → cellular organisms → Bacteria | 1263 | Open in IMG/M |
| 3300012930|Ga0137407_10147046 | Not Available | 2079 | Open in IMG/M |
| 3300012944|Ga0137410_11548526 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 580 | Open in IMG/M |
| 3300012975|Ga0134110_10153475 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales | 952 | Open in IMG/M |
| 3300012986|Ga0164304_10822219 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 719 | Open in IMG/M |
| 3300014164|Ga0181532_10055936 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2583 | Open in IMG/M |
| 3300015051|Ga0137414_1156706 | All Organisms → cellular organisms → Bacteria | 1892 | Open in IMG/M |
| 3300015054|Ga0137420_1119246 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 667 | Open in IMG/M |
| 3300015374|Ga0132255_100426991 | All Organisms → cellular organisms → Bacteria | 1935 | Open in IMG/M |
| 3300017973|Ga0187780_10097297 | All Organisms → cellular organisms → Bacteria | 2026 | Open in IMG/M |
| 3300017974|Ga0187777_10999495 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 605 | Open in IMG/M |
| 3300018006|Ga0187804_10178773 | All Organisms → cellular organisms → Bacteria | 901 | Open in IMG/M |
| 3300018019|Ga0187874_10463842 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 509 | Open in IMG/M |
| 3300018047|Ga0187859_10252228 | All Organisms → cellular organisms → Bacteria | 948 | Open in IMG/M |
| 3300019883|Ga0193725_1059776 | All Organisms → cellular organisms → Bacteria | 958 | Open in IMG/M |
| 3300020199|Ga0179592_10084982 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1452 | Open in IMG/M |
| 3300020580|Ga0210403_10015265 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 6171 | Open in IMG/M |
| 3300020581|Ga0210399_10018958 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 5449 | Open in IMG/M |
| 3300020581|Ga0210399_10185581 | All Organisms → cellular organisms → Bacteria | 1728 | Open in IMG/M |
| 3300020581|Ga0210399_10206534 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1634 | Open in IMG/M |
| 3300020581|Ga0210399_11076831 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 644 | Open in IMG/M |
| 3300021046|Ga0215015_10784478 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 694 | Open in IMG/M |
| 3300021046|Ga0215015_10867012 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 793 | Open in IMG/M |
| 3300021168|Ga0210406_10029576 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 4970 | Open in IMG/M |
| 3300021170|Ga0210400_11009094 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 676 | Open in IMG/M |
| 3300021178|Ga0210408_10415454 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1071 | Open in IMG/M |
| 3300021178|Ga0210408_11377992 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 532 | Open in IMG/M |
| 3300021401|Ga0210393_10425876 | All Organisms → cellular organisms → Bacteria | 1082 | Open in IMG/M |
| 3300021401|Ga0210393_10866783 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 734 | Open in IMG/M |
| 3300021405|Ga0210387_10262475 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1513 | Open in IMG/M |
| 3300021407|Ga0210383_10105756 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2370 | Open in IMG/M |
| 3300021407|Ga0210383_10428180 | All Organisms → cellular organisms → Bacteria | 1142 | Open in IMG/M |
| 3300021407|Ga0210383_11793095 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 500 | Open in IMG/M |
| 3300021420|Ga0210394_10273300 | All Organisms → cellular organisms → Bacteria | 1480 | Open in IMG/M |
| 3300021420|Ga0210394_11688755 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 531 | Open in IMG/M |
| 3300021433|Ga0210391_10663994 | All Organisms → cellular organisms → Bacteria | 817 | Open in IMG/M |
| 3300021433|Ga0210391_11058659 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 631 | Open in IMG/M |
| 3300021474|Ga0210390_11280439 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 589 | Open in IMG/M |
| 3300021475|Ga0210392_10838008 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 687 | Open in IMG/M |
| 3300021479|Ga0210410_10025523 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 5105 | Open in IMG/M |
| 3300021560|Ga0126371_10071857 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3368 | Open in IMG/M |
| 3300021560|Ga0126371_11903727 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 714 | Open in IMG/M |
| 3300022557|Ga0212123_10202458 | All Organisms → cellular organisms → Bacteria | 1470 | Open in IMG/M |
| 3300023030|Ga0224561_1024713 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 532 | Open in IMG/M |
| 3300024219|Ga0247665_1064339 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 525 | Open in IMG/M |
| 3300024249|Ga0247676_1006790 | All Organisms → cellular organisms → Bacteria | 1716 | Open in IMG/M |
| 3300024288|Ga0179589_10014460 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 2458 | Open in IMG/M |
| 3300024288|Ga0179589_10068126 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1387 | Open in IMG/M |
| 3300024288|Ga0179589_10344252 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 676 | Open in IMG/M |
