| Basic Information | |
|---|---|
| Family ID | F030732 |
| Family Type | Metagenome |
| Number of Sequences | 184 |
| Average Sequence Length | 42 residues |
| Representative Sequence | MFKVTVMWDEETRAVGWYDLAQECIECGTITTAPTEIDGDDCA |
| Number of Associated Samples | 137 |
| Number of Associated Scaffolds | 184 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Viruses |
| % of genes with valid RBS motifs | 22.28 % |
| % of genes near scaffold ends (potentially truncated) | 45.11 % |
| % of genes from short scaffolds (< 2000 bps) | 74.46 % |
| Associated GOLD sequencing projects | 120 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.45 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Duplodnaviria (50.543 % of family members) |
| NCBI Taxonomy ID | 2731341 |
| Taxonomy | All Organisms → Viruses → Duplodnaviria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake (22.283 % of family members) |
| Environment Ontology (ENVO) | Unclassified (67.935 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (69.565 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 8.45% β-sheet: 22.54% Coil/Unstructured: 69.01% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.45 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 184 Family Scaffolds |
|---|---|---|
| PF02467 | Whib | 34.24 |
| PF05257 | CHAP | 3.80 |
| PF07659 | DUF1599 | 3.26 |
| PF09723 | Zn-ribbon_8 | 3.26 |
| PF13481 | AAA_25 | 2.72 |
| PF13155 | Toprim_2 | 1.63 |
| PF13578 | Methyltransf_24 | 1.63 |
| PF02945 | Endonuclease_7 | 1.09 |
| PF12705 | PDDEXK_1 | 1.09 |
| PF13539 | Peptidase_M15_4 | 1.09 |
| PF01807 | zf-CHC2 | 1.09 |
| PF00589 | Phage_integrase | 0.54 |
| PF13362 | Toprim_3 | 0.54 |
| PF06941 | NT5C | 0.54 |
| PF13641 | Glyco_tranf_2_3 | 0.54 |
| PF04545 | Sigma70_r4 | 0.54 |
| PF13252 | DUF4043 | 0.54 |
| PF08281 | Sigma70_r4_2 | 0.54 |
| COG ID | Name | Functional Category | % Frequency in 184 Family Scaffolds |
|---|---|---|---|
| COG0358 | DNA primase (bacterial type) | Replication, recombination and repair [L] | 1.09 |
| COG4502 | 5'(3')-deoxyribonucleotidase | Nucleotide transport and metabolism [F] | 0.54 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 79.89 % |
| Unclassified | root | N/A | 20.11 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2035265000|ErSWdraf_F5BXKTZ02FQK68 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 540 | Open in IMG/M |
| 3300002091|JGI24028J26656_1018112 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 729 | Open in IMG/M |
| 3300002092|JGI24218J26658_1031108 | Not Available | 653 | Open in IMG/M |
| 3300003277|JGI25908J49247_10009127 | All Organisms → Viruses → Predicted Viral | 3115 | Open in IMG/M |
| 3300003394|JGI25907J50239_1022468 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1392 | Open in IMG/M |
| 3300003394|JGI25907J50239_1107434 | Not Available | 543 | Open in IMG/M |
| 3300003412|JGI25912J50252_10139184 | Not Available | 562 | Open in IMG/M |
| 3300003493|JGI25923J51411_1039186 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 884 | Open in IMG/M |
| 3300003986|Ga0063233_10158633 | Not Available | 688 | Open in IMG/M |
| 3300004096|Ga0066177_10186635 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 844 | Open in IMG/M |
| 3300005517|Ga0070374_10102454 | All Organisms → Viruses → Predicted Viral | 1492 | Open in IMG/M |
| 3300005517|Ga0070374_10201429 | All Organisms → Viruses → Predicted Viral | 1024 | Open in IMG/M |
| 3300005525|Ga0068877_10000655 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 29711 | Open in IMG/M |
| 3300005527|Ga0068876_10140051 | All Organisms → Viruses → Predicted Viral | 1426 | Open in IMG/M |
| 3300005527|Ga0068876_10776133 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 508 | Open in IMG/M |
| 3300005528|Ga0068872_10268122 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 954 | Open in IMG/M |
| 3300005528|Ga0068872_10331051 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 839 | Open in IMG/M |
| 3300005580|Ga0049083_10298861 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 539 | Open in IMG/M |
| 3300005581|Ga0049081_10034283 | All Organisms → Viruses → Predicted Viral | 1929 | Open in IMG/M |
| 3300005581|Ga0049081_10118035 | Not Available | 983 | Open in IMG/M |
| 3300005581|Ga0049081_10192428 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 734 | Open in IMG/M |
| 3300005805|Ga0079957_1010440 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 7021 | Open in IMG/M |
| 3300005805|Ga0079957_1146634 | All Organisms → Viruses → Predicted Viral | 1207 | Open in IMG/M |
| 3300006018|Ga0068875_1018913 | Not Available | 612 | Open in IMG/M |
| 3300006105|Ga0007819_1088973 | Not Available | 621 | Open in IMG/M |
| 3300006641|Ga0075471_10449446 | Not Available | 643 | Open in IMG/M |
| 3300006805|Ga0075464_10181278 | All Organisms → Viruses → Predicted Viral | 1246 | Open in IMG/M |
| 3300007363|Ga0075458_10114965 | Not Available | 836 | Open in IMG/M |
| 3300007516|Ga0105050_10011151 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 9675 | Open in IMG/M |
| 3300007523|Ga0105052_10397261 | Not Available | 904 | Open in IMG/M |
| 3300007523|Ga0105052_10558262 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 737 | Open in IMG/M |
| 3300007708|Ga0102859_1272432 | Not Available | 510 | Open in IMG/M |
| 3300007735|Ga0104988_10044 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 10337 | Open in IMG/M |
| 3300007735|Ga0104988_10921 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 39057 | Open in IMG/M |
| 3300007972|Ga0105745_1159625 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 695 | Open in IMG/M |
| 3300007973|Ga0105746_1013979 | All Organisms → Viruses → Predicted Viral | 2316 | Open in IMG/M |
| 3300007992|Ga0105748_10171858 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 893 | Open in IMG/M |
| 3300008107|Ga0114340_1010429 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 8696 | Open in IMG/M |
| 3300008107|Ga0114340_1011350 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 6380 | Open in IMG/M |
| 3300008110|Ga0114343_1053046 | All Organisms → Viruses → Predicted Viral | 1932 | Open in IMG/M |
| 3300008113|Ga0114346_1046160 | All Organisms → Viruses → Predicted Viral | 2197 | Open in IMG/M |
| 3300008116|Ga0114350_1091504 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 983 | Open in IMG/M |
| 3300008122|Ga0114359_1030715 | All Organisms → Viruses → Predicted Viral | 2076 | Open in IMG/M |
| 3300008266|Ga0114363_1070533 | All Organisms → Viruses → Predicted Viral | 1329 | Open in IMG/M |
| 3300008266|Ga0114363_1217250 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 570 | Open in IMG/M |
| 3300008267|Ga0114364_1068019 | All Organisms → Viruses → Predicted Viral | 1209 | Open in IMG/M |
| 3300008448|Ga0114876_1179181 | Not Available | 740 | Open in IMG/M |
| 3300008448|Ga0114876_1253447 | Not Available | 543 | Open in IMG/M |
| 3300008450|Ga0114880_1226570 | Not Available | 603 | Open in IMG/M |
