| Basic Information | |
|---|---|
| Family ID | F030608 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 185 |
| Average Sequence Length | 42 residues |
| Representative Sequence | PDALHRLAAERALLSRELTMLRTLTATPAPDLRNSPYSSN |
| Number of Associated Samples | 149 |
| Number of Associated Scaffolds | 185 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 1.62 % |
| % of genes near scaffold ends (potentially truncated) | 98.38 % |
| % of genes from short scaffolds (< 2000 bps) | 92.43 % |
| Associated GOLD sequencing projects | 144 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.45 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (79.459 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (24.324 % of family members) |
| Environment Ontology (ENVO) | Unclassified (22.162 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (49.189 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 39.71% β-sheet: 0.00% Coil/Unstructured: 60.29% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.45 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 185 Family Scaffolds |
|---|---|---|
| PF03992 | ABM | 20.54 |
| PF04454 | Linocin_M18 | 10.81 |
| PF02146 | SIR2 | 9.73 |
| PF00106 | adh_short | 7.03 |
| PF14310 | Fn3-like | 4.32 |
| PF00583 | Acetyltransf_1 | 1.62 |
| PF03061 | 4HBT | 1.62 |
| PF09995 | MPAB_Lcp_cat | 1.08 |
| PF12872 | OST-HTH | 1.08 |
| PF12697 | Abhydrolase_6 | 1.08 |
| PF02678 | Pirin | 1.08 |
| PF00296 | Bac_luciferase | 1.08 |
| PF00144 | Beta-lactamase | 1.08 |
| PF06974 | WS_DGAT_C | 1.08 |
| PF13714 | PEP_mutase | 1.08 |
| PF01184 | Gpr1_Fun34_YaaH | 1.08 |
| PF01546 | Peptidase_M20 | 1.08 |
| PF02515 | CoA_transf_3 | 0.54 |
| PF03109 | ABC1 | 0.54 |
| PF08241 | Methyltransf_11 | 0.54 |
| PF03575 | Peptidase_S51 | 0.54 |
| PF04961 | FTCD_C | 0.54 |
| PF01061 | ABC2_membrane | 0.54 |
| PF02190 | LON_substr_bdg | 0.54 |
| PF06897 | DUF1269 | 0.54 |
| PF05726 | Pirin_C | 0.54 |
| PF00528 | BPD_transp_1 | 0.54 |
| PF01981 | PTH2 | 0.54 |
| PF04237 | YjbR | 0.54 |
| PF13006 | Nterm_IS4 | 0.54 |
| PF03176 | MMPL | 0.54 |
| PF13396 | PLDc_N | 0.54 |
| PF02566 | OsmC | 0.54 |
| PF14344 | DUF4397 | 0.54 |
| PF00909 | Ammonium_transp | 0.54 |
| PF04542 | Sigma70_r2 | 0.54 |
| COG ID | Name | Functional Category | % Frequency in 185 Family Scaffolds |
|---|---|---|---|
| COG0846 | NAD-dependent protein deacetylase, SIR2 family | Posttranslational modification, protein turnover, chaperones [O] | 9.73 |
| COG1741 | Redox-sensitive bicupin YhaK, pirin superfamily | General function prediction only [R] | 1.62 |
| COG1584 | Succinate-acetate transporter SatP | Energy production and conversion [C] | 1.08 |
| COG2367 | Beta-lactamase class A | Defense mechanisms [V] | 1.08 |
| COG1680 | CubicO group peptidase, beta-lactamase class C family | Defense mechanisms [V] | 1.08 |
| COG1686 | D-alanyl-D-alanine carboxypeptidase | Cell wall/membrane/envelope biogenesis [M] | 1.08 |
| COG2141 | Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase) | Coenzyme transport and metabolism [H] | 1.08 |
| COG1764 | Organic hydroperoxide reductase OsmC/OhrA | Defense mechanisms [V] | 0.54 |
| COG4941 | Predicted RNA polymerase sigma factor, contains C-terminal TPR domain | Transcription [K] | 0.54 |
| COG4803 | Uncharacterized membrane protein | Function unknown [S] | 0.54 |
| COG3404 | Formiminotetrahydrofolate cyclodeaminase | Amino acid transport and metabolism [E] | 0.54 |
| COG2409 | Predicted lipid transporter YdfJ, MMPL/SSD domain, RND superfamily | General function prediction only [R] | 0.54 |
| COG2315 | Predicted DNA-binding protein with ‘double-wing’ structural motif, MmcQ/YjbR family | Transcription [K] | 0.54 |
| COG1990 | Peptidyl-tRNA hydrolase | Translation, ribosomal structure and biogenesis [J] | 0.54 |
| COG1804 | Crotonobetainyl-CoA:carnitine CoA-transferase CaiB and related acyl-CoA transferases | Lipid transport and metabolism [I] | 0.54 |
| COG1765 | Uncharacterized OsmC-related protein | General function prediction only [R] | 0.54 |
| COG0004 | Ammonia channel protein AmtB | Inorganic ion transport and metabolism [P] | 0.54 |
| COG1595 | DNA-directed RNA polymerase specialized sigma subunit, sigma24 family | Transcription [K] | 0.54 |
| COG1191 | DNA-directed RNA polymerase specialized sigma subunit | Transcription [K] | 0.54 |
| COG1033 | Predicted exporter protein, RND superfamily | General function prediction only [R] | 0.54 |
| COG0661 | Predicted protein kinase regulating ubiquinone biosynthesis, AarF/ABC1/UbiB family | Signal transduction mechanisms [T] | 0.54 |
| COG0568 | DNA-directed RNA polymerase, sigma subunit (sigma70/sigma32) | Transcription [K] | 0.54 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 79.46 % |
| Unclassified | root | N/A | 20.54 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000364|INPhiseqgaiiFebDRAFT_104907935 | All Organisms → cellular organisms → Bacteria | 508 | Open in IMG/M |
| 3300001384|JGI20190J14840_1007445 | All Organisms → cellular organisms → Bacteria | 1109 | Open in IMG/M |
| 3300001384|JGI20190J14840_1018945 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 584 | Open in IMG/M |
| 3300001408|JGI20206J14855_1061068 | All Organisms → cellular organisms → Bacteria | 536 | Open in IMG/M |
| 3300004092|Ga0062389_100711142 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1179 | Open in IMG/M |
| 3300005332|Ga0066388_103948959 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 756 | Open in IMG/M |
| 3300005434|Ga0070709_10422656 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 999 | Open in IMG/M |
| 3300005440|Ga0070705_100565948 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 874 | Open in IMG/M |
| 3300005518|Ga0070699_100205924 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1750 | Open in IMG/M |
| 3300005556|Ga0066707_10756840 | Not Available | 604 | Open in IMG/M |
| 3300005575|Ga0066702_10474926 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 764 | Open in IMG/M |
| 3300005764|Ga0066903_103694030 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 823 | Open in IMG/M |
| 3300005764|Ga0066903_109146898 | Not Available | 500 | Open in IMG/M |
| 3300005994|Ga0066789_10048411 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1865 | Open in IMG/M |
| 3300005995|Ga0066790_10207580 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 837 | Open in IMG/M |
| 3300006028|Ga0070717_11100805 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura | 723 | Open in IMG/M |
| 3300006755|Ga0079222_11029155 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 712 | Open in IMG/M |
| 3300006804|Ga0079221_10242279 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1019 | Open in IMG/M |
| 3300006806|Ga0079220_11582539 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 567 | Open in IMG/M |