| 3300024330|Ga0137417_1171372 | All Organisms → cellular organisms → Bacteria | 1349 | Open in IMG/M |
| 3300024330|Ga0137417_1195529 | All Organisms → cellular organisms → Bacteria | 1416 | Open in IMG/M |
| 3300024330|Ga0137417_1200363 | All Organisms → cellular organisms → Bacteria | 870 | Open in IMG/M |
| 3300024330|Ga0137417_1206042 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1067 | Open in IMG/M |
| 3300025454|Ga0208039_1022512 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1306 | Open in IMG/M |
| 3300025912|Ga0207707_10540358 | All Organisms → cellular organisms → Bacteria | 991 | Open in IMG/M |
| 3300025915|Ga0207693_11128218 | All Organisms → cellular organisms → Bacteria | 594 | Open in IMG/M |
| 3300025916|Ga0207663_10562679 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 892 | Open in IMG/M |
| 3300025923|Ga0207681_10647277 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 876 | Open in IMG/M |
| 3300026304|Ga0209240_1093412 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1089 | Open in IMG/M |
| 3300026322|Ga0209687_1250963 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 549 | Open in IMG/M |
| 3300026356|Ga0257150_1055273 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 591 | Open in IMG/M |
| 3300026542|Ga0209805_1206940 | All Organisms → cellular organisms → Bacteria | 838 | Open in IMG/M |
| 3300027014|Ga0207815_1024404 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 741 | Open in IMG/M |
| 3300027528|Ga0208985_1040082 | All Organisms → cellular organisms → Bacteria | 913 | Open in IMG/M |
| 3300027548|Ga0209523_1008859 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1819 | Open in IMG/M |
| 3300027583|Ga0209527_1104052 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 636 | Open in IMG/M |
| 3300027605|Ga0209329_1151793 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 509 | Open in IMG/M |
| 3300027643|Ga0209076_1092254 | All Organisms → cellular organisms → Bacteria | 860 | Open in IMG/M |
| 3300027671|Ga0209588_1041392 | All Organisms → cellular organisms → Bacteria | 1487 | Open in IMG/M |
| 3300027767|Ga0209655_10002009 | All Organisms → cellular organisms → Bacteria | 7328 | Open in IMG/M |
| 3300027824|Ga0209040_10297393 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 788 | Open in IMG/M |
| 3300027855|Ga0209693_10380664 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 683 | Open in IMG/M |
| 3300027884|Ga0209275_10446410 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 733 | Open in IMG/M |
| 3300027903|Ga0209488_10036977 | All Organisms → cellular organisms → Bacteria | 3570 | Open in IMG/M |
| 3300027908|Ga0209006_10942716 | All Organisms → cellular organisms → Bacteria | 690 | Open in IMG/M |
| 3300027911|Ga0209698_11262977 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 542 | Open in IMG/M |
| 3300028145|Ga0247663_1063241 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 638 | Open in IMG/M |
| 3300028536|Ga0137415_11119866 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 600 | Open in IMG/M |
| 3300028775|Ga0302231_10192757 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 851 | Open in IMG/M |
| 3300028906|Ga0308309_10844396 | All Organisms → cellular organisms → Bacteria | 795 | Open in IMG/M |
| 3300028906|Ga0308309_10868896 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 783 | Open in IMG/M |
| 3300028906|Ga0308309_11229311 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 645 | Open in IMG/M |
| 3300030057|Ga0302176_10074637 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1313 | Open in IMG/M |
| 3300030746|Ga0302312_10220415 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 726 | Open in IMG/M |
| 3300031028|Ga0302180_10369361 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 724 | Open in IMG/M |
| 3300031057|Ga0170834_105710111 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1091 | Open in IMG/M |
| 3300031231|Ga0170824_122054207 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1232 | Open in IMG/M |
| 3300031549|Ga0318571_10347001 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 568 | Open in IMG/M |
| 3300031561|Ga0318528_10029351 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2696 | Open in IMG/M |
| 3300031561|Ga0318528_10505858 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 649 | Open in IMG/M |
| 3300031679|Ga0318561_10716676 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 550 | Open in IMG/M |
| 3300031715|Ga0307476_11019804 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 609 | Open in IMG/M |
| 3300031718|Ga0307474_10357366 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1132 | Open in IMG/M |
| 3300031744|Ga0306918_10979390 | All Organisms → cellular organisms → Bacteria | 657 | Open in IMG/M |
| 3300031748|Ga0318492_10822230 | All Organisms → cellular organisms → Bacteria | 501 | Open in IMG/M |
| 3300031771|Ga0318546_10865939 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 636 | Open in IMG/M |
| 3300031780|Ga0318508_1177882 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 607 | Open in IMG/M |
