| Basic Information | |
|---|---|
| Family ID | F030765 |
| Family Type | Metagenome |
| Number of Sequences | 184 |
| Average Sequence Length | 40 residues |
| Representative Sequence | MDTEQTFDQEFSVEDITNAIVNQAKAEVKSKFGNKKRHRQ |
| Number of Associated Samples | 101 |
| Number of Associated Scaffolds | 184 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 84.24 % |
| % of genes near scaffold ends (potentially truncated) | 7.61 % |
| % of genes from short scaffolds (< 2000 bps) | 59.78 % |
| Associated GOLD sequencing projects | 92 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.43 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (64.130 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater (20.652 % of family members) |
| Environment Ontology (ENVO) | Unclassified (51.630 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (54.348 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 42.65% β-sheet: 0.00% Coil/Unstructured: 57.35% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.43 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 184 Family Scaffolds |
|---|---|---|
| PF13640 | 2OG-FeII_Oxy_3 | 5.98 |
| PF03767 | Acid_phosphat_B | 2.17 |
| PF00255 | GSHPx | 2.17 |
| PF05901 | Excalibur | 2.17 |
| PF06067 | DUF932 | 2.17 |
| PF00166 | Cpn10 | 2.17 |
| PF04973 | NMN_transporter | 2.17 |
| PF00067 | p450 | 1.63 |
| PF14020 | DUF4236 | 1.63 |
| PF01844 | HNH | 1.09 |
| PF12849 | PBP_like_2 | 1.09 |
| PF03796 | DnaB_C | 1.09 |
| PF04488 | Gly_transf_sug | 1.09 |
| PF13578 | Methyltransf_24 | 1.09 |
| PF02945 | Endonuclease_7 | 1.09 |
| PF11397 | GlcNAc | 0.54 |
| PF13419 | HAD_2 | 0.54 |
| PF03031 | NIF | 0.54 |
| PF01391 | Collagen | 0.54 |
| PF02467 | Whib | 0.54 |
| PF14025 | DUF4241 | 0.54 |
| PF05257 | CHAP | 0.54 |
| PF03171 | 2OG-FeII_Oxy | 0.54 |
| PF07883 | Cupin_2 | 0.54 |
| PF16861 | Carbam_trans_C | 0.54 |
| PF00685 | Sulfotransfer_1 | 0.54 |
| PF13469 | Sulfotransfer_3 | 0.54 |
| PF00210 | Ferritin | 0.54 |
| PF00296 | Bac_luciferase | 0.54 |
| PF08795 | DUF1796 | 0.54 |
| PF12587 | DUF3761 | 0.54 |
| PF00565 | SNase | 0.54 |
| PF13155 | Toprim_2 | 0.54 |
| PF05050 | Methyltransf_21 | 0.54 |
| PF00011 | HSP20 | 0.54 |
| PF07739 | TipAS | 0.54 |
| PF00535 | Glycos_transf_2 | 0.54 |
| PF04860 | Phage_portal | 0.54 |
| PF01464 | SLT | 0.54 |
| PF00534 | Glycos_transf_1 | 0.54 |
| PF07235 | DUF1427 | 0.54 |
| COG ID | Name | Functional Category | % Frequency in 184 Family Scaffolds |
|---|---|---|---|
| COG0234 | Co-chaperonin GroES (HSP10) | Posttranslational modification, protein turnover, chaperones [O] | 2.17 |
| COG0386 | Thioredoxin/glutathione peroxidase BtuE, reduces lipid peroxides | Defense mechanisms [V] | 2.17 |
| COG2503 | Predicted secreted acid phosphatase | General function prediction only [R] | 2.17 |
| COG3201 | Nicotinamide riboside transporter PnuC | Coenzyme transport and metabolism [H] | 2.17 |
| COG3700 | Acid phosphatase, class B | Inorganic ion transport and metabolism [P] | 2.17 |
| COG2124 | Cytochrome P450 | Defense mechanisms [V] | 1.63 |
| COG0305 | Replicative DNA helicase | Replication, recombination and repair [L] | 1.09 |
| COG1066 | DNA repair protein RadA/Sms, contains AAA+ ATPase domain | Replication, recombination and repair [L] | 1.09 |
| COG3774 | Mannosyltransferase OCH1 or related enzyme | Cell wall/membrane/envelope biogenesis [M] | 1.09 |
| COG0071 | Small heat shock protein IbpA, HSP20 family | Posttranslational modification, protein turnover, chaperones [O] | 0.54 |
| COG2141 | Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase) | Coenzyme transport and metabolism [H] | 0.54 |
| COG4317 | Xanthosine utilization system component, XapX domain | Nucleotide transport and metabolism [F] | 0.54 |
| COG5190 | TFIIF-interacting CTD phosphatase, includes NLI-interacting factor | Transcription [K] | 0.54 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 64.13 % |
| All Organisms | root | All Organisms | 35.87 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001282|B570J14230_10026734 | Not Available | 2070 | Open in IMG/M |
| 3300002161|JGI24766J26685_10031423 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1265 | Open in IMG/M |
| 3300002273|B570J29588_107657 | Not Available | 617 | Open in IMG/M |
| 3300002298|B570J29599_1003985 | Not Available | 962 | Open in IMG/M |
| 3300002303|B570J29644_1000002 | Not Available | 43494 | Open in IMG/M |
| 3300002408|B570J29032_109417435 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 749 | Open in IMG/M |
| 3300002408|B570J29032_109843227 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Methanomada group → Methanobacteria → Methanobacteriales → Methanobacteriaceae → Methanobrevibacter → unclassified Methanobrevibacter → Methanobrevibacter sp. | 1599 | Open in IMG/M |
| 3300002470|metazooDRAFT_1363935 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 771 | Open in IMG/M |
| 3300002835|B570J40625_100060907 | Not Available | 5171 | Open in IMG/M |
| 3300002835|B570J40625_100073130 | Not Available | 4521 | Open in IMG/M |
| 3300002835|B570J40625_100078016 | All Organisms → Viruses → Predicted Viral | 4315 | Open in IMG/M |
| 3300002835|B570J40625_100211478 | Not Available | 2083 | Open in IMG/M |
| 3300002835|B570J40625_101333168 | Not Available | 595 | Open in IMG/M |
| 3300004054|Ga0063232_10179086 | Not Available | 626 | Open in IMG/M |
| 3300004096|Ga0066177_10223749 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 779 | Open in IMG/M |
| 3300004112|Ga0065166_10003268 | Not Available | 3815 | Open in IMG/M |
| 3300004112|Ga0065166_10114016 | Not Available | 998 | Open in IMG/M |
| 3300004112|Ga0065166_10234493 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 733 | Open in IMG/M |
| 3300004112|Ga0065166_10406338 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 569 | Open in IMG/M |
| 3300004112|Ga0065166_10465884 | Not Available | 533 | Open in IMG/M |
| 3300004124|Ga0066178_10050467 | All Organisms → Viruses → Predicted Viral | 1056 | Open in IMG/M |
| 3300004124|Ga0066178_10081407 | Not Available | 862 | Open in IMG/M |
| 3300005517|Ga0070374_10060211 | All Organisms → Viruses → Predicted Viral | 1977 | Open in IMG/M |
| 3300005517|Ga0070374_10244344 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 919 | Open in IMG/M |
| 3300005527|Ga0068876_10136184 | All Organisms → Viruses → Predicted Viral | 1450 | Open in IMG/M |
| 3300005662|Ga0078894_10083313 | All Organisms → Viruses → Predicted Viral | 2789 | Open in IMG/M |