| 3300006881|Ga0068865_102091249 | Not Available | 515 | Open in IMG/M |
| 3300006954|Ga0079219_11859866 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 566 | Open in IMG/M |
| 3300009029|Ga0066793_10023493 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 3378 | Open in IMG/M |
| 3300009525|Ga0116220_10078242 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1391 | Open in IMG/M |
| 3300009623|Ga0116133_1079512 | All Organisms → cellular organisms → Bacteria | 823 | Open in IMG/M |
| 3300009698|Ga0116216_10583344 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 674 | Open in IMG/M |
| 3300010046|Ga0126384_10752774 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 868 | Open in IMG/M |
| 3300010048|Ga0126373_12744408 | Not Available | 550 | Open in IMG/M |
| 3300010048|Ga0126373_12998198 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 526 | Open in IMG/M |
| 3300010358|Ga0126370_10582481 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 962 | Open in IMG/M |
| 3300010358|Ga0126370_10732152 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 873 | Open in IMG/M |
| 3300010358|Ga0126370_11195979 | Not Available | 706 | Open in IMG/M |
| 3300010359|Ga0126376_11368126 | All Organisms → cellular organisms → Bacteria | 731 | Open in IMG/M |
| 3300010360|Ga0126372_12999837 | Not Available | 523 | Open in IMG/M |
| 3300010361|Ga0126378_11042805 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 920 | Open in IMG/M |
| 3300010361|Ga0126378_11267401 | All Organisms → cellular organisms → Bacteria | 833 | Open in IMG/M |
| 3300010361|Ga0126378_12383613 | All Organisms → cellular organisms → Bacteria | 604 | Open in IMG/M |
| 3300010361|Ga0126378_13025784 | Not Available | 536 | Open in IMG/M |
| 3300010366|Ga0126379_11593743 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 758 | Open in IMG/M |
| 3300010376|Ga0126381_100150870 | All Organisms → cellular organisms → Bacteria | 3051 | Open in IMG/M |
| 3300010376|Ga0126381_100627676 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1531 | Open in IMG/M |
| 3300010376|Ga0126381_103384813 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 628 | Open in IMG/M |
| 3300010379|Ga0136449_101713160 | Not Available | 946 | Open in IMG/M |
| 3300010379|Ga0136449_101838081 | Not Available | 904 | Open in IMG/M |
| 3300010379|Ga0136449_103389774 | Not Available | 610 | Open in IMG/M |
| 3300010396|Ga0134126_10988656 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae | 943 | Open in IMG/M |
| 3300010398|Ga0126383_12919644 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 558 | Open in IMG/M |
| 3300010866|Ga0126344_1074729 | All Organisms → cellular organisms → Bacteria | 905 | Open in IMG/M |
| 3300011271|Ga0137393_10000106 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 43175 | Open in IMG/M |
| 3300012189|Ga0137388_10075463 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2824 | Open in IMG/M |
| 3300012189|Ga0137388_10376478 | All Organisms → cellular organisms → Bacteria | 1312 | Open in IMG/M |
| 3300012350|Ga0137372_10161671 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1820 | Open in IMG/M |
| 3300012971|Ga0126369_11982207 | Not Available | 670 | Open in IMG/M |
| 3300014495|Ga0182015_10553510 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 732 | Open in IMG/M |
| 3300014968|Ga0157379_10677579 | All Organisms → cellular organisms → Bacteria | 967 | Open in IMG/M |
| 3300015242|Ga0137412_10705758 | Not Available | 750 | Open in IMG/M |
| 3300016341|Ga0182035_10292385 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1333 | Open in IMG/M |
| 3300016341|Ga0182035_11005847 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 739 | Open in IMG/M |
| 3300016404|Ga0182037_11835310 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 542 | Open in IMG/M |
| 3300016404|Ga0182037_11924530 | Not Available | 530 | Open in IMG/M |
| 3300017924|Ga0187820_1085850 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 890 | Open in IMG/M |
| 3300017932|Ga0187814_10076830 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1226 | Open in IMG/M |
| 3300017943|Ga0187819_10207101 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1156 | Open in IMG/M |
| 3300017946|Ga0187879_10104979 | All Organisms → cellular organisms → Bacteria | 1618 | Open in IMG/M |
| 3300017946|Ga0187879_10651132 | Not Available | 586 | Open in IMG/M |
| 3300017970|Ga0187783_10200855 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae → Xanthomonas → Xanthomonas massiliensis | 1464 | Open in IMG/M |
| 3300017995|Ga0187816_10433021 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 587 | Open in IMG/M |
| 3300018008|Ga0187888_1386738 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 529 | Open in IMG/M |
| 3300018025|Ga0187885_10078665 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1632 | Open in IMG/M |
| 3300018044|Ga0187890_10044434 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2662 | Open in IMG/M |
| 3300018060|Ga0187765_10485668 | Not Available | 779 | Open in IMG/M |
| 3300018060|Ga0187765_11330383 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 510 | Open in IMG/M |
| 3300019260|Ga0181506_1014861 | Not Available | 559 | Open in IMG/M |
| 3300019890|Ga0193728_1027718 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2822 | Open in IMG/M |
| 3300019890|Ga0193728_1116013 | All Organisms → cellular organisms → Bacteria | 1219 | Open in IMG/M |
| 3300020002|Ga0193730_1181009 | Not Available | 531 | Open in IMG/M |
| 3300021362|Ga0213882_10252210 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 732 | Open in IMG/M |
| 3300021401|Ga0210393_10466330 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1031 | Open in IMG/M |
| 3300021401|Ga0210393_11577971 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 521 | Open in IMG/M |
| 3300021402|Ga0210385_11017258 | All Organisms → cellular organisms → Bacteria | 637 | Open in IMG/M |
| 3300021402|Ga0210385_11342318 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 547 | Open in IMG/M |
| 3300021404|Ga0210389_10343921 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1171 | Open in IMG/M |
| 3300021406|Ga0210386_10652929 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 908 | Open in IMG/M |
| 3300021406|Ga0210386_11497089 | All Organisms → cellular organisms → Bacteria | 563 | Open in IMG/M |
| 3300021474|Ga0210390_10644147 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 886 | Open in IMG/M |
| 3300021475|Ga0210392_10384267 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 1021 | Open in IMG/M |
| 3300021478|Ga0210402_11094397 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 724 | Open in IMG/M |
| 3300021560|Ga0126371_10581663 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1269 | Open in IMG/M |
| 3300021560|Ga0126371_12596623 | All Organisms → cellular organisms → Bacteria | 614 | Open in IMG/M |