| 3300031890|Ga0306925_10093773 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3190 | Open in IMG/M |
| 3300031896|Ga0318551_10113455 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1454 | Open in IMG/M |
| 3300031897|Ga0318520_10048249 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2226 | Open in IMG/M |
| 3300031910|Ga0306923_10932940 | All Organisms → cellular organisms → Bacteria | 948 | Open in IMG/M |
| 3300031941|Ga0310912_10322985 | All Organisms → cellular organisms → Bacteria | 1196 | Open in IMG/M |
| 3300031941|Ga0310912_11505510 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 506 | Open in IMG/M |
| 3300031954|Ga0306926_10823137 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1117 | Open in IMG/M |
| 3300031954|Ga0306926_11808477 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 693 | Open in IMG/M |
| 3300031962|Ga0307479_10239833 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1788 | Open in IMG/M |
| 3300031962|Ga0307479_11401782 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 658 | Open in IMG/M |
| 3300031962|Ga0307479_11440976 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 647 | Open in IMG/M |
| 3300032035|Ga0310911_10794578 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 547 | Open in IMG/M |
| 3300032043|Ga0318556_10696297 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 529 | Open in IMG/M |
| 3300032059|Ga0318533_10271967 | All Organisms → cellular organisms → Bacteria | 1226 | Open in IMG/M |
| 3300032205|Ga0307472_101771367 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 612 | Open in IMG/M |
| 3300032261|Ga0306920_102303857 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 746 | Open in IMG/M |
| 3300032898|Ga0335072_11419270 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 599 | Open in IMG/M |
| 3300032954|Ga0335083_10001494 | All Organisms → cellular organisms → Bacteria | 32033 | Open in IMG/M |
| 3300033486|Ga0316624_11163389 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 700 | Open in IMG/M |
| 3300034091|Ga0326724_0672621 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 506 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 21.74% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 20.11% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 6.52% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 6.52% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 3.80% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 3.26% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 3.26% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.26% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 2.72% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.72% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 2.72% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 2.17% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 2.17% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.63% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.63% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 1.09% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 1.09% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 1.09% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.09% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 1.09% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.09% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.09% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 0.54% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.54% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 0.54% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.54% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 0.54% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.54% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.54% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.54% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.54% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.54% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.54% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.54% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.54% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.54% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.54% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000651 | Forest soil microbial communities from Amazon forest - Pasture72 2010 replicate I A10 | Environmental | Open in IMG/M |
| 3300002908 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_40cm | Environmental | Open in IMG/M |
| 3300002917 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_100cm | Environmental | Open in IMG/M |
| 3300003218 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM1 | Environmental | Open in IMG/M |
| 3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
| 3300004635 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
| 3300005172 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 | Environmental | Open in IMG/M |
| 3300005176 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 | Environmental | Open in IMG/M |