| 3300005662|Ga0078894_10403431 | Not Available | 1235 | Open in IMG/M |
| 3300005662|Ga0078894_10416105 | Not Available | 1213 | Open in IMG/M |
| 3300005662|Ga0078894_10501882 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1089 | Open in IMG/M |
| 3300005662|Ga0078894_10525924 | All Organisms → Viruses → Predicted Viral | 1060 | Open in IMG/M |
| 3300005662|Ga0078894_10832058 | Not Available | 805 | Open in IMG/M |
| 3300005662|Ga0078894_11269606 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 621 | Open in IMG/M |
| 3300005662|Ga0078894_11638724 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 530 | Open in IMG/M |
| 3300005662|Ga0078894_11755599 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 507 | Open in IMG/M |
| 3300005805|Ga0079957_1007210 | Not Available | 8772 | Open in IMG/M |
| 3300005805|Ga0079957_1010828 | Not Available | 6865 | Open in IMG/M |
| 3300005805|Ga0079957_1062134 | Not Available | 2209 | Open in IMG/M |
| 3300005805|Ga0079957_1116789 | Not Available | 1419 | Open in IMG/M |
| 3300005941|Ga0070743_10004540 | Not Available | 5050 | Open in IMG/M |
| 3300005941|Ga0070743_10118679 | Not Available | 885 | Open in IMG/M |
| 3300006484|Ga0070744_10002280 | Not Available | 5802 | Open in IMG/M |
| 3300006484|Ga0070744_10009756 | Not Available | 2846 | Open in IMG/M |
| 3300006484|Ga0070744_10014701 | Not Available | 2321 | Open in IMG/M |
| 3300006639|Ga0079301_1031662 | Not Available | 1780 | Open in IMG/M |
| 3300007545|Ga0102873_1029306 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1690 | Open in IMG/M |
| 3300007547|Ga0102875_1032913 | Not Available | 1702 | Open in IMG/M |
| 3300007606|Ga0102923_1130469 | Not Available | 787 | Open in IMG/M |
| 3300007632|Ga0102894_1144903 | Not Available | 629 | Open in IMG/M |
| 3300008055|Ga0108970_11242059 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 586 | Open in IMG/M |
| 3300008107|Ga0114340_1003252 | Not Available | 9174 | Open in IMG/M |
| 3300008107|Ga0114340_1093566 | All Organisms → Viruses → Predicted Viral | 1215 | Open in IMG/M |
| 3300008107|Ga0114340_1096758 | Not Available | 2370 | Open in IMG/M |
| 3300008108|Ga0114341_10421603 | Not Available | 637 | Open in IMG/M |
| 3300008110|Ga0114343_1021331 | Not Available | 2857 | Open in IMG/M |
| 3300008110|Ga0114343_1129967 | Not Available | 831 | Open in IMG/M |
| 3300008113|Ga0114346_1138628 | Not Available | 1056 | Open in IMG/M |
| 3300008113|Ga0114346_1216479 | Not Available | 748 | Open in IMG/M |
| 3300008261|Ga0114336_1036829 | All Organisms → cellular organisms → Bacteria | 2651 | Open in IMG/M |
| 3300009158|Ga0114977_10186206 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1223 | Open in IMG/M |
| 3300009159|Ga0114978_10621449 | Not Available | 622 | Open in IMG/M |
| 3300009164|Ga0114975_10781950 | Not Available | 501 | Open in IMG/M |
| 3300009183|Ga0114974_10002650 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 13751 | Open in IMG/M |
| 3300009183|Ga0114974_10331589 | Not Available | 887 | Open in IMG/M |
| 3300009194|Ga0114983_1023097 | All Organisms → Viruses → Predicted Viral | 1623 | Open in IMG/M |
| 3300009194|Ga0114983_1073069 | Not Available | 778 | Open in IMG/M |
| 3300009419|Ga0114982_1018132 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2367 | Open in IMG/M |
| 3300010354|Ga0129333_10071784 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3216 | Open in IMG/M |
| 3300010388|Ga0136551_1048725 | Not Available | 773 | Open in IMG/M |
| 3300010388|Ga0136551_1091610 | Not Available | 533 | Open in IMG/M |
| 3300010970|Ga0137575_10009603 | All Organisms → Viruses → Predicted Viral | 1686 | Open in IMG/M |
| 3300012286|Ga0157137_100027 | Not Available | 8749 | Open in IMG/M |
| 3300012286|Ga0157137_102231 | Not Available | 1552 | Open in IMG/M |
| 3300012346|Ga0157141_1000486 | Not Available | 11798 | Open in IMG/M |
| 3300012352|Ga0157138_1000018 | Not Available | 54788 | Open in IMG/M |
| 3300012352|Ga0157138_1023100 | Not Available | 997 | Open in IMG/M |
| 3300012663|Ga0157203_1029765 | Not Available | 768 | Open in IMG/M |
| 3300012665|Ga0157210_1010471 | Not Available | 1641 | Open in IMG/M |
| 3300013004|Ga0164293_10076668 | Not Available | 2618 | Open in IMG/M |
| 3300013004|Ga0164293_10499330 | Not Available | 803 | Open in IMG/M |
| 3300013005|Ga0164292_10564174 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 739 | Open in IMG/M |
| 3300020048|Ga0207193_1012993 | Not Available | 11335 | Open in IMG/M |
| 3300020048|Ga0207193_1013067 | Not Available | 11287 | Open in IMG/M |
| 3300020151|Ga0211736_10019674 | All Organisms → Viruses → Predicted Viral | 2787 | Open in IMG/M |
| 3300020151|Ga0211736_10925824 | Not Available | 40136 | Open in IMG/M |
| 3300020159|Ga0211734_10627824 | Not Available | 7281 | Open in IMG/M |
| 3300020161|Ga0211726_10500117 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 31288 | Open in IMG/M |
| 3300020480|Ga0208201_108752 | Not Available | 771 | Open in IMG/M |
| 3300020494|Ga0208326_100339 | Not Available | 3417 | Open in IMG/M |
| 3300020498|Ga0208050_1005989 | All Organisms → Viruses → Predicted Viral | 1471 | Open in IMG/M |
| 3300020501|Ga0208590_1019126 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102 | 798 | Open in IMG/M |
| 3300020506|Ga0208091_1007763 | Not Available | 1384 | Open in IMG/M |
| 3300020506|Ga0208091_1029458 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 617 | Open in IMG/M |
| 3300020519|Ga0208223_1001036 | Not Available | 6285 | Open in IMG/M |
| 3300020531|Ga0208487_1001410 | All Organisms → Viruses → Predicted Viral | 4620 | Open in IMG/M |
| 3300020531|Ga0208487_1025753 | Not Available | 698 | Open in IMG/M |
| 3300021956|Ga0213922_1012307 | Not Available | 2334 | Open in IMG/M |
| 3300021961|Ga0222714_10090190 | All Organisms → Viruses → Predicted Viral | 1970 | Open in IMG/M |
| 3300021962|Ga0222713_10004228 | Not Available | 14483 | Open in IMG/M |
| 3300021962|Ga0222713_10014559 | Not Available | 6853 | Open in IMG/M |
| 3300021962|Ga0222713_10431149 | Not Available | 804 | Open in IMG/M |
| 3300021963|Ga0222712_10159320 | Not Available | 1515 | Open in IMG/M |
| 3300021963|Ga0222712_10791513 | Not Available | 524 | Open in IMG/M |
| 3300022200|Ga0196901_1030351 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2112 | Open in IMG/M |
| 3300023174|Ga0214921_10000295 | Not Available | 98310 | Open in IMG/M |
| 3300023174|Ga0214921_10001877 | Not Available | 35173 | Open in IMG/M |
| 3300023174|Ga0214921_10006652 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 15701 | Open in IMG/M |