| 3300009068|Ga0114973_10039025 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2839 | Open in IMG/M |
| 3300009151|Ga0114962_10370009 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 782 | Open in IMG/M |
| 3300009152|Ga0114980_10129349 | All Organisms → Viruses → Predicted Viral | 1502 | Open in IMG/M |
| 3300009154|Ga0114963_10000435 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 27905 | Open in IMG/M |
| 3300009158|Ga0114977_10604085 | Not Available | 591 | Open in IMG/M |
| 3300009159|Ga0114978_10080216 | All Organisms → Viruses → Predicted Viral | 2184 | Open in IMG/M |
| 3300009160|Ga0114981_10001395 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 15917 | Open in IMG/M |
| 3300009181|Ga0114969_10292575 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 964 | Open in IMG/M |
| 3300009182|Ga0114959_10227925 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 954 | Open in IMG/M |
| 3300009183|Ga0114974_10038034 | All Organisms → Viruses → Predicted Viral | 3283 | Open in IMG/M |
| 3300009183|Ga0114974_10127958 | All Organisms → Viruses → Predicted Viral | 1608 | Open in IMG/M |
| 3300009183|Ga0114974_10412260 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 771 | Open in IMG/M |
| 3300009183|Ga0114974_10752573 | Not Available | 526 | Open in IMG/M |
| 3300009184|Ga0114976_10283073 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 891 | Open in IMG/M |
| 3300009187|Ga0114972_10297017 | Not Available | 959 | Open in IMG/M |
| 3300009187|Ga0114972_10301422 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 950 | Open in IMG/M |
| 3300009684|Ga0114958_10017078 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4290 | Open in IMG/M |
| 3300010157|Ga0114964_10557791 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 538 | Open in IMG/M |
| 3300010157|Ga0114964_10611486 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 511 | Open in IMG/M |
| 3300010158|Ga0114960_10145635 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1277 | Open in IMG/M |
| 3300010334|Ga0136644_10138492 | All Organisms → Viruses → Predicted Viral | 1487 | Open in IMG/M |
| 3300010334|Ga0136644_10663130 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 569 | Open in IMG/M |
| 3300010354|Ga0129333_10989668 | Not Available | 707 | Open in IMG/M |
| 3300010368|Ga0129324_10388592 | Not Available | 540 | Open in IMG/M |
| 3300010885|Ga0133913_10004320 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 36086 | Open in IMG/M |
| 3300010885|Ga0133913_10368851 | All Organisms → Viruses → Predicted Viral | 3796 | Open in IMG/M |
| 3300010885|Ga0133913_12999596 | All Organisms → Viruses → Predicted Viral | 1126 | Open in IMG/M |
| 3300011115|Ga0151514_10203 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 29231 | Open in IMG/M |
| 3300011334|Ga0153697_1171 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 22313 | Open in IMG/M |
| 3300012017|Ga0153801_1098013 | Not Available | 517 | Open in IMG/M |
| 3300013004|Ga0164293_10347492 | All Organisms → Viruses → Predicted Viral | 1013 | Open in IMG/M |
| 3300013005|Ga0164292_10708290 | Not Available | 642 | Open in IMG/M |
| 3300013006|Ga0164294_10248177 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1247 | Open in IMG/M |
| 3300013295|Ga0170791_14301058 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C455 | 733 | Open in IMG/M |
| 3300017701|Ga0181364_1038006 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 771 | Open in IMG/M |
| 3300017701|Ga0181364_1041992 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 728 | Open in IMG/M |
| 3300017722|Ga0181347_1068413 | All Organisms → Viruses → Predicted Viral | 1049 | Open in IMG/M |
| 3300017736|Ga0181365_1058958 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 953 | Open in IMG/M |
| 3300017736|Ga0181365_1097408 | Not Available | 714 | Open in IMG/M |
| 3300017761|Ga0181356_1050866 | All Organisms → Viruses → Predicted Viral | 1429 | Open in IMG/M |
| 3300017774|Ga0181358_1283463 | Not Available | 510 | Open in IMG/M |
| 3300017777|Ga0181357_1314814 | Not Available | 528 | Open in IMG/M |
| 3300017780|Ga0181346_1216799 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 683 | Open in IMG/M |
| 3300017784|Ga0181348_1153821 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 859 | Open in IMG/M |
| 3300017785|Ga0181355_1352296 | Not Available | 541 | Open in IMG/M |
| 3300019784|Ga0181359_1039325 | All Organisms → Viruses → Predicted Viral | 1832 | Open in IMG/M |
| 3300019784|Ga0181359_1248570 | Not Available | 541 | Open in IMG/M |
| 3300020551|Ga0208360_1034147 | Not Available | 656 | Open in IMG/M |
| 3300021961|Ga0222714_10049504 | All Organisms → cellular organisms → Bacteria | 2924 | Open in IMG/M |
| 3300021963|Ga0222712_10553648 | Not Available | 671 | Open in IMG/M |
| 3300022190|Ga0181354_1062887 | All Organisms → Viruses → Predicted Viral | 1233 | Open in IMG/M |
| 3300022190|Ga0181354_1065190 | All Organisms → Viruses → Predicted Viral | 1210 | Open in IMG/M |
| 3300022407|Ga0181351_1082802 | All Organisms → Viruses → Predicted Viral | 1275 | Open in IMG/M |
| 3300022407|Ga0181351_1185042 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 712 | Open in IMG/M |
| 3300023174|Ga0214921_10001585 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 38395 | Open in IMG/M |
| 3300023184|Ga0214919_10163818 | All Organisms → Viruses → Predicted Viral | 1739 | Open in IMG/M |
| 3300025075|Ga0209615_100275 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 5362 | Open in IMG/M |
| 3300025389|Ga0208257_1015305 | All Organisms → Viruses → Predicted Viral | 1222 | Open in IMG/M |
| 3300025398|Ga0208251_1000191 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 19154 | Open in IMG/M |
| 3300025635|Ga0208147_1118206 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 634 | Open in IMG/M |
| 3300025655|Ga0208795_1106626 | Not Available | 744 | Open in IMG/M |
| 3300025896|Ga0208916_10002596 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 7373 | Open in IMG/M |
| 3300025896|Ga0208916_10325766 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 670 | Open in IMG/M |
| 3300027142|Ga0255065_1090157 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 512 | Open in IMG/M |
| 3300027608|Ga0208974_1046550 | All Organisms → Viruses → Predicted Viral | 1258 | Open in IMG/M |
| 3300027693|Ga0209704_1139148 | Not Available | 700 | Open in IMG/M |
| 3300027721|Ga0209492_1272384 | Not Available | 568 | Open in IMG/M |
| 3300027736|Ga0209190_1098540 | All Organisms → Viruses → Predicted Viral | 1352 | Open in IMG/M |
| 3300027741|Ga0209085_1000689 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 23795 | Open in IMG/M |
| 3300027741|Ga0209085_1231427 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 735 | Open in IMG/M |
| 3300027754|Ga0209596_1006236 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 8652 | Open in IMG/M |
| 3300027763|Ga0209088_10000506 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 27337 | Open in IMG/M |