| 3300005179 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 | Environmental | Open in IMG/M |
| 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Environmental | Open in IMG/M |
| 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
| 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
| 3300005447 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 | Environmental | Open in IMG/M |
| 3300005526 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 | Environmental | Open in IMG/M |
| 3300005569 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 | Environmental | Open in IMG/M |
| 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Host-Associated | Open in IMG/M |
| 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Host-Associated | Open in IMG/M |
| 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
| 3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
| 3300006031 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100 | Environmental | Open in IMG/M |
| 3300006032 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 | Environmental | Open in IMG/M |
| 3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
| 3300006162 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 | Environmental | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300007255 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
| 3300009552 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_150 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Environmental | Open in IMG/M |
| 3300010322 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010343 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
| 3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300012924 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012975 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_11112015 | Environmental | Open in IMG/M |
| 3300012986 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MG | Environmental | Open in IMG/M |
| 3300014164 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_30_metaG | Environmental | Open in IMG/M |
| 3300015051 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015054 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300017973 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MG | Environmental | Open in IMG/M |
| 3300017974 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MG | Environmental | Open in IMG/M |
| 3300018006 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_4 | Environmental | Open in IMG/M |
| 3300018019 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_150 | Environmental | Open in IMG/M |
| 3300018047 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_10 | Environmental | Open in IMG/M |
| 3300019883 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2a2 | Environmental | Open in IMG/M |
| 3300020199 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300021046 | Soil microbial communities from Shale Hills CZO, Pennsylvania, United States - 90cm depth | Environmental | Open in IMG/M |
| 3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
| 3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
| 3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
| 3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
| 3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
| 3300021475 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-O | Environmental | Open in IMG/M |
| 3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300022557 | Paint Pots_combined assembly | Environmental | Open in IMG/M |
| 3300023030 | Soil microbial communities from Bohemian Forest, Czech Republic ? CSU2 | Environmental | Open in IMG/M |
| 3300024219 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK06 | Environmental | Open in IMG/M |
| 3300024249 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK17 | Environmental | Open in IMG/M |
| 3300024288 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300024330 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300025454 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_150 (SPAdes) | Environmental | Open in IMG/M |
| 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026304 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_80cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026322 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136 (SPAdes) | Environmental | Open in IMG/M |
| 3300026356 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DL-13-A | Environmental | Open in IMG/M |
| 3300026542 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 (SPAdes) | Environmental | Open in IMG/M |
| 3300027014 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 4 (SPAdes) | Environmental | Open in IMG/M |
| 3300027528 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA Ref_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027548 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM3H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027583 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027605 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027643 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027767 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027824 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027855 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027884 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027908 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027911 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300028145 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK04 | Environmental | Open in IMG/M |