| 3300023174|Ga0214921_10034705 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4833 | Open in IMG/M |
| 3300023174|Ga0214921_10077856 | Not Available | 2647 | Open in IMG/M |
| 3300024343|Ga0244777_10186852 | Not Available | 1333 | Open in IMG/M |
| 3300024346|Ga0244775_10012800 | Not Available | 7897 | Open in IMG/M |
| 3300024346|Ga0244775_10024338 | Not Available | 5451 | Open in IMG/M |
| 3300024346|Ga0244775_10096912 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102 | 2509 | Open in IMG/M |
| 3300024346|Ga0244775_10140085 | Not Available | 2044 | Open in IMG/M |
| 3300024346|Ga0244775_10192070 | Not Available | 1715 | Open in IMG/M |
| 3300024346|Ga0244775_10289252 | All Organisms → Viruses → Predicted Viral | 1360 | Open in IMG/M |
| 3300024346|Ga0244775_10809212 | Not Available | 749 | Open in IMG/M |
| 3300024348|Ga0244776_10000326 | Not Available | 55326 | Open in IMG/M |
| 3300024348|Ga0244776_10213843 | All Organisms → Viruses → Predicted Viral | 1363 | Open in IMG/M |
| 3300025091|Ga0209616_1015869 | Not Available | 766 | Open in IMG/M |
| 3300027114|Ga0208009_1007521 | All Organisms → Viruses → Predicted Viral | 2794 | Open in IMG/M |
| 3300027499|Ga0208788_1025466 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Donellivirus → Donellivirus gee | 1811 | Open in IMG/M |
| 3300027499|Ga0208788_1151194 | Not Available | 507 | Open in IMG/M |
| 3300027710|Ga0209599_10000020 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae | 124368 | Open in IMG/M |
| 3300027710|Ga0209599_10000044 | Not Available | 87910 | Open in IMG/M |
| 3300027710|Ga0209599_10000200 | Not Available | 42280 | Open in IMG/M |
| 3300027710|Ga0209599_10001755 | Not Available | 9737 | Open in IMG/M |
| 3300027710|Ga0209599_10003682 | Not Available | 5808 | Open in IMG/M |
| 3300027710|Ga0209599_10016544 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2131 | Open in IMG/M |
| 3300027759|Ga0209296_1002329 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 13728 | Open in IMG/M |
| 3300027759|Ga0209296_1014049 | All Organisms → cellular organisms → Bacteria | 4709 | Open in IMG/M |
| 3300027759|Ga0209296_1116378 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1252 | Open in IMG/M |
| 3300027797|Ga0209107_10081930 | Not Available | 1758 | Open in IMG/M |
| 3300027805|Ga0209229_10013656 | All Organisms → Viruses → Predicted Viral | 3455 | Open in IMG/M |
| 3300027805|Ga0209229_10060070 | All Organisms → Viruses → Predicted Viral | 1699 | Open in IMG/M |
| 3300027805|Ga0209229_10141519 | Not Available | 1084 | Open in IMG/M |
| 3300027805|Ga0209229_10186403 | Not Available | 930 | Open in IMG/M |
| 3300027805|Ga0209229_10218765 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 851 | Open in IMG/M |
| 3300027805|Ga0209229_10380240 | Not Available | 615 | Open in IMG/M |
| 3300027805|Ga0209229_10410838 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 586 | Open in IMG/M |
| 3300027892|Ga0209550_10115840 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1974 | Open in IMG/M |
| 3300027892|Ga0209550_10382976 | Not Available | 876 | Open in IMG/M |
| 3300027892|Ga0209550_10585222 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 657 | Open in IMG/M |
| 3300028025|Ga0247723_1000055 | Not Available | 64365 | Open in IMG/M |
| 3300028025|Ga0247723_1023874 | Not Available | 2018 | Open in IMG/M |
| 3300028025|Ga0247723_1052302 | Not Available | 1163 | Open in IMG/M |
| 3300028025|Ga0247723_1074063 | Not Available | 910 | Open in IMG/M |
| 3300028027|Ga0247722_10131422 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 910 | Open in IMG/M |
| 3300029349|Ga0238435_113808 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102 | 697 | Open in IMG/M |
| 3300031784|Ga0315899_11132936 | Not Available | 684 | Open in IMG/M |
| 3300031857|Ga0315909_10556146 | Not Available | 778 | Open in IMG/M |
| 3300031857|Ga0315909_10950969 | Not Available | 524 | Open in IMG/M |
| 3300031963|Ga0315901_11218391 | Not Available | 509 | Open in IMG/M |
| 3300032092|Ga0315905_10007888 | Not Available | 10760 | Open in IMG/M |
| 3300032092|Ga0315905_10444006 | Not Available | 1208 | Open in IMG/M |
| 3300033816|Ga0334980_0000095 | Not Available | 41955 | Open in IMG/M |
| 3300033978|Ga0334977_0002020 | Not Available | 11819 | Open in IMG/M |
| 3300033978|Ga0334977_0272484 | Not Available | 824 | Open in IMG/M |
| 3300033980|Ga0334981_0245573 | Not Available | 813 | Open in IMG/M |
| 3300033992|Ga0334992_0076639 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Methanomada group → Methanobacteria → Methanobacteriales → Methanobacteriaceae → Methanobrevibacter → unclassified Methanobrevibacter → Methanobrevibacter sp. | 1830 | Open in IMG/M |
| 3300033992|Ga0334992_0365648 | Not Available | 657 | Open in IMG/M |
| 3300033993|Ga0334994_0422281 | Not Available | 639 | Open in IMG/M |
| 3300033994|Ga0334996_0062373 | Not Available | 2274 | Open in IMG/M |
| 3300033994|Ga0334996_0072347 | Not Available | 2073 | Open in IMG/M |
| 3300033995|Ga0335003_0172036 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Methanomada group → Methanobacteria → Methanobacteriales → Methanobacteriaceae → Methanobrevibacter → unclassified Methanobrevibacter → Methanobrevibacter sp. | 1060 | Open in IMG/M |
| 3300034012|Ga0334986_0445659 | Not Available | 648 | Open in IMG/M |
| 3300034018|Ga0334985_0004747 | Not Available | 10993 | Open in IMG/M |
| 3300034019|Ga0334998_0698561 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 541 | Open in IMG/M |
| 3300034021|Ga0335004_0083311 | Not Available | 2172 | Open in IMG/M |
| 3300034022|Ga0335005_0274243 | Not Available | 1013 | Open in IMG/M |
| 3300034061|Ga0334987_0598008 | All Organisms → cellular organisms → Bacteria | 652 | Open in IMG/M |
| 3300034062|Ga0334995_0198922 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1395 | Open in IMG/M |
| 3300034062|Ga0334995_0472370 | Not Available | 763 | Open in IMG/M |
| 3300034066|Ga0335019_0002801 | Not Available | 11572 | Open in IMG/M |
| 3300034066|Ga0335019_0014836 | Not Available | 5361 | Open in IMG/M |
| 3300034066|Ga0335019_0162396 | All Organisms → Viruses → Predicted Viral | 1465 | Open in IMG/M |
| 3300034066|Ga0335019_0268646 | Not Available | 1080 | Open in IMG/M |
| 3300034082|Ga0335020_0000032 | Not Available | 111384 | Open in IMG/M |
| 3300034093|Ga0335012_0306478 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 804 | Open in IMG/M |
| 3300034102|Ga0335029_0448639 | Not Available | 764 | Open in IMG/M |