| 3300027763|Ga0209088_10005380 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 7336 | Open in IMG/M |
| 3300027777|Ga0209829_10178475 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 945 | Open in IMG/M |
| 3300027782|Ga0209500_10313092 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 660 | Open in IMG/M |
| 3300027785|Ga0209246_10067944 | All Organisms → Viruses → Predicted Viral | 1383 | Open in IMG/M |
| 3300027785|Ga0209246_10169194 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 858 | Open in IMG/M |
| 3300027785|Ga0209246_10180708 | Not Available | 827 | Open in IMG/M |
| 3300027785|Ga0209246_10295264 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 623 | Open in IMG/M |
| 3300027793|Ga0209972_10000552 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 36862 | Open in IMG/M |
| 3300027797|Ga0209107_10000444 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 24297 | Open in IMG/M |
| 3300027797|Ga0209107_10499155 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 540 | Open in IMG/M |
| 3300027798|Ga0209353_10065898 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1654 | Open in IMG/M |
| 3300027805|Ga0209229_10045871 | All Organisms → Viruses → Predicted Viral | 1943 | Open in IMG/M |
| 3300027808|Ga0209354_10078614 | All Organisms → Viruses → Predicted Viral | 1341 | Open in IMG/M |
| 3300027816|Ga0209990_10151731 | Not Available | 1097 | Open in IMG/M |
| 3300027892|Ga0209550_10129572 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1832 | Open in IMG/M |
| 3300027963|Ga0209400_1103375 | All Organisms → Viruses → Predicted Viral | 1321 | Open in IMG/M |
| 3300027971|Ga0209401_1147912 | Not Available | 919 | Open in IMG/M |
| 3300027976|Ga0209702_10007681 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 13033 | Open in IMG/M |
| 3300027983|Ga0209284_10005727 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 12603 | Open in IMG/M |
| 3300028025|Ga0247723_1000520 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 26351 | Open in IMG/M |
| 3300028025|Ga0247723_1001545 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 13365 | Open in IMG/M |
| 3300028025|Ga0247723_1003988 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 7161 | Open in IMG/M |
| 3300028025|Ga0247723_1004193 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 6917 | Open in IMG/M |
| 3300028025|Ga0247723_1012322 | All Organisms → Viruses → Predicted Viral | 3221 | Open in IMG/M |
| 3300028025|Ga0247723_1048063 | All Organisms → Viruses → Predicted Viral | 1234 | Open in IMG/M |
| 3300028025|Ga0247723_1063465 | All Organisms → Viruses → Predicted Viral | 1014 | Open in IMG/M |
| 3300028392|Ga0304729_1003619 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 8697 | Open in IMG/M |
| 3300028392|Ga0304729_1036408 | All Organisms → Viruses → Predicted Viral | 1947 | Open in IMG/M |
| 3300028392|Ga0304729_1037971 | All Organisms → Viruses → Predicted Viral | 1893 | Open in IMG/M |
| 3300028392|Ga0304729_1039896 | All Organisms → Viruses → Predicted Viral | 1830 | Open in IMG/M |
| 3300028393|Ga0304728_1235036 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 620 | Open in IMG/M |
| 3300029933|Ga0119945_1000387 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 6528 | Open in IMG/M |
| 3300031707|Ga0315291_10259035 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1732 | Open in IMG/M |
| 3300031746|Ga0315293_11211421 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 524 | Open in IMG/M |
| 3300031758|Ga0315907_10515835 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 943 | Open in IMG/M |
| 3300031758|Ga0315907_10559867 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 894 | Open in IMG/M |
| 3300031772|Ga0315288_10608486 | All Organisms → Viruses → Predicted Viral | 1052 | Open in IMG/M |
| 3300031857|Ga0315909_10153361 | All Organisms → Viruses → Predicted Viral | 1893 | Open in IMG/M |
| 3300031857|Ga0315909_10331241 | All Organisms → Viruses → Predicted Viral | 1122 | Open in IMG/M |
| 3300031952|Ga0315294_10091833 | All Organisms → Viruses → Predicted Viral | 3156 | Open in IMG/M |
| 3300031963|Ga0315901_10704575 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 748 | Open in IMG/M |
| 3300032050|Ga0315906_11092811 | Not Available | 590 | Open in IMG/M |
| 3300032092|Ga0315905_10004131 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 14834 | Open in IMG/M |
| 3300032177|Ga0315276_12119606 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 571 | Open in IMG/M |
| 3300033816|Ga0334980_0345224 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 571 | Open in IMG/M |
| 3300033993|Ga0334994_0072831 | All Organisms → Viruses → Predicted Viral | 2077 | Open in IMG/M |
| 3300033993|Ga0334994_0432495 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 628 | Open in IMG/M |
| 3300033996|Ga0334979_0483523 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 673 | Open in IMG/M |
| 3300034012|Ga0334986_0043808 | All Organisms → Viruses → Predicted Viral | 2878 | Open in IMG/M |
| 3300034062|Ga0334995_0191948 | All Organisms → Viruses → Predicted Viral | 1429 | Open in IMG/M |
| 3300034062|Ga0334995_0687184 | Not Available | 578 | Open in IMG/M |
| 3300034068|Ga0334990_0009071 | Not Available | 5324 | Open in IMG/M |
| 3300034092|Ga0335010_0333530 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 856 | Open in IMG/M |
| 3300034093|Ga0335012_0112335 | All Organisms → Viruses → Predicted Viral | 1514 | Open in IMG/M |
| 3300034101|Ga0335027_0362576 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 954 | Open in IMG/M |
| 3300034106|Ga0335036_0321857 | All Organisms → Viruses → Predicted Viral | 1020 | Open in IMG/M |
| 3300034118|Ga0335053_0555424 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 668 | Open in IMG/M |
| 3300034118|Ga0335053_0761854 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 538 | Open in IMG/M |
| 3300034122|Ga0335060_0004992 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 8821 | Open in IMG/M |
| 3300034168|Ga0335061_0131287 | All Organisms → Viruses → Predicted Viral | 1334 | Open in IMG/M |
| 3300034283|Ga0335007_0185090 | All Organisms → Viruses → Predicted Viral | 1460 | Open in IMG/M |
| 3300034283|Ga0335007_0571424 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 661 | Open in IMG/M |
| 3300034284|Ga0335013_0572817 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 664 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 22.28% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 21.74% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 13.04% |
| Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 4.89% |
| Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 3.80% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 3.80% |
| Deep Subsurface Sediment | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface Sediment | 3.80% |
| Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 2.72% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 2.72% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 2.72% |