| 3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300028775 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N2_2 | Environmental | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300030057 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E1_1 | Environmental | Open in IMG/M |
| 3300030746 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N2_1 | Environmental | Open in IMG/M |
| 3300031028 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E3_2 | Environmental | Open in IMG/M |
| 3300031057 | Oak Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031549 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f24 | Environmental | Open in IMG/M |
| 3300031561 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26 | Environmental | Open in IMG/M |
| 3300031679 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23 | Environmental | Open in IMG/M |
| 3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
| 3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
| 3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
| 3300031748 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f22 | Environmental | Open in IMG/M |
| 3300031771 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19 | Environmental | Open in IMG/M |
| 3300031780 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f21 | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031896 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f19 | Environmental | Open in IMG/M |
| 3300031897 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16 | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032035 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF170 | Environmental | Open in IMG/M |
| 3300032043 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f24 | Environmental | Open in IMG/M |
| 3300032059 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300032898 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.1 | Environmental | Open in IMG/M |
| 3300032954 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2 | Environmental | Open in IMG/M |
| 3300033486 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_N3_C1_D5_A | Environmental | Open in IMG/M |
| 3300034091 | Peat soil microbial communities from McLean, Ithaca, NY, United States - MB00N | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| AP72_2010_repI_A10DRAFT_10171872 | 3300000651 | Forest Soil | VYNRETMATRIIPDEDKPSVAIEISLEKPLPDYDL |
| JGI25382J43887_103795032 | 3300002908 | Grasslands Soil | MAIRVTADKEQPSATIEIPLEKPLPDYDLNQLEHPTPRXVD |
| JGI25616J43925_100331421 | 3300002917 | Grasslands Soil | MSIRIVPDKDQPSASIEIALEKPLPDYDLDQVEHPTPRDVDAIL |
| JGI26339J46600_100591262 | 3300003218 | Bog Forest Soil | MSLHISPDKNQPSAAIEIPLMNPLPDYDLHQIEQPAPRDIDALLVSQ |
| Ga0062389_1031530002 | 3300004092 | Bog Forest Soil | MTMSIRISPDEYQPSASIEIPLSKPLPDYDLDELEQPTPRDVDGI |
| Ga0062595_1003909392 | 3300004479 | Soil | VKKVYNRKAMAIRLLPDDDKPSVAIEISLEKPVPDYDLNEIDQPT |
| Ga0062388_1029458041 | 3300004635 | Bog Forest Soil | MSIRVVPDQDQPSAAIEISLSKPLPDYDLFQLDQPTPRDV |
| Ga0066683_100760981 | 3300005172 | Soil | MPMRVIPDENQPSAAIEIPLEKPLPDYDLDQLEQPTPRDV |
| Ga0066679_103040521 | 3300005176 | Soil | MAIRIAADKDQPSATIEIPLERALPDYDLNQLEQPTPRDVDA |
| Ga0066684_101025751 | 3300005179 | Soil | MSIRIASDKNQPSATIEIPLEKPLPDYDLHQLEQPTPRDV |
| Ga0070690_1005606592 | 3300005330 | Switchgrass Rhizosphere | MPMRIVPDDDKPSIAIEIPLEHPLPDYDLEQVDQPTPRDVD |
| Ga0070709_110324341 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | MPLKVVPDQHKPSVAIEMPLEKPLPDYDLEDLEKATPREVDGVLVSQG |
| Ga0070711_1003406741 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | MPIKVIPDEDKPFVSIEIPLEKPLPDYDLEDLEKPTPRDVDSILV |
| Ga0070711_1018299011 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | MSIRIIADVNQPSATIEIPLDKPLPDYDLHQLEQPTPRDVDSILVS |
| Ga0066689_103319051 | 3300005447 | Soil | MSIRIVPDKNQPSAAIEIPLEKPLPDYDLHQLEQPTPRDIDAI |
| Ga0073909_107055012 | 3300005526 | Surface Soil | MPIRIKPDHNQPSVAIEIPLEKPLPDYDLEQVEQPTP |
| Ga0066705_105127802 | 3300005569 | Soil | MRVIPDENQPSAAIEIPLEKPLPDYDLEELEQPTP |
| Ga0068854_1003678831 | 3300005578 | Corn Rhizosphere | MRIVPDDDKPSIAIEIPLEHPLPDYDLEQVDQPTPRDVDAILVSQG |
| Ga0068864_1019502251 | 3300005618 | Switchgrass Rhizosphere | MRIVPDDDKPSIAIEIPLEKPLPDYDLEDLEKASPREVDGILVSQGFR |
| Ga0068860_1007543381 | 3300005843 | Switchgrass Rhizosphere | MATRIIPDEHKPSIAIEISLEKPLPDYDLNEIERPTPRDVDG |
| Ga0070766_105690503 | 3300005921 | Soil | MPIRIAADKDQPSVAIEIPIEKPLPDYDLEQVEQP |
| Ga0070766_109378332 | 3300005921 | Soil | MSIRIVADQDQPSAAIEISLEQPLSDYDLLQLDQP |
| Ga0066651_100214031 | 3300006031 | Soil | MAIRVTADKEQPSATIEIPLEKPLPDYDLNQLEYPTPRNVDAILVSQ |
| Ga0066696_102431821 | 3300006032 | Soil | MSIRIASDKNQPSATIEIPLEKPLPDYDLHQLEQPTP |