| 3300021560|Ga0126371_12830344 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 588 | Open in IMG/M |
| 3300022724|Ga0242665_10188479 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 673 | Open in IMG/M |
| 3300024288|Ga0179589_10374007 | All Organisms → cellular organisms → Bacteria | 650 | Open in IMG/M |
| 3300025134|Ga0207416_1014195 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 4646 | Open in IMG/M |
| 3300025474|Ga0208479_1030227 | All Organisms → cellular organisms → Bacteria | 1128 | Open in IMG/M |
| 3300025527|Ga0208714_1054942 | All Organisms → cellular organisms → Bacteria | 855 | Open in IMG/M |
| 3300025588|Ga0208586_1024475 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1442 | Open in IMG/M |
| 3300025625|Ga0208219_1024976 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1697 | Open in IMG/M |
| 3300025627|Ga0208220_1067155 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1015 | Open in IMG/M |
| 3300025633|Ga0208480_1120578 | All Organisms → cellular organisms → Bacteria | 611 | Open in IMG/M |
| 3300025898|Ga0207692_10924111 | Not Available | 574 | Open in IMG/M |
| 3300025910|Ga0207684_10025987 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 4990 | Open in IMG/M |
| 3300025915|Ga0207693_11202202 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 571 | Open in IMG/M |
| 3300025916|Ga0207663_10913325 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 702 | Open in IMG/M |
| 3300025924|Ga0207694_10390091 | All Organisms → cellular organisms → Bacteria | 1157 | Open in IMG/M |
| 3300025928|Ga0207700_11194120 | Not Available | 679 | Open in IMG/M |
| 3300025982|Ga0208139_1023144 | Not Available | 687 | Open in IMG/M |
| 3300026041|Ga0207639_12136035 | Not Available | 521 | Open in IMG/M |
| 3300027002|Ga0209110_1008917 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1114 | Open in IMG/M |
| 3300027568|Ga0208042_1049518 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 1075 | Open in IMG/M |
| 3300027619|Ga0209330_1131484 | Not Available | 567 | Open in IMG/M |
| 3300027654|Ga0209799_1001908 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 4098 | Open in IMG/M |
| 3300027692|Ga0209530_1046644 | All Organisms → cellular organisms → Bacteria | 1273 | Open in IMG/M |
| 3300027696|Ga0208696_1069505 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1201 | Open in IMG/M |
| 3300027725|Ga0209178_1105676 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 944 | Open in IMG/M |
| 3300027817|Ga0209112_10115053 | Not Available | 879 | Open in IMG/M |
| 3300027882|Ga0209590_10169766 | All Organisms → cellular organisms → Bacteria | 1364 | Open in IMG/M |
| 3300027882|Ga0209590_10594058 | Not Available | 712 | Open in IMG/M |
| 3300027884|Ga0209275_10020122 | All Organisms → cellular organisms → Bacteria | 2976 | Open in IMG/M |
| 3300028807|Ga0307305_10410355 | Not Available | 612 | Open in IMG/M |
| 3300028877|Ga0302235_10449018 | Not Available | 549 | Open in IMG/M |
| 3300028906|Ga0308309_10474235 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinoallomurus | 1080 | Open in IMG/M |
| 3300028906|Ga0308309_10919193 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 759 | Open in IMG/M |
| 3300029943|Ga0311340_10570749 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 995 | Open in IMG/M |
| 3300029943|Ga0311340_11259020 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 592 | Open in IMG/M |
| 3300029943|Ga0311340_11599378 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae | 506 | Open in IMG/M |
| 3300030520|Ga0311372_10310729 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 2478 | Open in IMG/M |
| 3300030580|Ga0311355_10414599 | Not Available | 1314 | Open in IMG/M |
| 3300030738|Ga0265462_11898971 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 575 | Open in IMG/M |
| 3300031236|Ga0302324_102513601 | Not Available | 628 | Open in IMG/M |
| 3300031474|Ga0170818_112147754 | Not Available | 634 | Open in IMG/M |
| 3300031525|Ga0302326_10529379 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1776 | Open in IMG/M |
| 3300031525|Ga0302326_10891627 | Not Available | 1266 | Open in IMG/M |
| 3300031544|Ga0318534_10667924 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 588 | Open in IMG/M |
| 3300031549|Ga0318571_10021442 | All Organisms → cellular organisms → Bacteria | 1697 | Open in IMG/M |
| 3300031549|Ga0318571_10268458 | Not Available | 632 | Open in IMG/M |
| 3300031564|Ga0318573_10058564 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1898 | Open in IMG/M |
| 3300031572|Ga0318515_10256671 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 937 | Open in IMG/M |
| 3300031572|Ga0318515_10708585 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 532 | Open in IMG/M |
| 3300031573|Ga0310915_10193193 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Micromonospora | 1421 | Open in IMG/M |
| 3300031573|Ga0310915_10515521 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 849 | Open in IMG/M |
| 3300031668|Ga0318542_10547353 | Not Available | 603 | Open in IMG/M |
| 3300031669|Ga0307375_10807240 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 529 | Open in IMG/M |
| 3300031681|Ga0318572_10660214 | Not Available | 623 | Open in IMG/M |
| 3300031708|Ga0310686_103462710 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 515 | Open in IMG/M |
| 3300031719|Ga0306917_10374507 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1109 | Open in IMG/M |
| 3300031723|Ga0318493_10369879 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 781 | Open in IMG/M |
| 3300031724|Ga0318500_10429961 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 659 | Open in IMG/M |
| 3300031736|Ga0318501_10730674 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 546 | Open in IMG/M |
| 3300031744|Ga0306918_10113257 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1952 | Open in IMG/M |
| 3300031744|Ga0306918_10506675 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 945 | Open in IMG/M |
| 3300031747|Ga0318502_10845728 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 555 | Open in IMG/M |
| 3300031765|Ga0318554_10427250 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 751 | Open in IMG/M |
| 3300031771|Ga0318546_11314422 | Not Available | 508 | Open in IMG/M |
| 3300031782|Ga0318552_10017400 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3129 | Open in IMG/M |
| 3300031782|Ga0318552_10104725 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Micromonospora | 1398 | Open in IMG/M |
| 3300031788|Ga0302319_11089728 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 750 | Open in IMG/M |
| 3300031795|Ga0318557_10377783 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 651 | Open in IMG/M |
| 3300031796|Ga0318576_10429615 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 624 | Open in IMG/M |