| Freshwater | Environmental → Aquatic → Freshwater → Ice → Glacial Lake → Freshwater | 2.72% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater | 2.17% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 1.63% |
| Estuary Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water | 1.63% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 1.09% |
| Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Lentic | 1.09% |
| Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater And Sediment | 1.09% |
| Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Lake | 1.09% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 1.09% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 1.09% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 0.54% |
| Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater And Sediment | 0.54% |
| Freshwater | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater | 0.54% |
| Aquatic | Environmental → Aquatic → Freshwater → Drinking Water → Unclassified → Aquatic | 0.54% |
| Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 0.54% |
| Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 0.54% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 0.54% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2035265000 | Freshwater microbial communities from Swedish Lakes - surface of Lake Erken | Environmental | Open in IMG/M |
| 3300002091 | Lentic bog actinobacteria communities from Grosse Fuchskuhle, Germany - Sample acI-B2 co-culture F-F8 metagenome | Environmental | Open in IMG/M |
| 3300002092 | Lentic bog actinobacteria communities from Grosse Fuchskuhle, Germany - Sample acI-B2 co-culture F-B6 metagenome | Environmental | Open in IMG/M |
| 3300003277 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD | Environmental | Open in IMG/M |
| 3300003394 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SN | Environmental | Open in IMG/M |
| 3300003412 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.DD | Environmental | Open in IMG/M |
| 3300003493 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.SN | Environmental | Open in IMG/M |
| 3300003986 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM110.SN (v2) | Environmental | Open in IMG/M |
| 3300004096 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (version 2) | Environmental | Open in IMG/M |
| 3300005517 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (version 4) | Environmental | Open in IMG/M |
| 3300005525 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel6S_1000h metaG | Environmental | Open in IMG/M |
| 3300005527 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG | Environmental | Open in IMG/M |
| 3300005528 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel1S_2200h metaG | Environmental | Open in IMG/M |
| 3300005580 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG MI27MSRF | Environmental | Open in IMG/M |
| 3300005581 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF | Environmental | Open in IMG/M |
| 3300005805 | Microbial and algae communities from Cheney Reservoir in Wichita, Kansas, USA | Environmental | Open in IMG/M |
| 3300006018 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel4S_1600h metaG | Environmental | Open in IMG/M |
| 3300006105 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE07Jul09 | Environmental | Open in IMG/M |
| 3300006641 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006805 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA | Environmental | Open in IMG/M |
| 3300007363 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_0.3_<0.8_DNA | Environmental | Open in IMG/M |
| 3300007516 | Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - FRY-01 | Environmental | Open in IMG/M |
| 3300007523 | Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - FRY-03 | Environmental | Open in IMG/M |
| 3300007708 | Estuarine microbial communities from the Columbia River estuary - metaG 1371B-02 | Environmental | Open in IMG/M |
| 3300007735 | Freshwater viral communities from Lake Soyang, Gangwon-do, South Korea ? 2014Oct | Environmental | Open in IMG/M |
| 3300007972 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460ABC_3.0um | Environmental | Open in IMG/M |
| 3300007973 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460A_0.2um | Environmental | Open in IMG/M |
| 3300007992 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1461AB_0.2um | Environmental | Open in IMG/M |
| 3300008107 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-3-NA | Environmental | Open in IMG/M |
| 3300008110 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0048-3-NA | Environmental | Open in IMG/M |
| 3300008113 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0050-3-NA | Environmental | Open in IMG/M |
| 3300008116 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-3-NA | Environmental | Open in IMG/M |
| 3300008122 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample HABS-E2014-0124-100-LTR | Environmental | Open in IMG/M |
| 3300008266 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample HABS-E2014-0108-C-NA | Environmental | Open in IMG/M |
| 3300008267 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0024-100-LTR | Environmental | Open in IMG/M |
| 3300008448 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - August 4, 2014 all contigs | Environmental | Open in IMG/M |
| 3300008450 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - Oct 27, 2014 all contigs | Environmental | Open in IMG/M |
| 3300009068 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_MF_MetaG | Environmental | Open in IMG/M |
| 3300009151 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_MF_MetaG | Environmental | Open in IMG/M |
| 3300009152 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_EF_MetaG | Environmental | Open in IMG/M |
| 3300009154 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_EF_MetaG | Environmental | Open in IMG/M |
| 3300009158 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG | Environmental | Open in IMG/M |
| 3300009159 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG | Environmental | Open in IMG/M |
| 3300009160 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_MF_MetaG | Environmental | Open in IMG/M |
| 3300009181 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_MF_MetaG | Environmental | Open in IMG/M |
| 3300009182 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130625_EF_MetaG | Environmental | Open in IMG/M |
| 3300009183 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG | Environmental | Open in IMG/M |
| 3300009184 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaG | Environmental | Open in IMG/M |
| 3300009187 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_EF_MetaG | Environmental | Open in IMG/M |
| 3300009684 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130208_EF_MetaG | Environmental | Open in IMG/M |