| Ga0066652_1002574731 | 3300006046 | Soil | MRVIPDENQPSAAIEIPLEKPLPDYDLDQLEQPTPRDVDGIL |
| Ga0075030_1013664581 | 3300006162 | Watersheds | MSIRIAPDTNQPSVAIEIPLEKPMPDYDLHQVEQPTPRDIDGLLVSQGFRDLVDDARG |
| Ga0070716_1004092871 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | MPFKIIPDEDKPSVAIEIPLEKPLPDYDLEDLEKPTPR |
| Ga0079222_117420941 | 3300006755 | Agricultural Soil | MPPRIVPDEGAPSAAIEIPLEKPLPDYDLETLEQPTPRDVDAILVSQ |
| Ga0066665_106167663 | 3300006796 | Soil | MSIRIASDKNQPSATIEIPLEKPLPDYDLHQLEQPTPRDVDAILVS |
| Ga0066659_113882332 | 3300006797 | Soil | MAIRIVPDEGQSSAAVEISLEKPLPDYDLEEVEFPTPR |
| Ga0075425_1006780853 | 3300006854 | Populus Rhizosphere | MAIRILPDDDKPSVAIEISLERPLPDYDLDEIDQPTPRDVDGVL |
| Ga0075425_1027742092 | 3300006854 | Populus Rhizosphere | MPMKIIPDHDKPSVAIEIPLERSLPDYDLTELEHPTPRDVDGVLVS |
| Ga0099791_100772871 | 3300007255 | Vadose Zone Soil | MSVHISHDANRPSATIEIPLENPLPDYDLLQLEQPTPRDVDAVL |
| Ga0066710_1031627772 | 3300009012 | Grasslands Soil | MSIRIAPDNNQPSAAIEIPLEKPLPDYDLHQLEQPTPRDVDA |
| Ga0099828_102575463 | 3300009089 | Vadose Zone Soil | MSVHISHDANRPSATIEIPLENPLPDYDLLQLEQPTPRDVD |
| Ga0099828_113395662 | 3300009089 | Vadose Zone Soil | MSVRISPDANRPSATIEIPLENPLPDYDLLQLEHPT |
| Ga0099792_100696421 | 3300009143 | Vadose Zone Soil | MSIRIVPDENQPSASIEIALDKPLPDYDLEQPDQPTPRDVDAILV |
| Ga0116138_10415813 | 3300009552 | Peatland | MSLRISPDKNQPSAAIEIPLMNPLPDYDLHQIEQPTPRDIDVLLVS |
| Ga0126384_120664761 | 3300010046 | Tropical Forest Soil | MAIRVVPDQDRPSAAIEVSLAKPLPDYDLEQMDQPTP |
| Ga0126373_103236191 | 3300010048 | Tropical Forest Soil | MPMRVIPDENQPSAAIEIPLEKPLPDYDLGELEQPTPRDVDGILVTQ |
| Ga0126373_104987401 | 3300010048 | Tropical Forest Soil | MPVRIVPDENEPSAAIEIPLEKPLPDYDLEGLAQPTPRDVDAILVTQGF |
| Ga0099796_101183922 | 3300010159 | Vadose Zone Soil | MSIRIVPDDNQPSASIEIALEKSLPDYDLDEVEQP |
| Ga0134084_104305812 | 3300010322 | Grasslands Soil | MPMRVIPDQNQPSAAIEIPLEKPLPDYDLEELEKA |
| Ga0074044_104469821 | 3300010343 | Bog Forest Soil | MSIRVVADQDQPSAAIEISLEKALPDYDLIQLEQPTPRDVDALL |
| Ga0126370_113832701 | 3300010358 | Tropical Forest Soil | MPIRLVPDKDQPSAAIEIPLAKPLPDYDLEQMEQPTPRDVDG |
| Ga0126376_107562623 | 3300010359 | Tropical Forest Soil | MPMRIIPDESEPSAAIEIPLEKALPDYDLERLAQPTPRDVDAILV |
| Ga0126376_126822402 | 3300010359 | Tropical Forest Soil | MALRIIPDEGKPSAAIEISLEHPMPDYDLEQIDQPTPRDVDSVL |
| Ga0126372_104779363 | 3300010360 | Tropical Forest Soil | MPMRVIPDENQPSAAIEIPLEKPLPDYDLGELEQPTPRD |
| Ga0126379_134263152 | 3300010366 | Tropical Forest Soil | MPMRIIPDENQPSVAIEIPLEKPLPDYDLEELEQPTPRDVDGIL |
| Ga0126381_1017391743 | 3300010376 | Tropical Forest Soil | MGIRLIPDKDKPSVAIEIPLTKPLPDYDLEQMEQPTPRDIDAILV |
| Ga0136449_1016783321 | 3300010379 | Peatlands Soil | MFMRIAPDKNQPSATIEIPLAKPLPDYDLLQLEQPTPRDVDAILVSQ |
| Ga0126383_105183151 | 3300010398 | Tropical Forest Soil | MAIRVIPDDDKPSVSLEISLEKPLPDYDLDEVDLATPRD |
| Ga0137393_105778401 | 3300011271 | Vadose Zone Soil | MSIRISPDQNQPSAAIEISLERPLPDYDLLQLEQPTPRDVDAV |
| Ga0137388_100359321 | 3300012189 | Vadose Zone Soil | MSVRISPDANRPSATIEIPLENPLPDYDLLQLEHPTPRDVDAILV |
| Ga0137388_104147323 | 3300012189 | Vadose Zone Soil | MSIRIAPDKNQPSATIEIPLEKPLPDYDLHQLEQPTPRD |
| Ga0137364_102652741 | 3300012198 | Vadose Zone Soil | MRVIPDENQPSAAIEIPLEKPLPDYDLDQLEQPTP |
| Ga0137383_105447243 | 3300012199 | Vadose Zone Soil | MSIRIASDKNQPSATIEIPLEKPLPDYDLHQLEQPTPRDVD |
| Ga0137399_100477901 | 3300012203 | Vadose Zone Soil | MSIRIVPDENQPSASIEIALDKPLPDYDLEQPDQPT |
| Ga0137399_110789131 | 3300012203 | Vadose Zone Soil | MSIRISPDANRPSATIEIPLECPLPDYDLHQLEQPTPRDVDAVL |
| Ga0137360_101151174 | 3300012361 | Vadose Zone Soil | MSIRISPDANRPSATIEIPLECPLPDYDLHQLEHP |
| Ga0137358_104154713 | 3300012582 | Vadose Zone Soil | MPLKLLPDSDKPFVTVEIPLEKPLPDYDLEDLDKPTPREVDSVLVSQGF |
| Ga0137358_105855831 | 3300012582 | Vadose Zone Soil | MSIRIAADKEQPSVAIEIPLQRPLPDYDLHQIEQPTPRDIDGL |
| Ga0137358_106279722 | 3300012582 | Vadose Zone Soil | MSIRIVPDKDQPSASIEIALEKPLPDYDLDQVEHP |
| Ga0137396_101917533 | 3300012918 | Vadose Zone Soil | MSIRISPDAHRPSATVEIPLECPLPDYDLHQLEQPTP |
| Ga0137396_109499532 | 3300012918 | Vadose Zone Soil | MSIRIVPDEDQPSASIEIALEKPLPDYDLEEMEQPTPRH |
| Ga0137359_104102671 | 3300012923 | Vadose Zone Soil | MFIRIAPDKDQPSAAIEIPLAKPLPDYDLHQLEQPTPRD |
| Ga0137413_115623812 | 3300012924 | Vadose Zone Soil | MSIRIASDKNQPSATIEIPLERPLPDYDLHQLEQPTPR |
| Ga0137419_102823061 | 3300012925 | Vadose Zone Soil | MAMRIIYDEGKPSAAMEIPLEKPLPDYDLEQIDQPT |
| Ga0137407_101470463 | 3300012930 | Vadose Zone Soil | MSIRIVPDDNQPSASIEIALEKSLPDYDLDEVEQPTPRHV |
| Ga0137410_115485261 | 3300012944 | Vadose Zone Soil | MSIRISPDANRPSATIEIPLECPLPDYDLHQLEQPTPRDVD |
| Ga0134110_101534753 | 3300012975 | Grasslands Soil | MAIRVTADKEQPSATIEIPLEKPLPDYDLNQLEHPTPRNV |
| Ga0164304_108222193 | 3300012986 | Soil | MPMKIIPDGDKPSVAIEIPLEKSLPDYDLEDLEHPTPRDVDGVL |
| Ga0181532_100559365 | 3300014164 | Bog | MSMRLAPDRNKPSVAIEIPLTKPLPEYDLEQVEQPTPRDIDGILVSQG |
| Ga0137414_11567064 | 3300015051 | Vadose Zone Soil | MSIRIAADKEQPSVAIEIPLERPLPDYDLHQIEQPTPRDID |
| Ga0137420_11192463 | 3300015054 | Vadose Zone Soil | MSVHISPDANRPSATIEIPLENPLPDYDLLQLEQPTPRDVDAV |