| 3300031797|Ga0318550_10078651 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Micromonospora | 1528 | Open in IMG/M |
| 3300031831|Ga0318564_10393943 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 606 | Open in IMG/M |
| 3300031845|Ga0318511_10261742 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 777 | Open in IMG/M |
| 3300031860|Ga0318495_10055769 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1753 | Open in IMG/M |
| 3300031941|Ga0310912_10174917 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1632 | Open in IMG/M |
| 3300031947|Ga0310909_11100115 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 646 | Open in IMG/M |
| 3300032001|Ga0306922_10824101 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 969 | Open in IMG/M |
| 3300032008|Ga0318562_10338909 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 874 | Open in IMG/M |
| 3300032043|Ga0318556_10632160 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 558 | Open in IMG/M |
| 3300032054|Ga0318570_10130994 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1113 | Open in IMG/M |
| 3300032055|Ga0318575_10239200 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 915 | Open in IMG/M |
| 3300032059|Ga0318533_10714083 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 736 | Open in IMG/M |
| 3300032064|Ga0318510_10519796 | Not Available | 517 | Open in IMG/M |
| 3300032066|Ga0318514_10135474 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1270 | Open in IMG/M |
| 3300032074|Ga0308173_11966976 | Not Available | 551 | Open in IMG/M |
| 3300032160|Ga0311301_10255262 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2883 | Open in IMG/M |
| 3300032160|Ga0311301_11270656 | Not Available | 934 | Open in IMG/M |
| 3300032180|Ga0307471_101597351 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 808 | Open in IMG/M |
| 3300032180|Ga0307471_102959790 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 603 | Open in IMG/M |
| 3300032205|Ga0307472_102762575 | All Organisms → cellular organisms → Bacteria | 502 | Open in IMG/M |
| 3300032783|Ga0335079_12281203 | Not Available | 514 | Open in IMG/M |
| 3300032805|Ga0335078_12391440 | All Organisms → cellular organisms → Bacteria | 549 | Open in IMG/M |
| 3300032828|Ga0335080_10466475 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1345 | Open in IMG/M |
| 3300032828|Ga0335080_12300126 | All Organisms → cellular organisms → Bacteria | 516 | Open in IMG/M |
| 3300032892|Ga0335081_10091567 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 4558 | Open in IMG/M |
| 3300032896|Ga0335075_10670299 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1005 | Open in IMG/M |
| 3300033134|Ga0335073_12126329 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 507 | Open in IMG/M |
| 3300033828|Ga0334850_014558 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1473 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 24.32% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 11.35% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 4.86% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 4.86% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 4.86% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 4.86% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 4.32% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 4.32% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 3.78% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 3.24% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.70% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 2.70% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 2.16% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 2.16% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 2.16% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 1.62% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.62% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 1.62% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 1.62% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 1.08% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 0.54% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 0.54% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 0.54% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.54% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.54% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.54% |
| Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 0.54% |
| Prmafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Prmafrost Soil | 0.54% |
| Palsa | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa | 0.54% |
| Soil | Environmental → Terrestrial → Soil → Clay → Unclassified → Soil | 0.54% |
| Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 0.54% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 0.54% |
| Exposed Rock | Environmental → Terrestrial → Rock-Dwelling (Subaerial Biofilms) → Unclassified → Unclassified → Exposed Rock | 0.54% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.54% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.54% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.54% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.54% |
| Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 0.54% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300001384 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 53-3 shallow-072012 | Environmental | Open in IMG/M |
| 3300001408 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample F52-2 deep-092012 | Environmental | Open in IMG/M |
| 3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
| 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Environmental | Open in IMG/M |
| 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
| 3300005556 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 | Environmental | Open in IMG/M |
| 3300005575 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005994 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-049 | Environmental | Open in IMG/M |
| 3300005995 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-050 | Environmental | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
| 3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
| 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Host-Associated | Open in IMG/M |
| 3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
| 3300009029 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 1 DNA2013-189 | Environmental | Open in IMG/M |
| 3300009525 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_7_NC metaG | Environmental | Open in IMG/M |
| 3300009623 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_19_10 | Environmental | Open in IMG/M |