| 3300034102|Ga0335029_0531360 | Not Available | 675 | Open in IMG/M |
| 3300034111|Ga0335063_0013601 | Not Available | 5226 | Open in IMG/M |
| 3300034111|Ga0335063_0063794 | All Organisms → Viruses → Predicted Viral | 2297 | Open in IMG/M |
| 3300034118|Ga0335053_0187658 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1368 | Open in IMG/M |
| 3300034283|Ga0335007_0000360 | Not Available | 34438 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 20.65% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 13.04% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 9.78% |
| Deep Subsurface | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface | 7.07% |
| Estuarine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine | 6.52% |
| Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 4.89% |
| Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater And Sediment | 4.35% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 4.35% |
| Freshwater | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater | 3.80% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 3.80% |
| Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 3.26% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 3.26% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 2.72% |
| Deep Subsurface Sediment | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface Sediment | 2.72% |
| Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Lake | 2.17% |
| Pond Fresh Water | Environmental → Aquatic → Freshwater → Pond → Unclassified → Pond Fresh Water | 1.63% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater | 1.09% |
| Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Lake Sediment | 1.09% |
| Lake | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Lake | 0.54% |
| Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater And Sediment | 0.54% |
| Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 0.54% |
| Freshwater | Environmental → Aquatic → Freshwater → Creek → Unclassified → Freshwater | 0.54% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 0.54% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 0.54% |
| Estuary | Host-Associated → Plants → Leaf → Unclassified → Unclassified → Estuary | 0.54% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001282 | Freshwater microbial communities from Lake Mendota, WI - Practice 20APR2010 epilimnion | Environmental | Open in IMG/M |
| 3300002161 | Freshwater and sediment microbial communities from dead zone in Sandusky Bay, Ohio, USA | Environmental | Open in IMG/M |
| 3300002273 | Freshwater microbial communities from Lake Mendota, WI - 29JUN2012 deep hole epilimnion | Environmental | Open in IMG/M |
| 3300002298 | Freshwater microbial communities from Lake Mendota, WI - 08JUN2012 deep hole epilimnion | Environmental | Open in IMG/M |
| 3300002303 | Freshwater microbial communities from Lake Mendota, WI - 07OCT2009 deep hole epilimnion ns | Environmental | Open in IMG/M |
| 3300002408 | Freshwater microbial communities from Lake Mendota, WI, sample - 15JUL2010 deep hole epilimnion (Lake Mendota Combined assembly, ASSEMBLY_DATE=20140123) | Environmental | Open in IMG/M |
| 3300002470 | Freshwater microbial communities from San Paulo Zoo lake, Brazil - FEB 2013 | Environmental | Open in IMG/M |
| 3300002835 | Freshwater microbial communities from Lake Mendota, WI - (Lake Mendota Combined Ray assembly, ASSEMBLY_DATE=20140605) | Environmental | Open in IMG/M |
| 3300004054 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (v2) | Environmental | Open in IMG/M |
| 3300004096 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (version 2) | Environmental | Open in IMG/M |
| 3300004112 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 2) | Environmental | Open in IMG/M |
| 3300004124 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SD (version 2) | Environmental | Open in IMG/M |
| 3300005517 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (version 4) | Environmental | Open in IMG/M |
| 3300005527 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG | Environmental | Open in IMG/M |
| 3300005662 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 4) | Environmental | Open in IMG/M |
| 3300005805 | Microbial and algae communities from Cheney Reservoir in Wichita, Kansas, USA | Environmental | Open in IMG/M |
| 3300005941 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.697 | Environmental | Open in IMG/M |
| 3300006484 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.535 | Environmental | Open in IMG/M |
| 3300006639 | Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Utica-2 Time Series FC 2014_7_11 | Environmental | Open in IMG/M |
| 3300007545 | Estuarine microbial communities from the Columbia River estuary - metaG 1547B-3 | Environmental | Open in IMG/M |
| 3300007547 | Estuarine microbial communities from the Columbia River estuary - metaG 1547B-02 | Environmental | Open in IMG/M |
| 3300007606 | Estuarine microbial communities from the Columbia River estuary - metaG 1569-02 | Environmental | Open in IMG/M |
| 3300007632 | Estuarine microbial communities from the Columbia River estuary - metaG 1554A-3 | Environmental | Open in IMG/M |
| 3300008055 | Metatranscriptomes of the Eelgrass leaves and roots. Combined Assembly of Gp0128390, Gp0128391, Gp0128392, and Gp0128393 | Host-Associated | Open in IMG/M |
| 3300008107 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-3-NA | Environmental | Open in IMG/M |
| 3300008108 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0048-C-NA | Environmental | Open in IMG/M |
| 3300008110 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0048-3-NA | Environmental | Open in IMG/M |
| 3300008113 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0050-3-NA | Environmental | Open in IMG/M |
| 3300008261 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0024-C-NA | Environmental | Open in IMG/M |
| 3300009158 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG | Environmental | Open in IMG/M |
| 3300009159 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG | Environmental | Open in IMG/M |
| 3300009164 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130626_EF_MetaG | Environmental | Open in IMG/M |
| 3300009183 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG | Environmental | Open in IMG/M |
| 3300009194 | Subsurface microbial communities from deep shales in Ohio, USA - Utica-3 well 1 S input2 RT | Environmental | Open in IMG/M |