| 3300010157 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_MF_MetaG | Environmental | Open in IMG/M |
| 3300010158 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130625_MF_MetaG | Environmental | Open in IMG/M |
| 3300010334 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_EF_MetaG (v2) | Environmental | Open in IMG/M |
| 3300010354 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNA | Environmental | Open in IMG/M |
| 3300010368 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_15_0.2_DNA | Environmental | Open in IMG/M |
| 3300010885 | northern Canada Lakes Co-assembly | Environmental | Open in IMG/M |
| 3300011115 | Freshwater viral communities from Lake Soyang, Gangwon-do, South Korea - SYL_2016May | Environmental | Open in IMG/M |
| 3300011334 | Lotic viral community from Han River, Hwacheon, Gangwon-do, South Korea - Daesung | Environmental | Open in IMG/M |
| 3300012017 | Freshwater microbial communities from Central Basin Lake Erie, Ontario, Canada - Station 1208 - Top - Depth 1m | Environmental | Open in IMG/M |
| 3300013004 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES118 metaG | Environmental | Open in IMG/M |
| 3300013005 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES117 metaG | Environmental | Open in IMG/M |
| 3300013006 | Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - GEODES005 metaG | Environmental | Open in IMG/M |
| 3300013295 | northern Canada Lakes metatranscriptome co-assembly | Environmental | Open in IMG/M |
| 3300017701 | Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MM110.S.N | Environmental | Open in IMG/M |
| 3300017722 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.N | Environmental | Open in IMG/M |
| 3300017736 | Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MM110.D.N | Environmental | Open in IMG/M |
| 3300017761 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.N | Environmental | Open in IMG/M |
| 3300017774 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.D | Environmental | Open in IMG/M |
| 3300017777 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.D.N | Environmental | Open in IMG/M |
| 3300017780 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.D.N | Environmental | Open in IMG/M |
| 3300017784 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.D.N | Environmental | Open in IMG/M |
| 3300017785 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.D.N | Environmental | Open in IMG/M |
| 3300019784 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.D | Environmental | Open in IMG/M |
| 3300020551 | Freshwater microbial communities from Lake Mendota, WI - 27JUL2010 deep hole epilimnion ns (SPAdes) | Environmental | Open in IMG/M |
| 3300021961 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_3D | Environmental | Open in IMG/M |
| 3300021963 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_657D | Environmental | Open in IMG/M |
| 3300022190 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.N | Environmental | Open in IMG/M |
| 3300022407 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.S.D | Environmental | Open in IMG/M |
| 3300023174 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1505 | Environmental | Open in IMG/M |
| 3300023184 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1503 | Environmental | Open in IMG/M |
| 3300025075 | Freshwater bacterial and archeal communities from Indian Creek, Illinois, USA to study Microbial Dark Matter (Phase II) - 4B3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025389 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH10Sep07 (SPAdes) | Environmental | Open in IMG/M |
| 3300025398 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE15Jun09 (SPAdes) | Environmental | Open in IMG/M |
| 3300025635 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_0.3_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025655 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_2 Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025896 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300027142 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Cont_RepC_0h | Environmental | Open in IMG/M |
| 3300027608 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF (SPAdes) | Environmental | Open in IMG/M |
| 3300027693 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 1-3cm September2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300027721 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm May2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300027736 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140205_XF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027741 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027754 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027763 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140625_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027777 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_140205_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027782 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027785 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SN (SPAdes) | Environmental | Open in IMG/M |
| 3300027793 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel1S_2200h metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027797 | Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB hypolimnion July 2011 (SPAdes) | Environmental | Open in IMG/M |
| 3300027798 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD (SPAdes) | Environmental | Open in IMG/M |
| 3300027805 | Freshwater and sediment microbial communities from dead zone in Sandusky Bay, Ohio, USA (SPAdes) | Environmental | Open in IMG/M |
| 3300027808 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.DD (SPAdes) | Environmental | Open in IMG/M |
| 3300027816 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027892 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (SPAdes) | Environmental | Open in IMG/M |
| 3300027963 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027971 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027976 | Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - FRY-01 (SPAdes) | Environmental | Open in IMG/M |
| 3300027983 | Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - FRY-03 (SPAdes) | Environmental | Open in IMG/M |
| 3300028025 | Subsurface sediment microbial communities from gas well in West Virginia, United States - MSEEL Well Study Marcellus 5H_FC | Environmental | Open in IMG/M |
| 3300028392 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_MF_MetaG (v2) | Environmental | Open in IMG/M |
| 3300028393 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130625_MF_MetaG (v2) | Environmental | Open in IMG/M |
| 3300029933 | Aquatic microbial communities from drinking water treatment plant in Pearl River Delta area, China - influent_20120727_2 | Environmental | Open in IMG/M |
| 3300031707 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G12_20 | Environmental | Open in IMG/M |