| 3300009698 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300010866 | Boreal forest soil eukaryotic communities from Alaska, USA - C1-3 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012350 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300014495 | Permafrost microbial communities from Stordalen Mire, Sweden - 712P3M metaG | Environmental | Open in IMG/M |
| 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Host-Associated | Open in IMG/M |
| 3300015242 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300017924 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_5 | Environmental | Open in IMG/M |
| 3300017932 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_4 | Environmental | Open in IMG/M |
| 3300017943 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4 | Environmental | Open in IMG/M |
| 3300017946 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_10 | Environmental | Open in IMG/M |
| 3300017970 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300017995 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_1 | Environmental | Open in IMG/M |
| 3300018008 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_40 | Environmental | Open in IMG/M |
| 3300018025 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_100 | Environmental | Open in IMG/M |
| 3300018044 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_21_10 | Environmental | Open in IMG/M |
| 3300018060 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MG | Environmental | Open in IMG/M |
| 3300019260 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_10_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019890 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1c1 | Environmental | Open in IMG/M |
| 3300020002 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1a1 | Environmental | Open in IMG/M |
| 3300021362 | Barbacenia macrantha exposed rock microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - ER_R09 | Environmental | Open in IMG/M |
| 3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
| 3300021402 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-O | Environmental | Open in IMG/M |
| 3300021404 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O | Environmental | Open in IMG/M |
| 3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
| 3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
| 3300021475 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-O | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300022724 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-17-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300024288 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300025134 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPM 11 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025474 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 415-3 deep-072012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025527 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 415-1 shallow-072012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025588 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 53-3 shallow-072012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025625 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 53-2 shallow-072012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025627 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample F53-1 deep-092012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025633 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample F53-1 shallow-092012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025982 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_5C_0N_105 (SPAdes) | Environmental | Open in IMG/M |
| 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027002 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM2H0_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027568 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_7_NC metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027619 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027654 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 MoBio (SPAdes) | Environmental | Open in IMG/M |
| 3300027692 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027696 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_b_LC metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027725 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 (SPAdes) | Environmental | Open in IMG/M |
| 3300027817 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM3H0_O3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027884 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes) | Environmental | Open in IMG/M |
| 3300028807 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_186 | Environmental | Open in IMG/M |
| 3300028877 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N3_3 | Environmental | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300029943 | I_Palsa_N3 coassembly | Environmental | Open in IMG/M |
| 3300030520 | III_Palsa_N2 coassembly | Environmental | Open in IMG/M |
| 3300030580 | II_Palsa_N1 coassembly | Environmental | Open in IMG/M |
| 3300030738 | Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada VDE Co-assembly | Environmental | Open in IMG/M |
| 3300031236 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1 | Environmental | Open in IMG/M |
| 3300031474 | Fir Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031525 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_3 | Environmental | Open in IMG/M |
| 3300031544 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26 | Environmental | Open in IMG/M |
| 3300031549 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f24 | Environmental | Open in IMG/M |
| 3300031564 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21 | Environmental | Open in IMG/M |
| 3300031572 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19 | Environmental | Open in IMG/M |
| 3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
| 3300031668 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f23 | Environmental | Open in IMG/M |
| 3300031669 | Soil microbial communities from Risofladan, Vaasa, Finland - TR-1 | Environmental | Open in IMG/M |
| 3300031681 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20 | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
| 3300031723 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f23 | Environmental | Open in IMG/M |
| 3300031724 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f20 | Environmental | Open in IMG/M |
| 3300031736 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f21 | Environmental | Open in IMG/M |
| 3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
| 3300031747 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22 | Environmental | Open in IMG/M |
| 3300031765 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22 | Environmental | Open in IMG/M |