| 3300009419 | Subsurface microbial communities from deep shales in Ohio, USA - Utica-3 well 1 S input2 FT | Environmental | Open in IMG/M |
| 3300010354 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNA | Environmental | Open in IMG/M |
| 3300010388 | Freshwater microbial communities from the surface of the forest pond in Jussy, Geneva, Switzerland - JEBV, may 2015 | Environmental | Open in IMG/M |
| 3300010970 | Freshwater microbial communities from the surface of the forest pond in Jussy, Geneva, Switzerland - JEBV1, april 2016 | Environmental | Open in IMG/M |
| 3300012286 | Freshwater microbial communities from Ausable River, Ontario, Canada - S47 | Environmental | Open in IMG/M |
| 3300012346 | Freshwater microbial communities from Emily Creek, Ontario, Canada - S29 | Environmental | Open in IMG/M |
| 3300012352 | Freshwater microbial communities from Baxter Creek, Ontario, Canada - S37 | Environmental | Open in IMG/M |
| 3300012663 | Freshwater microbial communities from Indian River, Ontario, Canada - S50 | Environmental | Open in IMG/M |
| 3300012665 | Freshwater microbial communities from Talbot River, Ontario, Canada - S11 | Environmental | Open in IMG/M |
| 3300013004 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES118 metaG | Environmental | Open in IMG/M |
| 3300013005 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES117 metaG | Environmental | Open in IMG/M |
| 3300020048 | Microbial communities from Manganika and McQuade lakes, Minnesota, USA Combined Assembly of Gp0225457, Gp0225456, Gp0225455, Gp0225454, Gp0225453, Gp0224915 | Environmental | Open in IMG/M |
| 3300020151 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_202 megahit1 | Environmental | Open in IMG/M |
| 3300020159 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_108 megahit1 | Environmental | Open in IMG/M |
| 3300020161 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_101 megahit1 | Environmental | Open in IMG/M |
| 3300020480 | Freshwater microbial communities from Lake Mendota, WI - 16JUL2010 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020494 | Freshwater microbial communities from Lake Mendota, WI - 25SEP2008 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020498 | Freshwater microbial communities from Lake Mendota, WI - 13JUN2010 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020501 | Freshwater microbial communities from Lake Mendota, WI - 27SEP2009 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020506 | Freshwater microbial communities from Lake Mendota, WI - 26OCT2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020519 | Freshwater microbial communities from Lake Mendota, WI - 07OCT2009 deep hole epilimnion ns (SPAdes) | Environmental | Open in IMG/M |
| 3300020531 | Freshwater microbial communities from Lake Mendota, WI - 21SEP2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300021956 | Freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 29-17 MG | Environmental | Open in IMG/M |
| 3300021961 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_3D | Environmental | Open in IMG/M |
| 3300021962 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649D | Environmental | Open in IMG/M |
| 3300021963 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_657D | Environmental | Open in IMG/M |
| 3300022200 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG (v3) | Environmental | Open in IMG/M |
| 3300023174 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1505 | Environmental | Open in IMG/M |
| 3300024343 | Combined assembly of estuarine microbial communities from Columbia River, Washington, USA >3um size fraction | Environmental | Open in IMG/M |
| 3300024346 | Whole water sample coassembly | Environmental | Open in IMG/M |
| 3300024348 | 0.2um to 3um size fraction coassembly | Environmental | Open in IMG/M |
| 3300025091 | Freshwater bacterial and archeal communities from Indian Creek, Illinois, USA - Floc-Cal metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027114 | Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Utica-2 Time Series FC 2014_7_16 (SPAdes) | Environmental | Open in IMG/M |
| 3300027499 | Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Utica-2 Time Series FC 2014_7_11 (SPAdes) | Environmental | Open in IMG/M |
| 3300027710 | Subsurface microbial communities from deep shales in Ohio, USA - Utica-3 well 1 S input2 FT (SPAdes) | Environmental | Open in IMG/M |
| 3300027759 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027797 | Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB hypolimnion July 2011 (SPAdes) | Environmental | Open in IMG/M |
| 3300027805 | Freshwater and sediment microbial communities from dead zone in Sandusky Bay, Ohio, USA (SPAdes) | Environmental | Open in IMG/M |
| 3300027892 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (SPAdes) | Environmental | Open in IMG/M |
| 3300028025 | Subsurface sediment microbial communities from gas well in West Virginia, United States - MSEEL Well Study Marcellus 5H_FC | Environmental | Open in IMG/M |
| 3300028027 | Subsurface sediment microbial communities from gas well in West Virginia, United States - MSEEL Well Study Marcellus 3H_FC | Environmental | Open in IMG/M |
| 3300029349 | Freshwater microbial communities from Iron Gate Dam, Klamath Basin, California, USA - IR103 | Environmental | Open in IMG/M |
| 3300031784 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA112 | Environmental | Open in IMG/M |
| 3300031857 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125 | Environmental | Open in IMG/M |
| 3300031963 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA116 | Environmental | Open in IMG/M |
| 3300032092 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA121 | Environmental | Open in IMG/M |
| 3300033816 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME16Sep2004-rr0005 | Environmental | Open in IMG/M |
| 3300033978 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME28Sep2014-rr0002 | Environmental | Open in IMG/M |
| 3300033980 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME09Aug2015-rr0007 | Environmental | Open in IMG/M |
| 3300033992 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME16Jun2014-rr0035 | Environmental | Open in IMG/M |
| 3300033993 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Jul2012-rr0037 | Environmental | Open in IMG/M |
| 3300033994 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME25Jul2006D11-rr0046 | Environmental | Open in IMG/M |