| Ga0132255_1004269911 | 3300015374 | Arabidopsis Rhizosphere | MAIRVLPDDDKPSVAIEISLEKPVPDYDLNEIDQPTPRDVDGVLV |
| Ga0187780_100972971 | 3300017973 | Tropical Peatland | MSMRIAPDKNQPSVAIEIPLTKPLPDYDLDQVEQPTPRDIDG |
| Ga0187777_109994952 | 3300017974 | Tropical Peatland | MPPRIVPDDGRPSAAIEIPLEKPLPDYDLEQVDQPTPRNVD |
| Ga0187804_101787731 | 3300018006 | Freshwater Sediment | MSFRISPDKEQPSAAIEIPLMNPLADYDLHQIEQPTPRDIDALLVSQGF |
| Ga0187874_104638421 | 3300018019 | Peatland | MPLRISPDKSQPSVTIEIPLEKALPDYDLHQIEQPTPHDI |
| Ga0187859_102522283 | 3300018047 | Peatland | MAMRIIHDEGKPSAAVEIPLEKPLPDYDLEQIDQPTPRDVDAI |
| Ga0193725_10597761 | 3300019883 | Soil | MPLRVLPDSDKPFVSIEIPLEKSLPDYDLEDLDKPTPREVDSVL |
| Ga0179592_100849821 | 3300020199 | Vadose Zone Soil | MPLKVLPDSDKPFVSIEIALEKPLPDYDLEDLDKPTPREVDSVLV |
| Ga0210403_100152651 | 3300020580 | Soil | MRVIPDQDQPSAAIEISLEKPLPDYDLLQLDQPTPRD |
| Ga0210399_100189581 | 3300020581 | Soil | MSIRIVADQDQPSAAIEISLEQPLPDYDLFQLDQPTPRDVDALL |
| Ga0210399_101855814 | 3300020581 | Soil | MAIRIAPDKGKPSVAIEIPLEKPLPDYDLDQLEQPT |
| Ga0210399_102065341 | 3300020581 | Soil | MAIRIAADKDQPSVAIEIPLEKPLPDYDLEQVEQPTPRDIDA |
| Ga0210399_110768311 | 3300020581 | Soil | MSIRISPDANRPSATIEIPLETPLPDYDLHQLEQPTPRDVDAVLV |
| Ga0215015_107844782 | 3300021046 | Soil | MSIRIVPDENQPSASIEIALDKPLPDYDLEQPDQPTPRDVD |
| Ga0215015_108670123 | 3300021046 | Soil | MSIRITPDKDQPSTSIEIPLEKPLPDYDLHQLEQPTPRDVDAVLVSQLSLIHI |
| Ga0210406_100295761 | 3300021168 | Soil | MAIRIAADKDQPSVAIEIPLEKPLPDYDLEQVEQSTPRDIDALLV |
| Ga0210400_110090943 | 3300021170 | Soil | MSIRIIPDQGQPSAAIEISLSTPLPDYDLLQLDQPTPRDVDA |
| Ga0210408_104154541 | 3300021178 | Soil | MRISPDPDKPSVAIEIPLEKPLPDYDLEQLEQPTPRDVDG |
| Ga0210408_113779922 | 3300021178 | Soil | MSIRIVPDEDQPSASVEIALDKPLPDYDLEQMDQPTPRDVDAILVSQG |
| Ga0210393_104258763 | 3300021401 | Soil | MPMRIEPDHNQPCVAIEIPLEKPLPDYDLEQVEQP |
| Ga0210393_108667831 | 3300021401 | Soil | MSIRIVPDEDQPSASVEIALDKPLPDYDLEQMDQPTPRDVD |
| Ga0210387_102624753 | 3300021405 | Soil | MSLRIVPDEGKPSAAIEIALEHPMPDYDLEQIDQPTPRDVD |
| Ga0210383_101057561 | 3300021407 | Soil | MAIRIAPDKDAPSIAVEIPLEKPLPDYDLDQVEQPT |
| Ga0210383_104281801 | 3300021407 | Soil | MSIRIIPDQGQPSAAIEISLSTPLPDYDLLQLEQPTP |
| Ga0210383_117930952 | 3300021407 | Soil | MPARIVPDEGKPSAAIEIPLEKPLPDYDLEQIDQPTPRDVDGVLVSQ |
| Ga0210394_102733003 | 3300021420 | Soil | MSIHISADANQPSATIEIPLENPLPDYDLHQLEHPTPRDVDAVLV |
| Ga0210394_116887552 | 3300021420 | Soil | MPKRIAPDENQPSVAIEIPLERPLPDYDLEQLEQPTPRDIDALLVS |
| Ga0210391_106639943 | 3300021433 | Soil | MSIRIVADQDQPSAAIEISLEQPLPDYDLFQLDQPTPRDVDALLVS |
| Ga0210391_110586591 | 3300021433 | Soil | MSLRIIPDEGKPSAAIEIALEHPMPDYDLEQIDQP |
| Ga0210390_112804392 | 3300021474 | Soil | MSLRIIPDEGKPSAAIEIALEHPMPDYDLEQIDQPTPRDVDGVLVSQGF |
| Ga0210392_108380082 | 3300021475 | Soil | MRIVTDKGRPSATIEIPLQKPLPDYDLEQMDQPTPRD |
| Ga0210410_100255231 | 3300021479 | Soil | MPIRIAADKNQPSVAIEIPIEKPLPDYDLEQVEQPTPRDIDG |
| Ga0126371_100718576 | 3300021560 | Tropical Forest Soil | MAIRFAPDKTKPSVAVEIPLEKPLPDYDLEEIERPT |
| Ga0126371_119037273 | 3300021560 | Tropical Forest Soil | MPMRIVPDENQPSVAIEIPLEKPLPDYDLEELEQP |
| Ga0212123_102024581 | 3300022557 | Iron-Sulfur Acid Spring | MSIRIIADVNQPSATIEIPLDKPLPDYDLDQLEQPTPRDVD |
| Ga0224561_10247132 | 3300023030 | Soil | MSIRIVSDQDQPSAAIEISLEQPLPDYDLLQLDQPTPRDVDAV |
| Ga0247665_10643392 | 3300024219 | Soil | MSIRVIPDEDQPSAAIEISLEKPLPDYDLLQLDQPTPRDVDAILVS |
| Ga0247676_10067901 | 3300024249 | Soil | MALRIAADKDQPSVAIEIPIEKPLPDYDLEQVEQPTP |
| Ga0179589_100144605 | 3300024288 | Vadose Zone Soil | MALRIAADKDQPSVAIEIPIEKPLPDYDLEQVEQP |
| Ga0179589_100681263 | 3300024288 | Vadose Zone Soil | MPLKVLPDSDKPFVSIEIALEKPLPDYDLEDLDKPTPREVDS |
| Ga0179589_103442523 | 3300024288 | Vadose Zone Soil | MSIRISPDEHQPSASVEIPLSKPLPDYDLEQLEQPTPRD |
| Ga0137417_11713721 | 3300024330 | Vadose Zone Soil | MSVHISPDANRPSATIEIPLESPLPDYDLLQLEQPTPRDVDAVLVS |
| Ga0137417_11955291 | 3300024330 | Vadose Zone Soil | MSVHISPDANRPSATIEIPLESPLPDYDLLQLEQPTPRDVPRDVDAVLVS |
| Ga0137417_12003631 | 3300024330 | Vadose Zone Soil | MSVHISPDANRPSATIEIPLENPLPDYDLLQLEQPTPRDVDAVLVS |
| Ga0137417_12060423 | 3300024330 | Vadose Zone Soil | MSVHISPDANRPSATIEIPLESPLPDYDLLQLEQPTPRDVDAVLV |
| Ga0208039_10225123 | 3300025454 | Peatland | MSLRISPDKNQPSAAIEIPLMNPLPDYDLHQIEQPTPR |
| Ga0207707_105403581 | 3300025912 | Corn Rhizosphere | MPIRVIPDEDQPSAAIEISLATPLPDYDLVQLDQPTPRNVDV |
| Ga0207693_111282182 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | MAIRVLPDDDKPSVAIEISLEKPVPDYDLNEIDQPTP |
| Ga0207663_105626791 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | MPMKIIPDGDKPSVAIEIPLEKSLPDYDLEDLEHP |
| Ga0207681_106472773 | 3300025923 | Switchgrass Rhizosphere | MRIVPDDDKPSIAIEIPLEHPLPDYDLEQVDQPTPRDVDAI |
| Ga0209240_10934121 | 3300026304 | Grasslands Soil | MFIRIAPDKDQPSAAIEIPLAKPLPDYDLHQLEQPT |
| Ga0209687_12509632 | 3300026322 | Soil | MPMRIIPDENQPSVAIEIPLEKPLPDYDLEELEQP |
| Ga0257150_10552731 | 3300026356 | Soil | MSIRIVPDDNQPSASIEIALDKSLPDYDLDEVEQPTPRHVDAIL |
| Ga0209805_12069401 | 3300026542 | Soil | MRVIPDENQPSAAIEIPLEKPLPDYDLEELEQPTPRDVD |