| 3300031771 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19 | Environmental | Open in IMG/M |
| 3300031782 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f20 | Environmental | Open in IMG/M |
| 3300031788 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Bog_T0_2 | Environmental | Open in IMG/M |
| 3300031795 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f19 | Environmental | Open in IMG/M |
| 3300031796 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f24 | Environmental | Open in IMG/M |
| 3300031797 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f23 | Environmental | Open in IMG/M |
| 3300031831 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f20 | Environmental | Open in IMG/M |
| 3300031845 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f18 | Environmental | Open in IMG/M |
| 3300031860 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f25 | Environmental | Open in IMG/M |
| 3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
| 3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
| 3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
| 3300032008 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f18 | Environmental | Open in IMG/M |
| 3300032043 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f24 | Environmental | Open in IMG/M |
| 3300032054 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f23 | Environmental | Open in IMG/M |
| 3300032055 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f23 | Environmental | Open in IMG/M |
| 3300032059 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27 | Environmental | Open in IMG/M |
| 3300032064 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f17 | Environmental | Open in IMG/M |
| 3300032066 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f18 | Environmental | Open in IMG/M |
| 3300032074 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R1 | Environmental | Open in IMG/M |
| 3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
| 3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
| 3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
| 3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
| 3300032896 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.4 | Environmental | Open in IMG/M |
| 3300033134 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.2 | Environmental | Open in IMG/M |
| 3300033828 | Peat soil microbial communities from Stordalen Mire, Sweden - 715 P1 1-5 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| INPhiseqgaiiFebDRAFT_1049079352 | 3300000364 | Soil | LAAERALLAREITMLRSLTATPAPEFRNTPYSPN* |
| JGI20190J14840_10074452 | 3300001384 | Arctic Peat Soil | AEPDAERRLGAERALLARETTMLRSLTATPAPDLRNTPYNPN* |
| JGI20190J14840_10189452 | 3300001384 | Arctic Peat Soil | PVRQQLLAEPDAERRLGAERALLARETTMLRSLTATPAPDLRNTPYNPN* |
| JGI20206J14855_10610682 | 3300001408 | Arctic Peat Soil | DAERRLGAERTLLARETTMLRSLTATPAPDLRNTPYNPN* |
| Ga0062389_1007111421 | 3300004092 | Bog Forest Soil | ESDTLRRLARQRALLSRETAMLRTTTSRPAPDLRNTPYSPN* |
| Ga0066388_1039489591 | 3300005332 | Tropical Forest Soil | RDKQALLAEPDALHRLVTERMLLSRETTMLRTLTATPAPDLRNSPYSSN* |
| Ga0070709_104226563 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | DLSDRQTLLAEPDALHRLVTERMLLSRETTMLRTLTATPAPDLRNSPYSSN* |
| Ga0070705_1005659481 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | LAESDTLRRMAMQRALLSRETAMLRTTISRPAPDLRNTPYSPN* |
| Ga0070699_1002059241 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | IDLRDKQALLAEPDALHRLATERVLLSRETTMLRTLTAAPAPDLRNSPYSSN* |
| Ga0066707_107568401 | 3300005556 | Soil | SDTLRRLAMQRALLSRETAMLRTTTSRPVPDLRNTPYSPN* |
| Ga0066702_104749261 | 3300005575 | Soil | EPDTLRRLAMQRVLLSREAAMLRTTTSRPAPDLRNTPYSPN* |
| Ga0066903_1036940302 | 3300005764 | Tropical Forest Soil | DTVRRMAMQRALLSRETAMLRTTTSRPVPDLRNTPYSPN* |
| Ga0066903_1091468981 | 3300005764 | Tropical Forest Soil | HRLTAERALLSRELTMLRTLTATPAPDLRNSPYSSN* |
| Ga0066789_100484112 | 3300005994 | Soil | DSLSRLAAERALLQRETTMLRTLTARPAPDLRYAPYNPN* |
| Ga0066790_102075802 | 3300005995 | Soil | LGDQQALLAEPDAAARLAAERALLSRETTMLHSLTSTPAPDLRYSPYNPN* |
| Ga0070717_111008051 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | DAERRLGAERALLARETTMLRSLTAMPAPDLRNTPYHPN* |
| Ga0079222_110291553 | 3300006755 | Agricultural Soil | LAEPDALHRLAAERALLSRELTMLRTLTATPAPDLRNSPYSSN* |
| Ga0079221_102422791 | 3300006804 | Agricultural Soil | QALLAEPDALHRLAAERVLLSRELTMLRTLTATPAPDLRNSPYSSN* |
| Ga0079220_115825391 | 3300006806 | Agricultural Soil | IDLRDKQALLAEPDALHRLVTERMLLSRETTMLRTLTATPAPDLRNSPYSSN* |
| Ga0068865_1020912492 | 3300006881 | Miscanthus Rhizosphere | LRRLAMQRVLLSRETAMLRTTTSRPAPDLRNTPYSPN* |
| Ga0079219_118598661 | 3300006954 | Agricultural Soil | ASMIIDFSDRQTLLAEPDALHRLAAERSLLSRELTMLRTLTATPAPDLRNSPYSSN* |
| Ga0066793_100234931 | 3300009029 | Prmafrost Soil | IMDRPDKQALLAEPDALHRLLAERALLSRETMMLRSLTSTPAPDLRNSPYSSN* |
| Ga0116220_100782423 | 3300009525 | Peatlands Soil | LLAESGTVRRLALQRALLSRETAMLRTTTSRPAPDLRNTPYNPN* |
| Ga0116133_10795121 | 3300009623 | Peatland | LGAERALLARETTMLRSLTATPAPDLRNTPYNPN* |
| Ga0116216_105833441 | 3300009698 | Peatlands Soil | RLALQRALLSRETAMLRTTTSRPAPDLRHTPYSPN* |
| Ga0126384_107527743 | 3300010046 | Tropical Forest Soil | LAEPDALHRLAAERSLLSRELTMLRTLTATPAPDLRNSPYSSN* |
| Ga0126373_127444082 | 3300010048 | Tropical Forest Soil | LLEKPDAAQRLAAEHELLTRETAMLRSLTAAPAPELRYHPYSPN* |
| Ga0126373_129981981 | 3300010048 | Tropical Forest Soil | HHRLQAERRLLAHEMQMLRSLTATPAPDLRYSPYSQN* |
| Ga0126370_105824813 | 3300010358 | Tropical Forest Soil | TLLAEPNALHRLAAERALLSRELTMLRTLTATPAPDLRNSPYSSN* |
| Ga0126370_107321521 | 3300010358 | Tropical Forest Soil | MIMDLSDRQILLAEPDALHRLMAERALLSRELTMLRTLTATPAPDLRNTPYSAN* |
| Ga0126370_111959792 | 3300010358 | Tropical Forest Soil | LPVRQQLLAEPNAAARLKTERALLTKEQRILRSLTATPAPDLLNSPFSQN* |
| Ga0126376_113681263 | 3300010359 | Tropical Forest Soil | AAVVLDLPVRQQLLAEPNAAARLKTERALLTKEQQILRSLTATPAPDLLNSPFSQN* |
| Ga0126372_129998372 | 3300010360 | Tropical Forest Soil | LRRLAAERVLLSRETAMLRTTTSRPAPDLRNTPYNPN* |
| Ga0126378_110428051 | 3300010361 | Tropical Forest Soil | HRLATQRALLSRETAMLRTTTSRPVPDLRNTPYSPN* |
| Ga0126378_112674011 | 3300010361 | Tropical Forest Soil | PDALHRLVTERMLLSKETTMLRTLTATPAPDLRNSPYSSN* |
| Ga0126378_123836131 | 3300010361 | Tropical Forest Soil | PVRQQLLAEPNAAARLKTERALLTKEQQILRSLTATPAPDLLNSPFSQN* |
| Ga0126378_130257841 | 3300010361 | Tropical Forest Soil | LRDKQALLAEPDALHRLVTERMLLSRETTMLRTLTATPAPDLRNSPYSSN* |
| Ga0126379_115937432 | 3300010366 | Tropical Forest Soil | WLAADRILLTREIRITRELTTTPAPDLRYAPYSQN* |
| Ga0126381_1001508704 | 3300010376 | Tropical Forest Soil | KQQLLEESDAHHRLQAERRLLAHEMQMLRSLTATPAPDLRYSPYSQN* |
| Ga0126381_1006276761 | 3300010376 | Tropical Forest Soil | HRLAAERALLSRETAMLRTTTSRPAPDLRNTPYNPN* |
| Ga0126381_1033848131 | 3300010376 | Tropical Forest Soil | MVIDLRDKQALLAEPDALHRLVTERMLLSKETTMLRTLTATPAPDLRNSPYSSN* |