| 3300033995 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME23May2014-rr0056 | Environmental | Open in IMG/M |
| 3300034012 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Aug2017-rr0027 | Environmental | Open in IMG/M |
| 3300034018 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME04Jul2014-rr0021 | Environmental | Open in IMG/M |
| 3300034019 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME24Sep2014-rr0049 | Environmental | Open in IMG/M |
| 3300034021 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME01Oct2014-rr0057 | Environmental | Open in IMG/M |
| 3300034022 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Apr2018-rr0058 | Environmental | Open in IMG/M |
| 3300034061 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Sep2004-rr0028 | Environmental | Open in IMG/M |
| 3300034062 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Jul2012-rr0045 | Environmental | Open in IMG/M |
| 3300034066 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME11Jul2017-rr0087 | Environmental | Open in IMG/M |
| 3300034082 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME05Jun2015-rr0088 | Environmental | Open in IMG/M |
| 3300034093 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME08Jun2014-rr0072 | Environmental | Open in IMG/M |
| 3300034102 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Jul2002-rr0112 | Environmental | Open in IMG/M |
| 3300034111 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME03Oct2011-rr0186 | Environmental | Open in IMG/M |
| 3300034118 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME05Aug2017-rr0165 | Environmental | Open in IMG/M |
| 3300034283 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Aug2003-rr0061 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| B570J14230_100267342 | 3300001282 | Freshwater | MSAVVDTEQTFDQEFTVEELTKIIVDQAKADIKAKFGNKKRHRQ* |
| JGI24766J26685_100314232 | 3300002161 | Freshwater And Sediment | MNEAEFDQEFSVEEITKAIVDQAKAEVKSRFGNKKRHRQ* |
| B570J29588_1076571 | 3300002273 | Freshwater | VDTEQTFDQEFSVEEITNAIVNQAKAEVKSKFGNKKRHRQ* |
| B570J29599_10039852 | 3300002298 | Freshwater | VDTEETFDQEFTVEDITNAIVEQAKAEVKARYGNKKRHRQ* |
| B570J29644_10000022 | 3300002303 | Freshwater | VDTEQTFDQEFTVEELTKIIVDQAKADIKAKFGNKKRHRQ* |
| B570J29032_1094174352 | 3300002408 | Freshwater | MDTEEEFNLEDITNAIVNQAKADVKSRYGNKKRHRQ* |
| B570J29032_1098432272 | 3300002408 | Freshwater | MSALVDTEQTFDQEFTVEDITKAIVNQARADVKSKFGNKKRHRQ* |
| metazooDRAFT_13639353 | 3300002470 | Lake | VNEAQFDEEFNLEDITNAIVNQAKAEVKSKFGNKKRHRQ* |
| B570J40625_1000609075 | 3300002835 | Freshwater | VDTEQAFDQEFSVEEITNAIVNQAEAEVKSKFGNKKRHRQ* |
| B570J40625_1000731302 | 3300002835 | Freshwater | MDTEQNFDQEFSVEDITNAIVNQAKAEVKSRFGNKKRHRQ* |
| B570J40625_10007801613 | 3300002835 | Freshwater | VDTEQTFDQEFTVEEITKAIVDQAKADIKAKFGNRKRHRQ* |
| B570J40625_1002114783 | 3300002835 | Freshwater | MDTEESFDQEFSIEDITKAIVDQAKAEIKSKYGNKKRHRQ* |
| B570J40625_1013331681 | 3300002835 | Freshwater | MDTEQTFDQEFTVEEITKAIVDQAKSDVKAKYGNKKRHRQ* |
| Ga0063232_101790863 | 3300004054 | Freshwater Lake | VNEAEFDQEFNLEDITNAIVNQAKSEVKSKFGNKKRHRQ* |
| Ga0066177_102237492 | 3300004096 | Freshwater Lake | MNEAEFDQEFNVEDITNAIVNQAKADVKSKFGNKKRHRQ* |
| Ga0065166_100032687 | 3300004112 | Freshwater Lake | MNEQQFDEEFNVDLLTQSIVEKAKAEVKSRYGNKKRHRQ* |
| Ga0065166_101140162 | 3300004112 | Freshwater Lake | VDTEQTFDQEFSVEEITKAIVDQAKAEVKSRFGNKKRHRQ* |
| Ga0065166_102344932 | 3300004112 | Freshwater Lake | MNEQQFDDEFNVDLITKLIVDKAKAEVKSIYGNKKRHRQ* |
| Ga0065166_104063382 | 3300004112 | Freshwater Lake | MNEAQFDEEFNVEDITNAIVNQAKAEVKSKFGNKKRHRQ* |
| Ga0065166_104658842 | 3300004112 | Freshwater Lake | MNEAEFDQEFNLEDITNAIVNQAKAEVKSKFGNKKRHRQ* |
| Ga0066178_100504672 | 3300004124 | Freshwater Lake | MNEQQFDDEFNVEVLTQSIVDKAKAEVKARYGNKKRHRQ* |
| Ga0066178_100814072 | 3300004124 | Freshwater Lake | MDTEQTFDQEFKVEEAVRVIVEKAKADVKARYGNKKRHRQ* |
| Ga0070374_100602118 | 3300005517 | Freshwater Lake | MNEAEFDQEFNLEDITNAIVNQAKAEVKSKFGNKKR |
| Ga0070374_102443442 | 3300005517 | Freshwater Lake | MNEQQFDDEFNVDVLTQSIVDKAKAEVKARYGNKKRHRQ* |
| Ga0068876_101361841 | 3300005527 | Freshwater Lake | QEMSAVVDTEQTFDQEFTVEELTKIIVDQAKADIKAKFGNKKRHRQ* |
| Ga0078894_100833131 | 3300005662 | Freshwater Lake | MDTEQTFDQEFSVEDITNAIVNQAKAEVKSKFGNKKRHRQ* |
| Ga0078894_104034314 | 3300005662 | Freshwater Lake | MDTEQTFDQEFSVEEITKAIVDQAKADIKARFGNKKRHRQ* |
| Ga0078894_104161055 | 3300005662 | Freshwater Lake | MDTEEEFNLEDITNAIVNQAKADVKSKFGNKKRHRQ* |
| Ga0078894_105018823 | 3300005662 | Freshwater Lake | MNEAEFDQEFSVEEITKIIVDNAKAEVKAKFGNKKRHRQ* |
| Ga0078894_105259243 | 3300005662 | Freshwater Lake | MDTEETFDQEFSVEDITNAIVNQAKAEVRSKFGNKKRHRQ* |
| Ga0078894_108320584 | 3300005662 | Freshwater Lake | VDTEQASDQEFSVEEITNAIVNQAKADVKSKFGNKKRHRQ* |
| Ga0078894_112696061 | 3300005662 | Freshwater Lake | MNEQQFDDEFNVEVIAQSIVDKAKAEVKARYGNKKRHRQ* |
| Ga0078894_116387242 | 3300005662 | Freshwater Lake | MNEAQFDEEFNLEDITNAIVNQAKAKVKSKFGNKKRHRQ* |
| Ga0078894_117555991 | 3300005662 | Freshwater Lake | MNEAEFDQEFSVEEITKIIVDNAKAQVKAKYGNKRRHRQ* |
| Ga0079957_100721018 | 3300005805 | Lake | VDTEKQFDQEFSIEDITNAIVNQAKADIKAKFGNKKRHRQ* |
| Ga0079957_101082811 | 3300005805 | Lake | MNEAEFDQEFTVEEITKAIVDQAKAEVKSRFGNKKRHRQ* |
| Ga0079957_10621345 | 3300005805 | Lake | MNEAQFDEEFSVEDITNAIVNQAKADVKAKFGNKKRHRQ* |
| Ga0079957_11167892 | 3300005805 | Lake | MNEAEFDQEFTVEEITKAIVDKAKADIRAKFGNKKRHRQ* |
| Ga0070743_100045402 | 3300005941 | Estuarine | MDTEKTFDQEFSVEDITNAIVNQAKAEVKSKFGNKKRHRQ* |
| Ga0070743_101186793 | 3300005941 | Estuarine | MDTEQTFDQEFSVEDIANAIVEQAKSDIKSRYGNKKRHRQY* |
| Ga0070744_1000228014 | 3300006484 | Estuarine | VNEAEFDQEFNLEDITNAIVNQAKAEVKSKFGNKKRHRQ* |
| Ga0070744_100097568 | 3300006484 | Estuarine | MNEAQFDEEFNVEEIANAIVNQAKADVKSRFGNKKRHRQ* |
| Ga0070744_100147016 | 3300006484 | Estuarine | VDTEQTFDKEFNVEEIAQAILEKAKAEVKGRYGNKKRHRQ* |
| Ga0079301_10316624 | 3300006639 | Deep Subsurface | VNEAEFDQEFNLEDITNAIVNQAKADVKSKFGNKKRHRQ* |
| Ga0102873_10293067 | 3300007545 | Estuarine | MNEAEFDQEFSVEDITKAIVDQAKAEVKSRFGNKKRHRQ* |
| Ga0102875_10329134 | 3300007547 | Estuarine | MSAWVDTEQTFDQEFSVEEITKAIVDQAKAEVKSRFGNKKRHRQ* |
| Ga0102923_11304692 | 3300007606 | Estuarine | MDTEQQFDAEFSVEDITKAIVDQAKAEVKSRFGNKKRHRQ* |
| Ga0102894_11449033 | 3300007632 | Estuarine | MDTEQTFDQEFSVEEITKAIVDQAKADIKSRFGNKKRHRQY* |
| Ga0108970_112420591 | 3300008055 | Estuary | MNEAEFDQEFNLEDITNAIVNQAKAEVKSKFGNRKRHRQ* |
| Ga0114340_10032525 | 3300008107 | Freshwater, Plankton | MDTEQTFDQEFSVEEITKAIVDQAKADVKSRYGNKKRHRQ* |