| 3300031746 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_20 | Environmental | Open in IMG/M |
| 3300031758 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA123 | Environmental | Open in IMG/M |
| 3300031772 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_20 | Environmental | Open in IMG/M |
| 3300031857 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125 | Environmental | Open in IMG/M |
| 3300031952 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_40 | Environmental | Open in IMG/M |
| 3300031963 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA116 | Environmental | Open in IMG/M |
| 3300032050 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA122 | Environmental | Open in IMG/M |
| 3300032092 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA121 | Environmental | Open in IMG/M |
| 3300032177 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G05_0 | Environmental | Open in IMG/M |
| 3300033816 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME16Sep2004-rr0005 | Environmental | Open in IMG/M |
| 3300033993 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Jul2012-rr0037 | Environmental | Open in IMG/M |
| 3300033996 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Jul2016-rr0004 | Environmental | Open in IMG/M |
| 3300034012 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Aug2017-rr0027 | Environmental | Open in IMG/M |
| 3300034062 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Jul2012-rr0045 | Environmental | Open in IMG/M |
| 3300034068 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME13Apr2016-rr0031 | Environmental | Open in IMG/M |
| 3300034092 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME03Aug2012-rr0069 | Environmental | Open in IMG/M |
| 3300034093 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME08Jun2014-rr0072 | Environmental | Open in IMG/M |
| 3300034101 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME19Sep2005-rr0107 | Environmental | Open in IMG/M |
| 3300034106 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME23Aug2013-rr0131 | Environmental | Open in IMG/M |
| 3300034118 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME05Aug2017-rr0165 | Environmental | Open in IMG/M |
| 3300034122 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME03Aug2014-rr0181 | Environmental | Open in IMG/M |
| 3300034168 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME06Apr2016-rr0183 | Environmental | Open in IMG/M |
| 3300034283 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Aug2003-rr0061 | Environmental | Open in IMG/M |
| 3300034284 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME08Jul2016-rr0075 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| ErSWdraft_8643590 | 2035265000 | Freshwater | MFEITVMWDMETREVTWYDLAQKCKDCGTITTAPTPMDWMDCD |
| JGI24028J26656_10181121 | 3300002091 | Lentic | ETRMVGWYDLKQQCIECGTYTTAPTEIDEGMDCX* |
| JGI24218J26658_10311081 | 3300002092 | Lentic | CMMFRVNVMWDQESREVGWYDLKQECVECGTYTTAPTPIDWMDCD* |
| JGI25908J49247_100091275 | 3300003277 | Freshwater Lake | MFEITVMWDQETREVTWYDLAQKCKDCGTITTAPTPMDWRDCE* |
| JGI25907J50239_10224681 | 3300003394 | Freshwater Lake | MFEITVMWDQETREVTWYDLAQKCKDCGTITTAPTPMDWRDCE |
| JGI25907J50239_11074343 | 3300003394 | Freshwater Lake | MFVITVMWDDETREVSWYDLKQECKECKAISTAPTPMDWRDE* |
| JGI25912J50252_101391843 | 3300003412 | Freshwater Lake | CGCKVFTINVMWDDCERTVAWYDLRQVCKDCGTVSTAPTPIDDEE* |
| JGI25923J51411_10391861 | 3300003493 | Freshwater Lake | ICGCKMFRVTVMWDEXTRAVGWYDLAQECIECGTLTTAPTDIDGCEE* |
| Ga0063233_101586331 | 3300003986 | Freshwater Lake | CGCKMFRVTVMWDEETRAVGWYDLAQECIECGTLTTAPTDIDGCEE* |
| Ga0066177_101866354 | 3300004096 | Freshwater Lake | TVMWDEETREVGWYDLAQRCHECGTITTAPTPMDWRDCE* |
| Ga0070374_101024544 | 3300005517 | Freshwater Lake | MFKVIVMWDEETRAVGWYDLKQECIECGTLTTAPTEIDGDDCA* |
| Ga0070374_102014294 | 3300005517 | Freshwater Lake | MFVITVMWDNETREVSWYDLRQVCKECGAISTAPTPMDWRDE* |
| Ga0068877_1000065530 | 3300005525 | Freshwater Lake | MVCVCGSMMWNVTVMWDAETRTVAWYDLRQECKECGAIATAPTEID* |
| Ga0068876_101400514 | 3300005527 | Freshwater Lake | KMWIITVVWDEETRTVGWYDLRQECKLCGAIATAPTEID* |
| Ga0068876_107761331 | 3300005527 | Freshwater Lake | MWNITVIWDEDTREVGWYDLRQECKLCGAIATAPTPIDGEM* |
| Ga0068872_102681223 | 3300005528 | Freshwater Lake | MFEITVMWDQEDRTIGWYDLRQKCKDCGSISTAPTPIDGEI* |
| Ga0068872_103310511 | 3300005528 | Freshwater Lake | ITVVWDEETRTVGWYDLRQECKLCGAIATAPTEID* |
| Ga0049083_102988611 | 3300005580 | Freshwater Lentic | EETRAVGWYDLKQECIECGTLTTAPTEIDGDDCA* |
| Ga0049081_100342836 | 3300005581 | Freshwater Lentic | KMWIITVMWDEQDRTVSWYDLQQECKECGAIATAPTEIDWKDE* |
| Ga0049081_101180353 | 3300005581 | Freshwater Lentic | MFVITVMWDEETRELSWYDLKQECKECKAISTAPTPMDWRDE* |
| Ga0049081_101924282 | 3300005581 | Freshwater Lentic | MFKVIVMWDEETRAVGWYDLKQECIECGTLTTAPTEIDGDYCA* |
| Ga0079957_101044011 | 3300005805 | Lake | MFVVTVMWDEETREVSWYDLKQECKECKAISTAPTPMDWRDE* |
| Ga0079957_11466342 | 3300005805 | Lake | MFEVTVMWDKETREVGWYDLSQRCKECGTITTAPTPMDWRDCE* |
| Ga0068875_10189132 | 3300006018 | Freshwater Lake | MMWNVTVMWDAETRTVAWYDLRQECKECGAIATAPTEID* |
| Ga0007819_10889731 | 3300006105 | Freshwater | FQVNLMWDEETRLPGWYDLSQTCYECGTVTTAPTPIDKEMDCA* |
| Ga0075471_104494462 | 3300006641 | Aqueous | MFVITVMWDEETREVSWYDLKQECKECKAISTAPTPMDWRDE* |
| Ga0075464_101812782 | 3300006805 | Aqueous | MFKVTVMWDEETRAVGWYDLKQECIECGTLTTAPTEIDGDDCA* |
| Ga0075458_101149652 | 3300007363 | Aqueous | MFVITVMWDEETREVGWYDLKQECKECKAISTAPTPMDWRDE* |
| Ga0105050_1001115120 | 3300007516 | Freshwater | MWDEETREVGWYDLSQKCKECGTITTAPTPMDWEDCD* |
| Ga0105052_103972611 | 3300007523 | Freshwater | MFKITVMWDEQTRELSWYDLAQECVDCGIITTAPTPIDFDDINR* |
| Ga0105052_105582621 | 3300007523 | Freshwater | TVMWDEETREVGWYDLSQKCKECGTITTAPTPMDWEDCD* |
| Ga0102859_12724322 | 3300007708 | Estuarine | ITVMWDEETRELSWYDLKQECKECKAISTAPTPMDWRDE* |
| Ga0104988_1004418 | 3300007735 | Freshwater | MFQITVMWDEDTRAVGWYDLAQQCFECGTITTAPTEIDGCE* |
| Ga0104988_109213 | 3300007735 | Freshwater | MFVVTVMWDEETREVGWYDLKQECKECGAISTAPTPMDWRDE* |
| Ga0105745_11596254 | 3300007972 | Estuary Water | TVMWDEETRAVGWYDLKQECIECGTLTTAPTEIDGDYCV* |
| Ga0105746_10139793 | 3300007973 | Estuary Water | MFKVTVMWDEETRAVGWYDLAQECIECGTLTTAPTEIDGDDCA* |
| Ga0105748_101718581 | 3300007992 | Estuary Water | CICGCKMFKVTVMWDEETRAVGWYDLAQECIECGTLTTAPTEIDGDDCA* |
| Ga0114340_10104292 | 3300008107 | Freshwater, Plankton | MFEVTVMWDEDTRAVGWYDLAQKCKDCGAISTAPTEIDGCE* |
| Ga0114340_101135014 | 3300008107 | Freshwater, Plankton | MWDEDTRAVGWYDLAQECIECGTVTTAPTEIDGDDCA* |
| Ga0114343_10530461 | 3300008110 | Freshwater, Plankton | EITVMWDSETREVGWYDLRQKCKECGSESTAPTPIDWEI* |
| Ga0114346_10461601 | 3300008113 | Freshwater, Plankton | GCLMFEITVMWDSETREVGWYDLRQKCKECGSESTAPTPIDWEI* |
| Ga0114350_10915043 | 3300008116 | Freshwater, Plankton | MFKVTVMWDEDTRTVGWYDLAQECIECGTITTAPTEIDGC |
| Ga0114359_10307155 | 3300008122 | Freshwater, Plankton | WIITVVWDEETRTVGWYDLRQECKLCGAIATAPTEID* |