| Ga0207815_10244042 | 3300027014 | Tropical Forest Soil | MAQIRYVPDRDKPSLAVEIPLQKALPDYDLEEPEQPT |
| Ga0208985_10400823 | 3300027528 | Forest Soil | MAMRIIHDEGKPSAAIEIPLEKPLPDYDLEQIDQPTPRDVDAILVSQG |
| Ga0209523_10088594 | 3300027548 | Forest Soil | MSIRIAPDKDQPSVAIEIPIEKPLPDYDLEQAEQP |
| Ga0209527_11040521 | 3300027583 | Forest Soil | MSIRIAPDKDQPSVAIEISLEKPLPDYDLEQIDQPTPRDVD |
| Ga0209329_11517932 | 3300027605 | Forest Soil | MPLKVLPDGDKPFVSIEIPLEKSLPDYDLEDLDKPT |
| Ga0209076_10922543 | 3300027643 | Vadose Zone Soil | MSIRISPDANRPSATIEIPLECPLPDYDLHQLEQPTPRDVDA |
| Ga0209588_10413923 | 3300027671 | Vadose Zone Soil | MPVNISPDANRPSATIEIPLENPLPDYDLLQLEQPTPRDVD |
| Ga0209655_100020091 | 3300027767 | Bog Forest Soil | MSIRISPDEKQPSASIEIPLTKPLPDYDLEQLEQPTPRD |
| Ga0209040_102973931 | 3300027824 | Bog Forest Soil | MTMRIAPDKNQPSVAIEIPLVKPLPDYDLEQMEQP |
| Ga0209693_103806643 | 3300027855 | Soil | MSIRIVADQDQPSAAIEISLEQPLPDYDLFQLDQPTPRDVDAL |
| Ga0209275_104464103 | 3300027884 | Soil | MPIRIAADKDQPSVAIEIPIEKPLPDYDLEQVEQPTPRDIDGLLVSQ |
| Ga0209488_100369774 | 3300027903 | Vadose Zone Soil | MSIRIVPDENQPSASIEIALDKPLPDYDLEQPDQPTPRDVDALLV |
| Ga0209006_109427162 | 3300027908 | Forest Soil | MALRIAADKDQPSVAIEIPIEKPLPDYDLEQVEQPTPRDI |
| Ga0209698_112629772 | 3300027911 | Watersheds | MSIRIAPDTNQPSVAIEIPLEKPMPDYDLHQVEQPTPRDIDGLLVSQGFRDLVD |
| Ga0247663_10632411 | 3300028145 | Soil | MSIRIIPDEDQPSAAIEISLENPLPDYDLLQLDQPTPR |
| Ga0137415_111198661 | 3300028536 | Vadose Zone Soil | MSIRIVPDENQPSATIEIPLEKPLPDYDLEQMEQPT |
| Ga0302231_101927573 | 3300028775 | Palsa | MPTRIIPDSDQPSIAIEIALEKDLPDYDLEDLEKPAPRDVDGILVSQGF |
| Ga0308309_108443961 | 3300028906 | Soil | MALRIIPDEGKPSAAIEIALENPLPEYDIEQIDQPTPRDVDGV |
| Ga0308309_108688961 | 3300028906 | Soil | MRISPDPDKPSVAIEIPLEKPLPDYDLEQLEQPTPRDVDGIL |
| Ga0308309_112293112 | 3300028906 | Soil | MAMRIAPDKGKPSVAIEIPLEKPLPDYDLEQLEQP |
| Ga0302176_100746371 | 3300030057 | Palsa | MSIRISPDEARPSVSIEIPLDKPLEDYDLLQLEQPTPRDVDGVLVSQG |
| Ga0302312_102204151 | 3300030746 | Palsa | MSIRISPDERRPSASIEIPLAKPLPDYDLEQLEQPT |
| Ga0302180_103693613 | 3300031028 | Palsa | MSIRISPDEARPSVSIEIPLDKPLEDYDLLQLEQPTPRDVDGVL |
| Ga0170834_1057101113 | 3300031057 | Forest Soil | MALRIAADKDQPSVAIEIPIERPLPDYDLEQIEQPTPRD |
| Ga0170824_1220542073 | 3300031231 | Forest Soil | MSLRIIPDEGKPSAAIEIALENPLPDYDLEQIDQPTPRDV |
| Ga0318571_103470012 | 3300031549 | Soil | MVLGPMTARIIPDDDKPSVAIEIPIAKPLPDYDLEQVE |
| Ga0318528_100293511 | 3300031561 | Soil | MPMRVIADQNQPSAAIEIPLEKPLPDYDLEELERA |
| Ga0318528_105058581 | 3300031561 | Soil | MAIRISPDKSSPSVAIEIPLEKPLPDYDLHQIEQPTPRD |
| Ga0318561_107166762 | 3300031679 | Soil | MGIRLIPDKDKPSVAIEIPLTKPLPDYDLEQMEQPTPRDIDAILVTQGF |
| Ga0307476_110198042 | 3300031715 | Hardwood Forest Soil | MAIRIAADKDQPSVAIEIPLEKPLPDYDLEQVEQPTPRDIDALLVSQ |
| Ga0307474_103573661 | 3300031718 | Hardwood Forest Soil | MKLLYNVNPMALRIIPDEGKPSAAIEIALDRPMPDYDLEQIDQPTPRDVDGVLVSQG |
| Ga0306918_109793902 | 3300031744 | Soil | MSTRIIPDDDKPSVAIEISLEKPLPDYDLCEMDQPSPRDVDGVLV |
| Ga0318492_108222302 | 3300031748 | Soil | MRVIADQNQPSAAIEIPLEKPLPDYDLEELEKATPRDVDGIL |
| Ga0318546_108659391 | 3300031771 | Soil | MAVRLAPDNDRPSVAIEIPLEKPLPDYDLDQIEQPTPRDIDAVLVSQG |
| Ga0318508_11778821 | 3300031780 | Soil | MGIRVIPDKDKPSVAIEIPLMKPLPDYDLEQVEQPTPR |
| Ga0306925_100937731 | 3300031890 | Soil | MAIRFAPDKTKPSVAVEIPLEKPLPDYDLEELERPTPRDVD |
| Ga0318551_101134554 | 3300031896 | Soil | MGIRLIPDKDKPSVAIEIPLTKPLPDYDLEQMEQPT |
| Ga0318520_100482492 | 3300031897 | Soil | MPMRVIADQNQPSAAIEIPLEKPLPDYDLEELEKATPRDVDGILVTQGSAIWLMMRAAS |
| Ga0306923_109329401 | 3300031910 | Soil | MGIRLIPDKDKPSVAIEIPLGKPLPDYDLEQMEQP |
| Ga0310912_103229853 | 3300031941 | Soil | MGIRLIPDKDKPSVAIEIPLTKPLPDYDLEQMEQPTPRDIDAILVTQG |
| Ga0310912_115055102 | 3300031941 | Soil | MAQIRYVPDKDKPSLAVEIPLQKPLPDYDLEELGQPTPRDVD |
| Ga0306926_108231371 | 3300031954 | Soil | MGIRVIPDKDKPSVAIEIPLMKPLPDYDLEQVEQPTPRDID |
| Ga0306926_118084771 | 3300031954 | Soil | MAQIRYVPDKDKPSLAVEIPLQKPLPDYDLEELGQPTPRDVDGILVTQ |
| Ga0307479_102398331 | 3300031962 | Hardwood Forest Soil | MPLKIIPDADKPSVAIEIPLEKSLPDYDLVDLEQPTPRDVDSVLV |
| Ga0307479_114017821 | 3300031962 | Hardwood Forest Soil | MTLRIAADKDQPSVAIEIPLEKPLPDYDLHQIEQPTPRDIDAVLVSQG |
| Ga0307479_114409761 | 3300031962 | Hardwood Forest Soil | MSIRISPDQNQPSAAIEISLERPLLDYDLDQIEQPTPRDIDVILVSQ |
| Ga0310911_107945781 | 3300032035 | Soil | MPIRIKPDHNQPSVAIEIPLEKPLPDYDLEQLEQPTPRDID |
| Ga0318556_106962971 | 3300032043 | Soil | MAARIIPDSDKPSVAIEIPLEKPLSDYDLEQVEQRTPRDVD |
| Ga0318533_102719671 | 3300032059 | Soil | MTARIIPDDDKPSVAIEIPIAKPLPDYDLEQVEQPTPRDVDG |
| Ga0307472_1017713672 | 3300032205 | Hardwood Forest Soil | MSIRIVLDENQPSASIEIALDKPLPDYDLEQPDQPTPRDVDAI |
| Ga0306920_1023038571 | 3300032261 | Soil | MSIRIAPDKDQPSVAIEIPLENPLPDYDLEQIEQPTPRDIDGL |
| Ga0335072_114192701 | 3300032898 | Soil | MSIRIIPDEDKPSAAIEIVLEKPLPDYDLEQMEQPTPR |
| Ga0335083_100014941 | 3300032954 | Soil | MSIRVIPDEDQPSAAIEISLEKPLPDYDLLQMEQPTPRDVDLILVSQ |
| Ga0316624_111633893 | 3300033486 | Soil | MAIRIIPDEDQPSAAIEISLEKPLPDYDLLQLDQPTPRDVDVILV |
| Ga0326724_0672621_358_504 | 3300034091 | Peat Soil | MAFRLAPDKNQPSVAVEIPLRKLLPDYDLEQMEQRAPRDIDAILVSQGF |
| ⦗Top⦘ |