| Ga0136449_1017131601 | 3300010379 | Peatlands Soil | EPDSLSRLNAERAMLQRETTMLRTLTARPAPDLRHAPYNPN* |
| Ga0136449_1018380813 | 3300010379 | Peatlands Soil | DEPDAARRLAAERALLAREMQLLRSLTAAPAPGLRYSPYSQN* |
| Ga0136449_1033897742 | 3300010379 | Peatlands Soil | RRLALQRALLSRETAMLRTTTSRPAPDLRHTPYSPN* |
| Ga0134126_109886561 | 3300010396 | Terrestrial Soil | LRRLARERSLLSRETAMLRTTTSRPAPDLRNTPYSPN* |
| Ga0126383_129196442 | 3300010398 | Tropical Forest Soil | AEPDALHRLVTERMLLSRETTMLRTLTATPAPDLRNSPYSSN* |
| Ga0126344_10747292 | 3300010866 | Boreal Forest Soil | QQLLAEPDAERRLGAERALLARETTMLRSLTATPAPDLRNTPYNPN* |
| Ga0137393_1000010637 | 3300011271 | Vadose Zone Soil | MSALPDAASRLTAERALLSRETTMLRSLTSTPAPDLRYSPYNPN* |
| Ga0137388_100754631 | 3300012189 | Vadose Zone Soil | KIIELSDRQTLLAEPDALHRLAAERALLSRELTMLRTLTATPAPDLRNSPYSSS* |
| Ga0137388_103764783 | 3300012189 | Vadose Zone Soil | RLAMQRALLSRETAMLRTTTSRPVPDLRNTPYSPN* |
| Ga0137372_101616711 | 3300012350 | Vadose Zone Soil | ASRLAAERALLARETSMLRSLTSTPAPDLRYTPYNPN* |
| Ga0126369_119822071 | 3300012971 | Tropical Forest Soil | VRRMAMQRALLSRETAMLRTTTSRPAPDLRNTPYSPN* |
| Ga0182015_105535102 | 3300014495 | Palsa | TLRRLSLQRALLSRETAMLRSTTSRPAPDLRNTPYNPN* |
| Ga0157379_106775791 | 3300014968 | Switchgrass Rhizosphere | DALHRLTAERALLTRETTMLRSLTATPAPEFRNTPYNPN* |
| Ga0137412_107057581 | 3300015242 | Vadose Zone Soil | LAPTPWRDLERRLGAERALLARETTMLRSLTATPAPDLRNTPYNPN* |
| Ga0182035_102923853 | 3300016341 | Soil | DTLRRLAMQRALLSRETAMLRTTTSRPVPDLRNTPYSPN |
| Ga0182035_110058471 | 3300016341 | Soil | DALHRLAAERSLLSRELTMLRTLTATPAPDLRNSPYSSN |
| Ga0182037_118353101 | 3300016404 | Soil | RLVAERSLLSRELTMLRTLTATPAPDLRNSPYSSN |
| Ga0182037_119245301 | 3300016404 | Soil | LRRLAAERVLLLREAAMLRATTSRPAPDLRYTPYNPN |
| Ga0187820_10858502 | 3300017924 | Freshwater Sediment | PDARRRLAAERTLLSREIRMTRSLTTTPAPDLRYAPYSQN |
| Ga0187814_100768301 | 3300017932 | Freshwater Sediment | LRDKQALLAEPDALHRLVTERMLLSRETTMLRTLTATPAPDLRNSPYSSN |
| Ga0187819_102071011 | 3300017943 | Freshwater Sediment | VDLPLKQSLLDQPDAHRRLAAERALLGRETRMLRSLTAAPAPDLRYSPYSQN |
| Ga0187879_101049794 | 3300017946 | Peatland | GQRLNLQRTLLSRETSMLRTTTSRPVPDLRNTPYNPN |
| Ga0187879_106511321 | 3300017946 | Peatland | RQGLLAEPDSLSRLTAERAMLQRETTMLRTLTARPAPDLRYAPYNPN |
| Ga0187783_102008553 | 3300017970 | Tropical Peatland | LAEPDAARRLVADRELLAKETRMLRTLPATPAPDLRNSPYSPN |
| Ga0187816_104330212 | 3300017995 | Freshwater Sediment | VVDLPVKQRMLEEPDAHRRLVAERALLASEMRMLRSLTAAPIPGLRYSPYSQN |
| Ga0187888_13867381 | 3300018008 | Peatland | ALLAEPDALRRLEAERALLARETSMLRALTSKPAPDLRNTPYSPN |
| Ga0187885_100786654 | 3300018025 | Peatland | QALLAEPDSLSRLAAERALLQRETTMLRALTARPAPDLRYAPYNPN |
| Ga0187890_100444344 | 3300018044 | Peatland | RQQLLAEPDAVRRLGAERALLARETTMLRSLTATPAPDLRNTPYNPN |
| Ga0187765_104856682 | 3300018060 | Tropical Peatland | QALLAEPDALHRLASERVLLNQEITMLRSLTATPAPELRNSPYNPN |
| Ga0187765_113303832 | 3300018060 | Tropical Peatland | AASMVIDLPDKQALLAEPDAMHRLATERMMLSRETTMLRALTSTPAPDLRNSPYSSN |
| Ga0181506_10148611 | 3300019260 | Peatland | QALLAEPDAVSRLGAERAMLSRETSMLRSLTSTPAPELRYSPYNPN |
| Ga0193728_10277184 | 3300019890 | Soil | MILDLSVRQDLLAEPDAERRLGAERALLARETTMLRSLTAMPAPDLRNTPYSPN |
| Ga0193728_11160131 | 3300019890 | Soil | LPAEPDAERRLGAERALLARETTMLRSLTATPVPDLLNTPYNPN |
| Ga0193730_11810092 | 3300020002 | Soil | RLALQRVLLSRETAMLRTTISRPAPDLRNTPYSPN |
| Ga0213882_102522102 | 3300021362 | Exposed Rock | RRLVMQRALLSRETAMLRTTTSRPAPDLRHTPYNPN |
| Ga0210393_104663303 | 3300021401 | Soil | LRRLGAERALLSRELTMLRTLTATPAPDLRNSPYSSN |
| Ga0210393_115779712 | 3300021401 | Soil | TVRRLGIERALLARETAMLRTTTSRPAPDLRNTPYSPN |
| Ga0210385_110172581 | 3300021402 | Soil | AERRLGAERALLARETTMLRSLTATPAPDLRNTPYNPN |
| Ga0210385_113423182 | 3300021402 | Soil | LLAEPDALHRLAAERTLLSRELTMLRTLTATPAPDLRNSPYSSN |
| Ga0210389_103439213 | 3300021404 | Soil | LAAPDAARRLVAGRELLRREIRMLRALPTTPAPDLRYSPYNPN |
| Ga0210386_106529291 | 3300021406 | Soil | SDTLRRMAMQRALLSRETTMLRTTTSRPAPDLRNTPYSPN |
| Ga0210386_114970892 | 3300021406 | Soil | SVRQDLLAEPDAERRLGAERALLARETTMLRSLTATPAPDLRNTPYSSN |
| Ga0210390_106441472 | 3300021474 | Soil | LAESGTLGRLDLERALLSRETGMLRTTTSRPAPDLRNTPYSPN |
| Ga0210392_103842671 | 3300021475 | Soil | LRRLAMQRVLLSRETAMLRTTTSRPAPDLRNTPYSPN |
| Ga0210402_110943972 | 3300021478 | Soil | DAHHRLKAERRLLAREMQMLRSLTATPAPDLRYSPYSQN |
| Ga0126371_105816631 | 3300021560 | Tropical Forest Soil | DKQALLAEPDALHRLVTERMLLSRETTMLRTLTATPAPDLRNSPYSSN |
| Ga0126371_125966231 | 3300021560 | Tropical Forest Soil | AAARLKTERALLTKEQRILRSLTATPAPDLLNSPFSQN |
| Ga0126371_128303442 | 3300021560 | Tropical Forest Soil | HRLVTERMLLSRETTMLRTLTATPAPDLRNSPYSSN |
| Ga0242665_101884791 | 3300022724 | Soil | EPDALHRLAAERTLLSRELTMLRTLTATPAPDLRNSPYSSN |
| Ga0179589_103740072 | 3300024288 | Vadose Zone Soil | RLGAERALLVRETTMLRSLTATPAPDLRNTPYNPN |
| Ga0207416_10141951 | 3300025134 | Iron-Sulfur Acid Spring | PEKQALLAEPDAVRRLAAERALLIKETTLLRTLTSMPAADLRNTPYSPN |
| Ga0208479_10302272 | 3300025474 | Arctic Peat Soil | LLAEPDAERRLGAERALLAREITMLRSLTATPAPDLRNTPYNPN |
| Ga0208714_10549422 | 3300025527 | Arctic Peat Soil | ARQQLLAEPDAERRLGAERALLAREITMLRSLTATPAPDLRNTPYNPN |
| Ga0208586_10244753 | 3300025588 | Arctic Peat Soil | DAERRLGAERALLARETTMLRSLTATPAPDLRNTPYNPN |
| Ga0208219_10249763 | 3300025625 | Arctic Peat Soil | LPVRQQLLAEPDAERRLGAERALLARETTMLRSLTATPAPDLRNTPYNPN |
| Ga0208220_10671552 | 3300025627 | Arctic Peat Soil | RRLSAERALLAKETTMLRTLPSTPAADLRYSPYSNN |
| Ga0208480_11205782 | 3300025633 | Arctic Peat Soil | ERRLGAERALLARETTMLRSLTATPAPDLRNTPYNPN |
| Ga0207692_109241111 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | SASMIIDLSDRQTLLAEPDALHRLVAERSLLSRELTMLRTLTATPAPDLRNSPYSSN |
| Ga0207684_100259871 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | LRRMAMQRALLSRETAMLRTTISRPAPDLRNTPYSPN |
| Ga0207693_112022022 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | ALHRLAAERSLLSRELTMLRTLTATPAPDLRNSPYSSN |
| Ga0207663_109133252 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | PDTLRRLAMQRVLLSREAAMLRTTTSRPAPDLRNTPYSPN |
| Ga0207694_103900913 | 3300025924 | Corn Rhizosphere | LLAEPDALRRLESERALLARETSMIGSLTARPAPDLRYSPYSSN |
| Ga0207700_111941202 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | RLAMQRALLSRETAMLRTTTSRPAPDLRNTPYSPN |
| Ga0208139_10231442 | 3300025982 | Rice Paddy Soil | LPARQALLAEPDAVARLAAERALLGRETTMLRALTSAPAPDLGHSRFHPN |
| Ga0207639_121360351 | 3300026041 | Corn Rhizosphere | EPDTLRRLAMQRVLLSREAAMLRTTTSRPAPDLRNTPYSPN |
| Ga0209110_10089172 | 3300027002 | Forest Soil | AEPDALSRLTAERAMLVRETTMLQTLTARPAPDLRYAPYSPN |
| Ga0208042_10495183 | 3300027568 | Peatlands Soil | VRRLALQRALLSRETAMLRTTTSRPAPDLRHTPYSPN |
| Ga0209330_11314842 | 3300027619 | Forest Soil | LLAEPDALRRLTAERALLTVQTSMLRSLASAPAPDLRYSPYNPN |
| Ga0209799_10019081 | 3300027654 | Tropical Forest Soil | RQALLAEPDALHRLTAERTLLSRELTMLRTLTATPAPDLRNSPYSSN |