| Ga0114363_10705331 | 3300008266 | Freshwater, Plankton | CGSKMWIITVVWDEETRTVGWYDLRQECKLCGAIATAPTEID* |
| Ga0114363_12172501 | 3300008266 | Freshwater, Plankton | WDREDRTIGWYDLKQKCKECGTLTTAPTPIDGEM* |
| Ga0114364_10680192 | 3300008267 | Freshwater, Plankton | MFEITVMWDMETREVTWYDLAQKCKECGTITTAPTPMDWRDCE* |
| Ga0114876_11791812 | 3300008448 | Freshwater Lake | MWNITVMLDEEDRTIGWYDLRQECKECGAIATAPTEIDWK |
| Ga0114876_12534472 | 3300008448 | Freshwater Lake | MWNITVMWDEEDRTIGWYDLRQECKECGAIATTPTEIDWKDE* |
| Ga0114880_12265702 | 3300008450 | Freshwater Lake | MWNITVMWDEEDRTIGWYDLRQECKECGAIATAPTEID |
| Ga0114973_100390252 | 3300009068 | Freshwater Lake | MFEITVMWDMETREVTWYDLAQKCKDCGTITTAPTPMDWMDCD* |
| Ga0114962_103700092 | 3300009151 | Freshwater Lake | MFKVTVMWDEETRAVGWYDLKQECIECGTWTTAPTEIDGEDCA* |
| Ga0114980_101293495 | 3300009152 | Freshwater Lake | CKMFKVIVMWDEETRAVGWYDLKQECIECGTLTTAPTEIDGDDCA* |
| Ga0114963_1000043516 | 3300009154 | Freshwater Lake | MFNITVIWDEETRAVGWYDLKQECKDCGIITTAPTEIDGCD* |
| Ga0114977_106040853 | 3300009158 | Freshwater Lake | MFKVTVMWDEETRAVGWYDLAQECIECGTVTTAPTEIDGDDCA* |
| Ga0114978_100802163 | 3300009159 | Freshwater Lake | MFEITVMWDMETREVTWYDLAQKCKDCGTITTAPTPMDWRDCE* |
| Ga0114981_1000139513 | 3300009160 | Freshwater Lake | MWKVVVMWDEEDRTVSWYDLQQECKMCGALATAPTEIDWRD* |
| Ga0114969_102925751 | 3300009181 | Freshwater Lake | CICGCMMFKVIVMWDEDTRAVGWYDLRQECIDCGIITTAPTEIDGCE* |
| Ga0114959_102279252 | 3300009182 | Freshwater Lake | MWDEETRAVGWYDLAQVCIECGTVTTAPTEIDGEDCA* |
| Ga0114974_100380346 | 3300009183 | Freshwater Lake | MWIVTVMWDEEDRTVAWYDLQQECKECGAIATAPTEIDWEDE* |
| Ga0114974_101279581 | 3300009183 | Freshwater Lake | TVMWDEETREVSWYDLKQECKECKAISTAPTPMDWRDE* |
| Ga0114974_104122602 | 3300009183 | Freshwater Lake | MFRVTVMWDEETRAVGWYDLKQECIECGTWTTAPTEIDGDDCA* |
| Ga0114974_107525731 | 3300009183 | Freshwater Lake | MWIITVMWDEEDRTVVWYDLQQQCKECGAIATAPTEIDW |
| Ga0114976_102830733 | 3300009184 | Freshwater Lake | MFKVTVMWDEETRAVGWYDLAQECIECGIVTTAPTEIDGCEE* |
| Ga0114972_102970171 | 3300009187 | Freshwater Lake | ICGCKMFKVIVMWDEETRAVGWYDLKQECIECGTLTTAPTEIDGDYCA* |
| Ga0114972_103014223 | 3300009187 | Freshwater Lake | MFKVIVIWDEETRAVGWYDLKQECIECGTLTTAPTE |
| Ga0114958_100170783 | 3300009684 | Freshwater Lake | MFKVTVMWDEETRAVGWYDLAQVCVECETVTTAPTEIDGEDCA* |
| Ga0114964_105577913 | 3300010157 | Freshwater Lake | VTVMWDEETRAVGWYDLKQECIECGTWTTAPTEIDGEDCA* |
| Ga0114964_106114862 | 3300010157 | Freshwater Lake | MFKITVMWDEETRAVGWYDLKQECIECGTLTTAPTEIDGCE* |
| Ga0114960_101456352 | 3300010158 | Freshwater Lake | MWDEETRAVGWYDLAQVCIECGTVTTAPTEIDGDDCA* |
| Ga0136644_101384923 | 3300010334 | Freshwater Lake | MWDEETRAVGWYDLAQVCVECETVTTAPTEIDGEDCA* |
| Ga0136644_106631302 | 3300010334 | Freshwater Lake | WDNETREVSWYDLAQKCKECGAITTAPTPIDWMIERD* |
| Ga0129333_109896681 | 3300010354 | Freshwater To Marine Saline Gradient | CLCGSKMWIITVVWDEETRTVGWYDLRQECKLCGAIATAPTEID* |
| Ga0129324_103885922 | 3300010368 | Freshwater To Marine Saline Gradient | MFEITVMWDREDRTIGWYDLKQKCKECGTLTTAPTPIDEEI* |
| Ga0133913_1000432015 | 3300010885 | Freshwater Lake | MFEITVMWDNETREVSWYDLAQKCKECGAITTAPTPIDWMIERD* |
| Ga0133913_103688512 | 3300010885 | Freshwater Lake | MMFEITVMWDQETREVSWYDLVQKCKDCGTVTTAPTPIDWMDCE* |
| Ga0133913_129995962 | 3300010885 | Freshwater Lake | MFKVTVMWDEETRAVGWYDLKQECIECGTWTTAPTEIDGDDCA* |
| Ga0151514_1020331 | 3300011115 | Freshwater | MFVVTVMWDEETREVGWYDLKQECKECKAISTAPTPMDWRD* |
| Ga0153697_117127 | 3300011334 | Freshwater | MFNVTLMWDEDTRSVGWYDLAQECFECGTITTAPTEIDGDDCA* |
| Ga0153801_10980131 | 3300012017 | Freshwater | MFVITVMWDEETREVSWYDLKQECKECKAISTAPT |
| Ga0164293_103474922 | 3300013004 | Freshwater | MFIVTVMWDDETREVSWYDLRQECKECGAISTAPTPIDWKDDNGTQEV* |
| Ga0164292_107082902 | 3300013005 | Freshwater | MFIVTVMWDDETREVSWYDLRQQCKECGAISTAPTPIDWKDE* |
| Ga0164294_102481771 | 3300013006 | Freshwater | DEETRAVGWYDLAQECIECGTLTTAPTDIDGCEE* |
| Ga0170791_143010584 | 3300013295 | Freshwater | MFEITVMWDQETREVTWYDLAQKCKECGTITTAPTPEDWRDCD* |
| Ga0181364_10380063 | 3300017701 | Freshwater Lake | VCGCKMFIVTVMWDEEDRTVGWYDLKQECKECGAISTAPTEIDWKD |
| Ga0181364_10419922 | 3300017701 | Freshwater Lake | MMFKVTVMWDEETRAVGWYDLKQECIECGTLTTAPTEIDGDYCA |
| Ga0181347_10684134 | 3300017722 | Freshwater Lake | VMWDEETRAVGWYDLKQECIECGTLTTAPTEIDGDYCA |
| Ga0181365_10589581 | 3300017736 | Freshwater Lake | ITVMWDEETREVSWYDLKQECKECKAISTAPTPMDWRDE |
| Ga0181365_10974082 | 3300017736 | Freshwater Lake | MFKVTVMWDEETRAVGWYDLKQECIECGTLTTAPTEIDGDDCV |
| Ga0181356_10508661 | 3300017761 | Freshwater Lake | FACICGCKMFRVTVMWDEETRAVGWYDLAQECIECGTLTTAPTDIDGCEE |
| Ga0181358_12834632 | 3300017774 | Freshwater Lake | TVMWDEETRAVGWYDLKQECIECGTLTTAPTEIDGDDCV |
| Ga0181357_13148142 | 3300017777 | Freshwater Lake | VMWDEETRAVGWYDLKQECIECGTLTTAPTEIDGDDCV |
| Ga0181346_12167991 | 3300017780 | Freshwater Lake | VQWDQETREVGWYDLAQKCKECGTITTAPTPIDWMDCD |
| Ga0181348_11538211 | 3300017784 | Freshwater Lake | MFKVVVMWDEETRAVGWYDLKQECIECGTLTTAPTEIDGDDCA |
| Ga0181355_13522962 | 3300017785 | Freshwater Lake | CICGCMMFKVTVMWDEETRAVGWYDLKQECIECGTLTTAPTEIDGDDCV |
| Ga0181359_10393255 | 3300019784 | Freshwater Lake | MFKVTVMWDEETRAVGWYDLAQECIECGTLTTAPTDIDGDDCA |
| Ga0181359_12485702 | 3300019784 | Freshwater Lake | FKVTVMWDEETRAVGWYDLKQECIECGTLTTAPTEIDGDDCV |
| Ga0208360_10341471 | 3300020551 | Freshwater | MFVVTVMWDEETREVGWYDLKQECKECGAISTAPTPIDWRDDA |
| Ga0222714_100495042 | 3300021961 | Estuarine Water | MFKINVMWDAETRAVGWYDLAQECVECGTITTAPTEIDGCE |
| Ga0222712_105536481 | 3300021963 | Estuarine Water | TVMWDEDTRAVGWYDLAQECIECGTISTAPTEIDGCE |
| Ga0181354_10628871 | 3300022190 | Freshwater Lake | MWDEETRAVGWYDLAQECIECGTLTTAPTDIDGDDCV |
| Ga0181354_10651905 | 3300022190 | Freshwater Lake | MFEITVMWDMETREVMWYDLAQKCKECGTITTAPTPMDWRDCE |
| Ga0181351_10828022 | 3300022407 | Freshwater Lake | MFVITVMWDEETREVSWYDLRQECKECKAISTAPTPMDWRDE |
| Ga0181351_11850423 | 3300022407 | Freshwater Lake | VTVMWDEETRAVGWYDLAQECIECGTLTTAPTDIDGCEE |
| Ga0214921_1000158527 | 3300023174 | Freshwater | MFVVTVMWDAETREVGWYDLKQECKECGAISTAPTPMDWRDE |
| Ga0214919_101638185 | 3300023184 | Freshwater | MFVVTVMWDEETREVSWYDLKQECKECKAISTAPTPMDWRDE |
| Ga0209615_1002753 | 3300025075 | Freshwater | MFKVTVMWDEETRAVGWYDLAQECIECGTITTAPTEIDGDDCA |
| Ga0208257_10153051 | 3300025389 | Freshwater | MWDQDSRLVGWYDLRQECVECGTITTAPTPIDDEGMDCA |
| Ga0208251_100019130 | 3300025398 | Freshwater | MWDEETRLPGWYDLSQTCYECGTVTTAPTPIDEGMDCV |
| Ga0208147_11182063 | 3300025635 | Aqueous | MFVITVMWDEETREVGWYDLKQECKECKAISTAPTPMDWRDE |
| Ga0208795_11066262 | 3300025655 | Aqueous | MFVVTVMWDEETREVGWYDLRQECKECGAISTAPTPEDWRD |
| Ga0208916_100025961 | 3300025896 | Aqueous | IVMWDEETRAVGWYDLAQECIQCGTITTAPTEIDGEEYA |
| Ga0208916_103257662 | 3300025896 | Aqueous | MFKVTVMWDEETRAVGWYDLKQECIECGTLTTAPTEIDGDDCA |
| Ga0255065_10901571 | 3300027142 | Freshwater | ICGCKMFKVTVMWDEETRAVGWYDLKQECIECGTLTTAPTEIDGDDCA |
| Ga0208974_10465505 | 3300027608 | Freshwater Lentic | MFVITVMWDDETREVSWYDLKQECKECKAISTAPTPMDWRDE |