| Ga0114340_10935664 | 3300008107 | Freshwater, Plankton | MNEAQFDEEFNLEDITNAIVNQAKAEVKSKFGNKKRHRQ* |
| Ga0114340_10967584 | 3300008107 | Freshwater, Plankton | MDTEQTFDQEFSVEEITNAIVNQAKAEVKSRYGNKKRHRQ* |
| Ga0114341_104216032 | 3300008108 | Freshwater, Plankton | MDTEQTFDQEFSVEEITNAILNQAKAEVKSKFGNKKRHRQ* |
| Ga0114343_10213314 | 3300008110 | Freshwater, Plankton | MDTEQTFDQEFTVEDITNAIVNQAKADVKAKFGNKKRHRQ* |
| Ga0114343_11299672 | 3300008110 | Freshwater, Plankton | MDTEQTFDEEFSVEDITNAIVSQAKSEVKAKYGNKKRHRQ* |
| Ga0114346_11386283 | 3300008113 | Freshwater, Plankton | MDTEQTFDEEFSVEDITNAIVNQAKSEVKAKYGNKKRHRQ* |
| Ga0114346_12164791 | 3300008113 | Freshwater, Plankton | MDTEKTFDEEFSVEDITNAIVSQAKSEVKAKYGNKKRHRQ* |
| Ga0114336_10368295 | 3300008261 | Freshwater, Plankton | VDTEQTFDQEFSVEEITKAIVEQAKAQVKSRYGNRKRHRQ* |
| Ga0114977_101862061 | 3300009158 | Freshwater Lake | MDTEQTFDQEFTVEEITKAIVDQAKSDIKAKYGNKKRHRQ* |
| Ga0114978_106214493 | 3300009159 | Freshwater Lake | MDTEETFDQEFTVKEITKAIVDQAKSDVKAKYGNKKRHRQ* |
| Ga0114975_107819502 | 3300009164 | Freshwater Lake | MDTEETFDQKFTVEEITKAIVDQARSDVKAKYGNRKRHRQ* |
| Ga0114974_1000265041 | 3300009183 | Freshwater Lake | MDTEKSFDKEFDVEETTKVIVDKAKAEVRSRYGNKKRHRQ* |
| Ga0114974_103315891 | 3300009183 | Freshwater Lake | MDTEQTFDQEFTVEEITKAIVDQAKSDVKAKYGNRKRHRQ* |
| Ga0114983_10230974 | 3300009194 | Deep Subsurface | MDTEQTFDQEFDVKETTKAIVDKAKAEVKAKYGNKKRHRQ* |
| Ga0114983_10730691 | 3300009194 | Deep Subsurface | MDTEQTFDQEFSVEEITKAIVDRAKSEVKSKFGNKKRHRQ* |
| Ga0114982_10181323 | 3300009419 | Deep Subsurface | MNEQQFDEEFNVDVLTQSIVEKAKAEVKSRYGNKKRHRQ* |
| Ga0129333_1007178411 | 3300010354 | Freshwater To Marine Saline Gradient | MNEAEFDQEFNLEDITNAIVNQAKSEVKSKFGNKKRHRQ* |
| Ga0136551_10487251 | 3300010388 | Pond Fresh Water | VNSVEFDKEFDLEYILKLSQEITDKAKAEVKAKYGNKKRHRQ* |
| Ga0136551_10916101 | 3300010388 | Pond Fresh Water | VNEKQFDDEFNLEQLTKAIVDKAKADIKAKYGKKKRHRQ* |
| Ga0137575_100096031 | 3300010970 | Pond Fresh Water | MNEAQFDEEFNVEDITNAIVNQAKAEVKSKFGNKKR |
| Ga0157137_1000273 | 3300012286 | Freshwater | MNEKQFDEEFDLEETTKRIVDRAKAEVKNRYGNKKRHRQ* |
| Ga0157137_1022312 | 3300012286 | Freshwater | MNEQQFDEEFDLEETTKLIVAKAKAEVKSIYGNKKRHRQ* |
| Ga0157141_100048612 | 3300012346 | Freshwater | VNEQEFDEEFDLESTTKAIVDKAKAEVKSRYGNKKRHRQ* |
| Ga0157138_100001830 | 3300012352 | Freshwater | VKESEFDEEFDLEATTKAIVEKAKAEVKSKYGNKKRHRQ* |
| Ga0157138_10231001 | 3300012352 | Freshwater | MSASMDTEQQFDQEFSVEEITNAIVNQAKADIKAKFGNKKRHRQ* |
| Ga0157203_10297651 | 3300012663 | Freshwater | MNEAEFDKEFNLEEITRTIIDKAKAEVKSKYGNKKRHRQ* |
| Ga0157210_10104711 | 3300012665 | Freshwater | MDTEQTFDQKFSVEEITKAIVDKAKAEVKTKFGNKKRHRQ* |
| Ga0164293_100766683 | 3300013004 | Freshwater | MDNEKEFNVEDITNAIVNQAKAEVKAKFGNKKRHRQ* |
| Ga0164293_104993303 | 3300013004 | Freshwater | MNEAEFDQEFTVEEITKAIVDQAKSDIKAKFGNKKRHRQ* |
| Ga0164292_105641742 | 3300013005 | Freshwater | MDTEEEFNLEDITNAIVNQAKAEVKSKFGNKKRHKQ* |
| Ga0207193_101299313 | 3300020048 | Freshwater Lake Sediment | MDTEEEFNLEDITNAIVNQAKAEVKSKYGNKKRHRQ |
| Ga0207193_10130676 | 3300020048 | Freshwater Lake Sediment | MDTEKTFDQEFSIEDITNAIVNQAKAEVKASFGNKKRHRQY |
| Ga0211736_100196748 | 3300020151 | Freshwater | MNEEDFDKEFNLEEITNAIVNQAKADVKSKFGNKKRHRQ |
| Ga0211736_1092582475 | 3300020151 | Freshwater | MDTEKQFDQEFDLEEITKAIVDQAKSDVKSRFGNKKRHRQ |
| Ga0211734_106278248 | 3300020159 | Freshwater | MDTEQTFDQEFTVEDITNAIVNQAKADVKAKFGNKKRHRQ |
| Ga0211726_1050011744 | 3300020161 | Freshwater | MDTEKQFDQEFNIEDITNAIVNQAKAEVKSKFGNKKRHRQ |
| Ga0208201_1087522 | 3300020480 | Freshwater | MDTEQTFDQEFNLEDITNAIVNQAKAEVKARFGNKKRHRQ |
| Ga0208326_1003399 | 3300020494 | Freshwater | MSAVVDTEQTFDQEFTVEELTKIIVDQAKADIKAKFGNKKRHRQ |
| Ga0208050_10059894 | 3300020498 | Freshwater | MDTEEEFNLEDITNAIVNQAKAEVKSKFGNKKRHRQ |
| Ga0208590_10191261 | 3300020501 | Freshwater | EQTFDQEFTVEELTKIIVDQAKADIKAKFGNKKRHRQ |
| Ga0208091_10077632 | 3300020506 | Freshwater | VDTEETFDQEFTVEDITNAIVEQAKAEVKARYGNKKRHRQ |
| Ga0208091_10294582 | 3300020506 | Freshwater | MDTEEEFNLEDITNAIVNQAKADVKSRYGNKKRHRQ |
| Ga0208223_10010364 | 3300020519 | Freshwater | VDTEQTFDQEFTVEEITKAIVDQAKADIKAKFGNRKRHRQ |
| Ga0208487_100141016 | 3300020531 | Freshwater | VDTEQTFDQEFSVEEITNAIVNQAKAEVKSKFGNKKRHRQ |
| Ga0208487_10257532 | 3300020531 | Freshwater | VDTEQAFDQEFSVEEITNAIVNQAEAEVKSKFGNKKRHRQ |
| Ga0213922_10123072 | 3300021956 | Freshwater | MNEAEFDQEFSVEEITKAIVEQAKAEVKSRFGNKKRHRQ |
| Ga0222714_100901906 | 3300021961 | Estuarine Water | VVDTEQTFDQEFTVEELTKIIVDQAKADIKAKFGNKKRHRQ |
| Ga0222713_100042288 | 3300021962 | Estuarine Water | MNEAQFDEEFNVEDITNAIVNQAKAEVKSKFGNKKRHRQ |
| Ga0222713_100145596 | 3300021962 | Estuarine Water | MSAWVDTEQTFDQEFTVEELTKIIVDQAKADIKAKFGNKKIHRQ |
| Ga0222713_104311494 | 3300021962 | Estuarine Water | VDTEQTFDQEFTVEELTKIIVDQAKAEVKSKFGNKKRHRQ |
| Ga0222712_101593202 | 3300021963 | Estuarine Water | MNEAEFDQEFNLEDITNAIVNKAKDEVKSKFGNKKRHRQ |
| Ga0222712_107915133 | 3300021963 | Estuarine Water | MNEKQFDEEFDLEETTKRIVDKAKAEVKSRYGNKKRHRQ |
| Ga0196901_10303512 | 3300022200 | Aqueous | MDTEQTFDQEFSVEDITNAIVNQAKAEVKSKFGNKKRHRQ |
| Ga0214921_10000295105 | 3300023174 | Freshwater | MNEAEFDQEFDVEDITNAIVNQAKADVKSKFGNKKRHRQ |
| Ga0214921_100018774 | 3300023174 | Freshwater | MNEAEFDKEFDLEEITRTIIDKAKAEVKSKYGNKKRHRQ |
| Ga0214921_1000665218 | 3300023174 | Freshwater | MDTEQTFDQEFTVEEITKAIVNQAKSDIKAKYGNKKRHRQ |
| Ga0214921_1003470511 | 3300023174 | Freshwater | MNEAEFDEEFNLVATTKAIVDKAKSEVKSRYGNKKRHRQ |
| Ga0214921_100778564 | 3300023174 | Freshwater | MNEAEFDKEFNLEEITKIIVDKAKVEVKSKYGNKKRHRQ |
| Ga0244777_101868524 | 3300024343 | Estuarine | MSAWVDTEQTFDQEFSVEEITKAIVDQAKAEVKSRFGNKKRHRQ |
| Ga0244775_1001280012 | 3300024346 | Estuarine | MNEAEFDQEFNLEDITNAIVNQAKAEVKSKFGNKKRHRQ |
| Ga0244775_100243386 | 3300024346 | Estuarine | MDTEKTFDQEFSVEDITNAIVNQAKAEVKSKFGNKKRHRQ |
| Ga0244775_100969122 | 3300024346 | Estuarine | MNEAQFDEEFNVEEIANAIVNQAKADVKSRFGNKKRHRQ |
| Ga0244775_101400855 | 3300024346 | Estuarine | VDTEQTFDKEFNVEEIAQAILEKAKAEVKGRYGNKKRHRQ |
| Ga0244775_101920706 | 3300024346 | Estuarine | MDTEQTFDQEFSVEDIANAIVEQAKSDIKSRYGNKKRHRQY |
| Ga0244775_102892524 | 3300024346 | Estuarine | MNEAEFDQEFNLEDITNAIVNQAKADVKTKFGNKKRHRQ |
| Ga0244775_108092121 | 3300024346 | Estuarine | MNEAQFDEEFSVEDITNAIVNQAKAEVKSKFGNKKR |
| Ga0244776_1000032685 | 3300024348 | Estuarine | MNEAEFDQEFSVEDITKAIVDQAKAEVKSRFGNKKRHRQ |
| Ga0244776_102138432 | 3300024348 | Estuarine | MDTEQTFDQEFSVEEITKAIVDQAKADIKSRFGNKKRHRQY |