| Ga0209530_10466443 | 3300027692 | Forest Soil | AESGTLRRLSLQRALLSMETAMLRSTTSRPAPDLRNTPYNPN |
| Ga0208696_10695053 | 3300027696 | Peatlands Soil | LRRLARQRAMLSRETAMLRTTTSRPAPDLRNTPYSPN |
| Ga0209178_11056763 | 3300027725 | Agricultural Soil | DQQALLAEPDALHRLAAERVLLSRELTMLRTLTATPAPDLRNSPYSSN |
| Ga0209112_101150531 | 3300027817 | Forest Soil | PDSISRLTAERAMLVRETTMLQTLTARPAPDLRYAPFNPN |
| Ga0209590_101697663 | 3300027882 | Vadose Zone Soil | DTLRRLGLQRALLSQETAMLRTTTSRPAPDLRNTPYSPN |
| Ga0209590_105940581 | 3300027882 | Vadose Zone Soil | EPDAAARLNAERALLTRETTMLRSLTSTPAPDLRYAPYSPN |
| Ga0209275_100201224 | 3300027884 | Soil | DALRRLTAERTLLSRETSMLRSLTSTPAPEFRYAPYSPN |
| Ga0307305_104103551 | 3300028807 | Soil | RLAAERALLTRETSMLRSLTSTPAPDLRYTPYNPN |
| Ga0302235_104490181 | 3300028877 | Palsa | SRLAAERALLQRETTMLRTLTARPAPDLRYAPYNPN |
| Ga0308309_104742351 | 3300028906 | Soil | VSRLTAERALLHRETTMLQSLTSTPAPDLRYSPYNPN |
| Ga0308309_109191931 | 3300028906 | Soil | TLQRLAMQRALLSRETAMLRTTTSRPAPDLRNTPYSPN |
| Ga0311340_105707492 | 3300029943 | Palsa | EPDAAGRLAAERALLSRETTMLRSLTSTPAPDLRNTPYNPN |
| Ga0311340_112590201 | 3300029943 | Palsa | RRLTAEHMLLARETTMLRSLTSTPAPDLRNTPYNPN |
| Ga0311340_115993781 | 3300029943 | Palsa | QQALLAEPDSLSRLAAERALLQRETTMLRTLTARPAPDLRYAPYNPN |
| Ga0311372_103107291 | 3300030520 | Palsa | AASRLAAERAMLSRETMMLRSLTSTPAPDLRYSPYNPN |
| Ga0311355_104145991 | 3300030580 | Palsa | ALLAEPDSLSRLAAERALLQRETTMLRTLTARPAPDLRYAPYNPN |
| Ga0265462_118989711 | 3300030738 | Soil | LEEPDADRRLAAERRLLAHETQMLRSLTATPAPDLRYSPYSQN |
| Ga0302324_1025136012 | 3300031236 | Palsa | LRRLNMQRALLSRETAMLRTTTSRPAPDLRNTPYNPN |
| Ga0170818_1121477542 | 3300031474 | Forest Soil | IIDLSDRQTLLAEPDALHRLVAARTLLSRELTMLRTLTATPAPDLRNSPYSSN |
| Ga0302326_105293794 | 3300031525 | Palsa | AEPDSLSRLAAERALLQRETTMLRTLTARPAPDLRYAPYNPN |
| Ga0302326_108916272 | 3300031525 | Palsa | RLAAERALLQRETTMLRTLTARPAPDLRYAPYNPN |
| Ga0318534_106679241 | 3300031544 | Soil | AEPDALHRLAAGRSLLSRELTMLRTLTATPAPDLRNSPYSSN |
| Ga0318571_100214421 | 3300031549 | Soil | LLAEPDALHRLAAERSLLSRELTMLRTLTATPAPDLRNSPYSSN |
| Ga0318571_102684582 | 3300031549 | Soil | ALHRLVTERMLLSRETTMLRTLTATPAPDLRNSPYSSN |
| Ga0318573_100585644 | 3300031564 | Soil | EPDALHRLTAERALLSRELTMLRTLTATPAPDLRNSPYSSN |
| Ga0318515_102566713 | 3300031572 | Soil | QALLAEPDALHRLTAERALLSRELTMLRTLTATPAPDLRNSPYSSN |
| Ga0318515_107085851 | 3300031572 | Soil | HRLTAERTLLSRELTMLRTLTATPAPDLRNSPYSSN |
| Ga0310915_101931931 | 3300031573 | Soil | AEPDALHRLTAERTLLARELTMLRALTATPAPNLRNSPYSSN |
| Ga0310915_105155211 | 3300031573 | Soil | ALHRLAAERALLSRELTMLRTLTATPAPDLRNSPYSSN |
| Ga0318542_105473531 | 3300031668 | Soil | LLAESGTLRRLARLRALLSRETAMLRTTTSRPAPDLRHAPYSPN |
| Ga0307375_108072401 | 3300031669 | Soil | ARRLTAERALLAKETTMLRALPSTPAADLRYSPYSPN |
| Ga0318572_106602142 | 3300031681 | Soil | SDTLHRLARQRALLSRETAVLRTTTSRPAPDLRNTPYSPN |
| Ga0310686_1034627102 | 3300031708 | Soil | LATPDAAARLAAGRELLSREIRMLRTIPTTPAPDLRYSPYSPN |
| Ga0306917_103745072 | 3300031719 | Soil | RQALLAEPDALHRLTAERALLSRELTMLRALTATPAPDLRNSPYSSN |
| Ga0318493_103698791 | 3300031723 | Soil | LRRMAMQRVLLSRETAMLRTTTSRPVPDLRNTPYSPN |
| Ga0318500_104299611 | 3300031724 | Soil | RRLAMQRALLSRETAMLRTTTSRPVPDLRNTPYSPN |
| Ga0318501_107306741 | 3300031736 | Soil | ALHRLTAERALLSRELTMLRTLTATPAPDLRNSPYSSN |
| Ga0306918_101132571 | 3300031744 | Soil | RQAMLAEPDALHRLTAERTLLSRELTMLRALTATPAPDLRNSPYSSN |
| Ga0306918_105066751 | 3300031744 | Soil | MVIDLRDKQALLAEPDALHRLVTERMLLSRETTMLRTLTATPAPDLRNSPYSSN |
| Ga0318502_108457281 | 3300031747 | Soil | PDALHRLVTERMLLSRETTMLRTLTATPAPDLRNSPYSSN |
| Ga0318554_104272503 | 3300031765 | Soil | VGASMIIDLSDRQTLLGEADALHRLVAERSLLSRELTMLRTLTATPAPDLRNSPYSSN |
| Ga0318546_113144221 | 3300031771 | Soil | IDLRDKQALLAEPDALHRLVTERMLLSRETTMLRTLTATPAPDLRNSPYSSN |
| Ga0318552_100174001 | 3300031782 | Soil | EPDALRRLAAERALLARELTMLRALTATPAPDLRNSPYSSN |
| Ga0318552_101047253 | 3300031782 | Soil | ALHRLTAERTLLARELTMLRALTATPAPNLRNSPYSSN |
| Ga0302319_110897281 | 3300031788 | Bog | QQALRAEPDSLSRLAAERALLQRETTMLRTLTARPAPDLRYAPYSPN |
| Ga0318557_103777832 | 3300031795 | Soil | HRLAAERALLSRELTMLRTLTATPAPDLRNSPYSSN |
| Ga0318576_104296151 | 3300031796 | Soil | LAEADALHRLVAERSLLSRELTMLRTLTATPAPDLRNSPYSSN |
| Ga0318550_100786511 | 3300031797 | Soil | LHRLAAERSLLSRELTMLRTLTATPAPDLRNSPYSSN |
| Ga0318564_103939432 | 3300031831 | Soil | AEPDALHRLVTERMLLSRETTMLRTLTATPAPDLRNSPYSSN |
| Ga0318511_102617421 | 3300031845 | Soil | RLTAERALLSRELTMLRTLTATPAPDLRNSPYSSN |
| Ga0318495_100557691 | 3300031860 | Soil | LLLAEPDAAARLAAERVMLARETTMLRTLPSTPATDLRNSPYSPN |
| Ga0310912_101749171 | 3300031941 | Soil | RLTAERALLSRETAMLRTLTSTPAPDLRNTPYSPN |
| Ga0310909_111001151 | 3300031947 | Soil | VIDLRDKQALLAEPDALHRLVTERMLLSRETTMLRTLTATPAPDLRNSPYSSN |
| Ga0306922_108241013 | 3300032001 | Soil | EPDALHRLVTERMLLARETTMLRTLTAAPAPDLRNSPYSSN |
| Ga0318562_103389091 | 3300032008 | Soil | ALHRLTAERTLLSRELTMLRTLTATPAPDLRNSPYSSN |
| Ga0318556_106321602 | 3300032043 | Soil | LPEKQRLLEEPDALRRLVAERRLLSREMQMLRSLTATPAPDLRYAPYSQN |
| Ga0318570_101309941 | 3300032054 | Soil | PDALHRLAAERALLSRELTMLRTLTATPAPDLRNSPYSSN |
| Ga0318575_102392001 | 3300032055 | Soil | RQALLAEPDALHRLTAERALLSRELTMLRTLTATPAPDLRNSPYSSN |
| Ga0318533_107140833 | 3300032059 | Soil | SMIIDLSDRQTLLAEPDALHRLAAERSLLSRELTMLRTLTATPAPDLRNSPYSSN |
| Ga0318510_105197961 | 3300032064 | Soil | LAESDTLRRLAMQRVLLSREAAMLRTTTSRPAPDLRNTPYNPN |
| Ga0318514_101354743 | 3300032066 | Soil | TLRRLAMQRALLSRETAMLRTTTSRPVPDLRNTPYSPN |
| Ga0308173_119669761 | 3300032074 | Soil | RLALERSLLSRETAMLRTTTSRPAPDLRNTPYSPN |
| Ga0311301_102552626 | 3300032160 | Peatlands Soil | VDLPDKQALLAKPDALARLTAERTLLVRETTMLRSLTSAPAPDLRYTPYSNN |
| Ga0311301_112706561 | 3300032160 | Peatlands Soil | EPDSLSRLNAERAMLQRETTMLRTLTARPAPDLRHAPYNPN |
| Ga0307471_1015973511 | 3300032180 | Hardwood Forest Soil | DALHRLVAERMLLSRETTMLRTLTAAPAPDLRNSPYSSN |
| Ga0307471_1029597902 | 3300032180 | Hardwood Forest Soil | EEPDAYRRLLAERKLLGLEMRMLRSLTATPAPDLRFSPYSPN |
| Ga0307472_1027625751 | 3300032205 | Hardwood Forest Soil | LRRLVAERALLSRETAMLRTLTSTPAPDLRNTPYSTN |
| Ga0335079_122812031 | 3300032783 | Soil | RRLALQRALLSRETAMLRATTSRPAPDLRHTPYSPN |
| Ga0335078_123914401 | 3300032805 | Soil | DLPVRQQLLAEPDAERRLGAERALLAREITMLRSLTATPAPDLRNTPYNPN |
| Ga0335080_104664752 | 3300032828 | Soil | RLSTERALLSRETTMLRSLSSTPAPDLRNAPYNPN |
| Ga0335080_123001262 | 3300032828 | Soil | AEPDALSRLTAERAMLSREAAMLRSLTSTPAPELRNAPYNPN |
| Ga0335081_100915674 | 3300032892 | Soil | DRQVLLAEPDAVRRLSTERALLSRETTMLRSLSSTPAPDLRNAPYNPN |
| Ga0335075_106702991 | 3300032896 | Soil | LEEPDALRRLVSERRLLTREMQMLRSLTATPAPDLRYAPYSNN |
| Ga0335073_121263291 | 3300033134 | Soil | PDALRRLVAERRLLTREMQMLRSLTATPAPDLRYAPYSQN |
| Ga0334850_014558_1356_1472 | 3300033828 | Soil | AHRRLVAERALLTRELQLLRSLPATPATDLRYSPYSQN |
| ⦗Top⦘ |