| Ga0209704_11391482 | 3300027693 | Freshwater Sediment | MFVVTVMWDEETREVGWYDLKQECKECGAISTAPTPIDWRDE |
| Ga0209492_12723842 | 3300027721 | Freshwater Sediment | KMFVVTVMWDEETREVGWYDLKQECKECGAISTAPTPIDWRDE |
| Ga0209190_10985402 | 3300027736 | Freshwater Lake | MFKVIVMWDEETRAVGWYDLKQECIECGTLTTAPTEIDGDYCA |
| Ga0209085_100068938 | 3300027741 | Freshwater Lake | MFNITVIWDEETRAVGWYDLKQECKDCGIITTAPTEIDGCD |
| Ga0209085_12314273 | 3300027741 | Freshwater Lake | WDEETREVGWYDLKQQCMECGTYTTAPTPIDEGMDCA |
| Ga0209596_100623616 | 3300027754 | Freshwater Lake | CICGCMMFKVIVMWDEDTRAVGWYDLRQECIDCGIITTAPTEIDGCE |
| Ga0209088_1000050646 | 3300027763 | Freshwater Lake | MWKVVVMWDEEDRTVSWYDLQQECKMCGALATAPTEIDWRD |
| Ga0209088_100053802 | 3300027763 | Freshwater Lake | MFRIIVMWDEETRAVGWYGLTQECIECGTTTTAPTPIDDEPDEMECV |
| Ga0209829_101784751 | 3300027777 | Freshwater Lake | VIWDEETRAVGWYDLKQECKDCGIITTAPTEIDGCD |
| Ga0209500_103130923 | 3300027782 | Freshwater Lake | LMFEITVMWDKEDRTVGWYDLKQKCKECGTLTTAPTPIDGEM |
| Ga0209246_100679446 | 3300027785 | Freshwater Lake | CKMFKVTVMWDEETRAVGWYDLAQECIECGTLTTAPTDIDGDDCV |
| Ga0209246_101691942 | 3300027785 | Freshwater Lake | MWDEETRAVGWYDLKQECIECGTLTTAPTEIDGDDC |
| Ga0209246_101807082 | 3300027785 | Freshwater Lake | MMFKVTVMWDEETRAVGWYDLKQECIECGTLTTAPTEIDGDDCA |
| Ga0209246_102952642 | 3300027785 | Freshwater Lake | CICGCKMFKVTVMWDEETRAVGWYDLAQECIECGTLTTAPTDIDGDDCA |
| Ga0209972_1000055238 | 3300027793 | Freshwater Lake | MVCVCGSMMWNVTVMWDAETRTVAWYDLRQECKECGAIATAPTEID |
| Ga0209107_1000044413 | 3300027797 | Freshwater And Sediment | MWDEETRAVGWYDLAQECIECGTLTTAPTEIDGDDCA |
| Ga0209107_104991553 | 3300027797 | Freshwater And Sediment | CLMFEITVMWDWESREISWYDLAQKCKDCGTITTAPTPMDWMDCD |
| Ga0209353_100658987 | 3300027798 | Freshwater Lake | LMFEITVMWDMETREVMWYDLAQKCKECGTITTAPTPMDWRDCE |
| Ga0209229_100458714 | 3300027805 | Freshwater And Sediment | MWDEETRAVGWYDLAQECIECGTVTTAPTEIDGDDCA |
| Ga0209354_100786143 | 3300027808 | Freshwater Lake | MMFKVTVMWDEETRAVGWYDLKQECIECGTLTTAPTEIDGDDCV |
| Ga0209990_101517314 | 3300027816 | Freshwater Lake | MACICGCLMFEITVMWDSETREVGWYDLRQKCKECGSESTAPTPI |
| Ga0209550_101295727 | 3300027892 | Freshwater Lake | ICGCLMFEITVMWDMETREVMWYDLAQKCKECGTITTAPTPMDWRDCE |
| Ga0209400_11033755 | 3300027963 | Freshwater Lake | MFVITVMWDEETRELSWYDLKQECKECKAISTAPTP |
| Ga0209401_11479123 | 3300027971 | Freshwater Lake | VMWDEQDRTVSWYDLKQECKECGAIATAPTEIDWKDE |
| Ga0209702_1000768121 | 3300027976 | Freshwater | MWDEETREVGWYDLSQKCKECGTITTAPTPMDWEDCD |
| Ga0209284_100057277 | 3300027983 | Freshwater | MFEITVMWDEETREVGWYDLSQKCKECGTITTAPTPMDWEDCD |
| Ga0247723_100052011 | 3300028025 | Deep Subsurface Sediment | MFKVTVMWDEDTRTVGWYDLAQECIECGTITTAPTEIDGCE |
| Ga0247723_100154520 | 3300028025 | Deep Subsurface Sediment | MFKVTVMWDEDTRAVGWYDLAQECIECGTVTTAPTEIDGDDCV |
| Ga0247723_10039886 | 3300028025 | Deep Subsurface Sediment | MWDEETRAVGWYDLTQECIECGTLTTAPTDIDGDDCV |
| Ga0247723_10041935 | 3300028025 | Deep Subsurface Sediment | MFEVTVMWDKETREVGWYDLSQKCKECGTITTAPTPMDWRDCE |
| Ga0247723_10123224 | 3300028025 | Deep Subsurface Sediment | MWDEDTRAVGWYDLAQECIECGTVTTAPTEIDGEDCV |
| Ga0247723_10480635 | 3300028025 | Deep Subsurface Sediment | GCLMFEITVMWDMEDRTVGWYDLRQKCKECGSLSTAPTPIDGEDNANL |
| Ga0247723_10634652 | 3300028025 | Deep Subsurface Sediment | MFVVTVMWDEETREVGWYDLKQECKECGAISTAPTPMDWRDE |
| Ga0304729_100361914 | 3300028392 | Freshwater Lake | MFQITVMWDEDTRAVGWYDLAQQCFECGTITTAPTEIDGCE |
| Ga0304729_10364084 | 3300028392 | Freshwater Lake | MFKVTVMWDEETRAVGWYDLKQECIECGTWTTAPTEIDGEDCA |
| Ga0304729_10379713 | 3300028392 | Freshwater Lake | MFKVTVMWDEETRAVGWYDLKQECIECGTWTTAPTEIDGCE |
| Ga0304729_10398967 | 3300028392 | Freshwater Lake | VICGCLMFEITVMWDQETREVTWYDLAQKCKDCGTITTAPTPMDWRDCE |
| Ga0304728_12350362 | 3300028393 | Freshwater Lake | MFKVTVMWDEETRAVGWYDLAQVCVECETVTTAPTEIDGEDCA |
| Ga0119945_10003871 | 3300029933 | Aquatic | MVCVCGSKMWNVTVMWDEETRAVGWYDLRQECKQCGAIATAPTEID |
| Ga0315291_102590353 | 3300031707 | Sediment | MFVITVMWDEETREVSWYDLKQECKECKAISTAPTPMDWRDE |
| Ga0315293_112114212 | 3300031746 | Sediment | MFEITVMWDMKTREVAWYDLAQKCKDCGTITTAPTPIDWMDCD |
| Ga0315907_105158351 | 3300031758 | Freshwater | ITVMWDREDRTIGWYDLKQKCKECGTLTTAPTPIDGEM |
| Ga0315907_105598672 | 3300031758 | Freshwater | KMWKITVMWDEESREVSWYDLRQECKSCGALATAPTPIDEEM |
| Ga0315288_106084864 | 3300031772 | Sediment | ACICGCLMFEITVMWDQETREVTWYDLAQKCKDCGTITTAPTPMDWRDCE |
| Ga0315909_101533611 | 3300031857 | Freshwater | CGSKMWIITVVWDEETRTVGWYDLRQECKLCGAIATAPTEID |
| Ga0315909_103312412 | 3300031857 | Freshwater | MWNITVMWDEEDRTIGWYDLRQECKECGAIATAPTEIDWKDE |
| Ga0315294_100918339 | 3300031952 | Sediment | FVITVMWDEETREVSWYDLKQECKECKAISTAPTPMDWRDE |
| Ga0315901_107045753 | 3300031963 | Freshwater | CGCMMFRITVMWDEDTRAVGWYDLAQECIECGTITTAPTEIDGCE |
| Ga0315906_110928111 | 3300032050 | Freshwater | VMWDEEDRTIGWYDLRQECKECGAIATAPTEIDWKDE |
| Ga0315905_100041312 | 3300032092 | Freshwater | MFVITVMWDDETREVSWYDLRQECKECGAISTAPTPIDWRDDA |
| Ga0315276_121196061 | 3300032177 | Sediment | ICGSKMFNITVMWDETTRTVGWYDLRQECRLCGAVTTAPTDIDGCD |
| Ga0334980_0345224_431_556 | 3300033816 | Freshwater | MFEITVMWDEEDRAVGWYDLTQKCKDCGSISTAPTPIDGEI |
| Ga0334994_0072831_20_151 | 3300033993 | Freshwater | MFVVTVMWDEETREVGWYDLKQECKECGAISTAPTPIDWKDDA |
| Ga0334994_0432495_485_616 | 3300033993 | Freshwater | MFEITVMWDWESREISWYDLAQKCKDCGTITTAPTPIDGRDCE |
| Ga0334979_0483523_14_145 | 3300033996 | Freshwater | MFKVIVMWDEETRAVGWYDLKQECIECGTLTTAPTEIDRDDCV |
| Ga0334986_0043808_1709_1837 | 3300034012 | Freshwater | MFVVTVMWDEETREVGWYDLKQECKACGAISTAPTPIDWRDE |
| Ga0334995_0191948_267_395 | 3300034062 | Freshwater | MWIVTVMWDEEDRTISWYDLKQECKECGAIATAPTEIDWKDE |
| Ga0334995_0687184_417_545 | 3300034062 | Freshwater | MFVVTVMWDEETREVGWYDLKQECKECGAISTAPTPIDWKDE |
| Ga0334990_0009071_4910_5041 | 3300034068 | Freshwater | MFKLTVMWDEETRAVGWYDLKQECIECGTLTTAPTEIDGDDCA |
| Ga0335010_0333530_635_766 | 3300034092 | Freshwater | MFKVIVMWDEKTRAVGWYDLKQECIECGTLTTAPTEIDGDDCA |
| Ga0335012_0112335_470_598 | 3300034093 | Freshwater | MWIVTVMWDEEDRTVGWYDLQQECKECGAIATAPTEIDWKDE |
| Ga0335027_0362576_481_609 | 3300034101 | Freshwater | MMFEVTVMWDEDTRAVGWYDLAQKCKDCGAISTAPTEIDGCE |
| Ga0335036_0321857_604_735 | 3300034106 | Freshwater | MFELTVMWDEESREVSWYDLAQKCKDCGTITTAPTPIDWMDCD |
| Ga0335053_0555424_527_667 | 3300034118 | Freshwater | CGCKMWIVTVMWDEEDRTIGWYDLRQECKECGAIATAPTEIDWKDE |
| Ga0335053_0761854_21_155 | 3300034118 | Freshwater | MMFKITVMWDEETRAVGWYDLKQECIECGTLTTAPTEIDGDDCA |
| Ga0335060_0004992_5005_5136 | 3300034122 | Freshwater | MFKVTVMWDEDTRAVGWYDLAQECIECGTVTTAPTEIDGDDCA |
| Ga0335061_0131287_439_570 | 3300034168 | Freshwater | MFKLTVMWDEETRAVGWYDLKQECIECGTLTTAPTEIDRDDCV |
| Ga0335007_0185090_896_1024 | 3300034283 | Freshwater | MFEITVMWDEDTRAVGWYDLTQKCKECGTLTTAPTEIDGCED |
| Ga0335007_0571424_3_137 | 3300034283 | Freshwater | LMFELTVMWDMETRELAWYDLAQKCKECGTITTAPTPIDWMDCD |
| Ga0335013_0572817_187_318 | 3300034284 | Freshwater | MFKVTVMWDEETRAVGWYDLKQECIECGTLTTAPTEIDRDDCV |
| ⦗Top⦘ |