| Ga0209616_10158694 | 3300025091 | Freshwater | MDTEQTFDQEFTVEEITKAIVDKAKSEVKSKYGNKKRHRQ |
| Ga0208009_100752112 | 3300027114 | Deep Subsurface | VNEAEFDQEFNLEDITNAIVNQAKADVKSKFGNKKRHR |
| Ga0208788_10254663 | 3300027499 | Deep Subsurface | VNEAEFDQEFNLEDITNAIVNQAKADVKSKFGNKKRHRQ |
| Ga0208788_11511941 | 3300027499 | Deep Subsurface | DKGTKVNEAEFDQEFNLEDITNAIVNQAKAEVKSKFGNKKRHRQ |
| Ga0209599_10000020164 | 3300027710 | Deep Subsurface | MDTEQTFDQEFSVEEITKAIVDRAKSEVKSKFGNKKRHRQ |
| Ga0209599_10000044123 | 3300027710 | Deep Subsurface | MDTEQTFDQEFDVKETTKAIVDKAKAEVKAKYGNKKRHRQ |
| Ga0209599_100002008 | 3300027710 | Deep Subsurface | MDTEQTFDQEFSVEEITKAIVDQAKADVKSRYGNKKRHRQ |
| Ga0209599_1000175520 | 3300027710 | Deep Subsurface | MDTEQTFDQEFSVEEITNAILNQAKAEVKSKFGNKKRHRQ |
| Ga0209599_100036824 | 3300027710 | Deep Subsurface | MDTEQTFDEEFSVEDITNAIVNQAKSEVKAKYGNKKRHRQ |
| Ga0209599_100165444 | 3300027710 | Deep Subsurface | MNEQQFDEEFNVDVLTQSIVEKAKAEVKSRYGNKKRHRQ |
| Ga0209296_100232940 | 3300027759 | Freshwater Lake | MDTEKSFDKEFDVEETTKVIVDKAKAEVRSRYGNKKRHRQ |
| Ga0209296_10140497 | 3300027759 | Freshwater Lake | MDTEETFDQKFTVEEITKAIVDQARSDVKAKYGNRKRHRQ |
| Ga0209296_11163784 | 3300027759 | Freshwater Lake | MDTEQTFDQEFTVEEITKAIVDQAKSDIKAKYGNKKRHRQ |
| Ga0209107_100819305 | 3300027797 | Freshwater And Sediment | MDNEQEFNVEDITNAIVNQAKAEVKAKFGNKKRHRQ |
| Ga0209229_100136566 | 3300027805 | Freshwater And Sediment | MNEAQFDEEFSVEDITNAIVNQAKADVKAKFGNKKRHRQ |
| Ga0209229_100600704 | 3300027805 | Freshwater And Sediment | MNEAEFDQEFSVEEITKAIVDQAKAEVKSRFGNKKRHRQ |
| Ga0209229_101415191 | 3300027805 | Freshwater And Sediment | VDTEQTFDQEFSVEEITNAIVNQAKSEVKTKFGNKKRHRQY |
| Ga0209229_101864033 | 3300027805 | Freshwater And Sediment | MNEAQFDEEFNVEDITNAIVNQAKADIKAKFGNKKRHRQ |
| Ga0209229_102187651 | 3300027805 | Freshwater And Sediment | MTNSEQTFDQEFSVEDITNAIVDQAKAEVKARYGNKKRHRQ |
| Ga0209229_103802401 | 3300027805 | Freshwater And Sediment | MNEAQFDEEFNLEDITNAIVNQAKAEVKSKFGNKKRHRQ |
| Ga0209229_104108382 | 3300027805 | Freshwater And Sediment | MNEAEFDKEFDLDAKTKEIVDKAKAEVKARYGNKKRHRQ |
| Ga0209550_101158405 | 3300027892 | Freshwater Lake | MNEQQFDDEFNVDVLTQSIVDKAKAEVKARYGNKKRHRQ |
| Ga0209550_103829764 | 3300027892 | Freshwater Lake | MDTEQTFDQEFKVEEITKAIVDQAKAEVKARYGNKKRHRQXENAL |
| Ga0209550_105852223 | 3300027892 | Freshwater Lake | MNEAEFDQEFNVEDITNAIVNQAKADVKSKFGNKKRHRQ |
| Ga0247723_100005579 | 3300028025 | Deep Subsurface Sediment | VDTEQTFDQEFTVEDITKAIVEQAKAEVKSRYGNKKRHRQ |
| Ga0247723_10238744 | 3300028025 | Deep Subsurface Sediment | MDTEQTFDQEFSVEEITNAIVDQAKADVKSKYGNKKRHRQ |
| Ga0247723_10523024 | 3300028025 | Deep Subsurface Sediment | MNEAEFDEEFSVEDITNAIVNQANAEVKSKFGNKKRHRQ |
| Ga0247723_10740631 | 3300028025 | Deep Subsurface Sediment | MDTEQTFDEEFSVEDITNAIVNQAKSQVKAKYGNKKRHRQXILSEI |
| Ga0247722_101314222 | 3300028027 | Deep Subsurface Sediment | MNEQQFDKEFNVEILTQSIVEKAKAEVKSRYGNKKRHRQ |
| Ga0238435_1138082 | 3300029349 | Freshwater | MDTEQTFDQEFSVEEITKAIVDNAKAEVKSRYGNKKRHRQ |
| Ga0315899_111329363 | 3300031784 | Freshwater | TEQTFDKEFNVEEIAQAILEKAKAEVKGRYGNKKRHRQ |
| Ga0315909_105561464 | 3300031857 | Freshwater | MDTEQTFDQEFSVEEITNAIVNQAKAEVKSRYGNKK |
| Ga0315909_109509692 | 3300031857 | Freshwater | MDTEQTFDEEFSVEDITNAIVNQAKSQVKAKYGNKKRHRQXILLEI |
| Ga0315901_112183911 | 3300031963 | Freshwater | MDTEQTFDEEFSVEDITNAIVSQAKSEVKAKYGNKKRHRQXILSET |
| Ga0315905_100078887 | 3300032092 | Freshwater | MDSEQEFDNEFSIDDITKAIVDQAKSEVKSRYGNKKRHRQ |
| Ga0315905_104440064 | 3300032092 | Freshwater | MNEAEFDQEFNLEDITNAIVNQAKADIKAKFGNKKRHRQ |
| Ga0334980_0000095_22754_22876 | 3300033816 | Freshwater | MDTEQNFDQEFSVEDITNAIVNQAKAEVKSRFGNKKRHRQ |
| Ga0334977_0002020_411_530 | 3300033978 | Freshwater | MNEAEFDQEFSVEEITNAIVNQAKAEVKSKFGNKKRHRQ |
| Ga0334977_0272484_266_385 | 3300033978 | Freshwater | MNEAEFDQEFTVEEITKAIVDKAKADIKAKFGNKKRHRQ |
| Ga0334981_0245573_451_561 | 3300033980 | Freshwater | MDTEEEFNLEDITNAIVNQAKADVKSKFGNKKRHRQ |
| Ga0334992_0076639_1714_1830 | 3300033992 | Freshwater | TEQTFDQEFTVEDITKAIVNQARADVKSKFGNKKRHRQ |
| Ga0334992_0365648_390_512 | 3300033992 | Freshwater | MDTEQTFDQEFTVEEITKAIVDQAKSDVKAKYGNKKRHRQ |
| Ga0334994_0422281_286_396 | 3300033993 | Freshwater | MDNEKEFNVEDITNAIVNQAKAEVKAKFGNKKRHRQ |
| Ga0334996_0062373_515_649 | 3300033994 | Freshwater | MNAQMDTEQAFDQEFNLEDITKAIVDQAKAEVKSKYGNKKRHRQ |
| Ga0334996_0072347_1096_1209 | 3300033994 | Freshwater | MDTEEEFNVEDITNAIVNQAKAEVKSKLGNKKRHRQW |
| Ga0335003_0172036_1_129 | 3300033995 | Freshwater | ALVDTEQTFDQEFNVEDITKAIVNQARADVKSKFGNKKRHRQ |
| Ga0334986_0445659_51_170 | 3300034012 | Freshwater | MNEAEFDQEFTVEEITKAIVDQAKSDIKAKFGNKKRHRQ |
| Ga0334985_0004747_5708_5842 | 3300034018 | Freshwater | MSALVDTEQTFDQEFTVEDITKAIVNQARADVKSKFGNKKRHRQ |
| Ga0334998_0698561_423_539 | 3300034019 | Freshwater | TEQTFDQEFTVEELTKIIVDQAKADIKAKFGNKKRHRQ |
| Ga0335004_0083311_1283_1417 | 3300034021 | Freshwater | MSAVVDTEQAFDQEFTVEELTKIIVDQAKAEVKSKFGNKKRHRQ |
| Ga0335005_0274243_489_608 | 3300034022 | Freshwater | MNEAEFDQEFSVEEITKAIVNQAKAEVKSKFGNKKRHRQ |
| Ga0334987_0598008_19_138 | 3300034061 | Freshwater | MNEAEFDQEFTVEDITKTIVDNAKAEVKSKFGNRKRHRQ |
| Ga0334995_0198922_597_716 | 3300034062 | Freshwater | MNEQQFDEEFNVEILTQSIVEKAKAEVKSRYGNKKRHRQ |
| Ga0334995_0472370_213_326 | 3300034062 | Freshwater | MDTEKDFNLEDITNAIVNQAKAEVKSKFGNKKRHRQW |
| Ga0335019_0002801_10777_10899 | 3300034066 | Freshwater | VDTEQTFDQEFSVEEITKAIVNQAKAEVKSKFGNKKRHRQ |
| Ga0335019_0014836_798_920 | 3300034066 | Freshwater | MDTEQTFDQEFTVEEITKAIVDQARSDVKAKYGNKKRHRQ |
| Ga0335019_0162396_1325_1447 | 3300034066 | Freshwater | VDTEKTFDQEFSVEEITNAIVNQAKAEVKSKFGNKKRHRQ |
| Ga0335019_0268646_206_328 | 3300034066 | Freshwater | VDTEQAFDQEFSVEDITNAIVNQAKAEVKSKFGNKKRHRQ |
| Ga0335020_0000032_23958_24077 | 3300034082 | Freshwater | MNESEFDQEFSVEDITNAIVNQAKAEVKSKFGNKKRHRQ |
| Ga0335012_0306478_281_400 | 3300034093 | Freshwater | MKEAEFDQEFTVEEITKAIVDQAKADIKAKFGNKKRHRQ |
| Ga0335029_0448639_505_627 | 3300034102 | Freshwater | MDTEQTFDQEFSVEDITNAIVDKAKAEVKARYGNKKRHRQ |
| Ga0335029_0531360_421_543 | 3300034102 | Freshwater | VDTEQTFDEEFSVEDITNAIVNQAKAEVKARFGNKKRHRQ |
| Ga0335063_0013601_961_1083 | 3300034111 | Freshwater | MDTEQTFDQEFNVTETTKAIVDKAKAEVKAKYGNKKRHRQ |
| Ga0335063_0063794_82_204 | 3300034111 | Freshwater | MDTEQTFDQEFTIEEITKAIVDQAKSDVKAKYGNKKRHRQ |
| Ga0335053_0187658_1057_1167 | 3300034118 | Freshwater | MDTEEKFNLEDITNAIVNQAKAEVKSKFGNKKRHRQ |
| Ga0335007_0000360_9597_9707 | 3300034283 | Freshwater | MDTEEDFNLEDITNAIVNQAKAEVKSKFGNKKRHRQ |
| ⦗Top⦘ |