Basic Information | |
---|---|
Family ID | F030425 |
Family Type | Metagenome |
Number of Sequences | 185 |
Average Sequence Length | 41 residues |
Representative Sequence | MATTTNYGWTTPDDTDLVKDGAAAIRTLGSSVDTTTK |
Number of Associated Samples | 134 |
Number of Associated Scaffolds | 185 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | No |
Most common taxonomic group | Viruses |
% of genes with valid RBS motifs | 100.00 % |
% of genes near scaffold ends (potentially truncated) | 95.68 % |
% of genes from short scaffolds (< 2000 bps) | 87.57 % |
Associated GOLD sequencing projects | 125 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.41 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Duplodnaviria (63.784 % of family members) |
NCBI Taxonomy ID | 2731341 |
Taxonomy | All Organisms → Viruses → Duplodnaviria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake (21.622 % of family members) |
Environment Ontology (ENVO) | Unclassified (58.919 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (54.054 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 32.31% β-sheet: 12.31% Coil/Unstructured: 55.38% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.41 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 185 Family Scaffolds |
---|---|---|
PF05065 | Phage_capsid | 1.08 |
PF01050 | MannoseP_isomer | 0.54 |
PF04860 | Phage_portal | 0.54 |
COG ID | Name | Functional Category | % Frequency in 185 Family Scaffolds |
---|---|---|---|
COG4653 | Predicted phage phi-C31 gp36 major capsid-like protein | Mobilome: prophages, transposons [X] | 1.08 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 66.49 % |
Unclassified | root | N/A | 33.51 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300002408|B570J29032_109214038 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 638 | Open in IMG/M |
3300002408|B570J29032_109904228 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2268 | Open in IMG/M |
3300002835|B570J40625_101066969 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 685 | Open in IMG/M |
3300003394|JGI25907J50239_1003448 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3866 | Open in IMG/M |
3300003491|JGI25924J51412_1045741 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 695 | Open in IMG/M |
3300003497|JGI25925J51416_10143650 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 545 | Open in IMG/M |
3300004054|Ga0063232_10277864 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 509 | Open in IMG/M |
3300005581|Ga0049081_10127441 | Not Available | 939 | Open in IMG/M |
3300005581|Ga0049081_10344519 | Not Available | 506 | Open in IMG/M |
3300006484|Ga0070744_10192643 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 581 | Open in IMG/M |
3300006805|Ga0075464_10151701 | Not Available | 1361 | Open in IMG/M |
3300006805|Ga0075464_10530653 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 722 | Open in IMG/M |
3300006805|Ga0075464_10973951 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 531 | Open in IMG/M |
3300006917|Ga0075472_10038952 | Not Available | 2233 | Open in IMG/M |
3300006920|Ga0070748_1104790 | All Organisms → Viruses → Predicted Viral | 1075 | Open in IMG/M |
3300007165|Ga0079302_1076482 | Not Available | 724 | Open in IMG/M |
3300007214|Ga0103959_1109487 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2044 | Open in IMG/M |
3300007234|Ga0075460_10006970 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4554 | Open in IMG/M |
3300007538|Ga0099851_1048827 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1664 | Open in IMG/M |
3300007541|Ga0099848_1096486 | Not Available | 1138 | Open in IMG/M |
3300007559|Ga0102828_1158850 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 569 | Open in IMG/M |
3300007974|Ga0105747_1149681 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 753 | Open in IMG/M |
3300008012|Ga0075480_10575777 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 535 | Open in IMG/M |
3300008114|Ga0114347_1131424 | Not Available | 923 | Open in IMG/M |
3300008117|Ga0114351_1046937 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2720 | Open in IMG/M |
3300008119|Ga0114354_1084661 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1286 | Open in IMG/M |
3300008120|Ga0114355_1226831 | Not Available | 570 | Open in IMG/M |
3300008264|Ga0114353_1224919 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 859 | Open in IMG/M |
3300008265|Ga0114361_1138278 | Not Available | 759 | Open in IMG/M |
3300008265|Ga0114361_1183775 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Vibrionales → Vibrionaceae → Vibrio → Vibrio cholerae | 652 | Open in IMG/M |
3300008265|Ga0114361_1192677 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 636 | Open in IMG/M |
3300008266|Ga0114363_1050257 | Not Available | 1662 | Open in IMG/M |
3300008266|Ga0114363_1186263 | Not Available | 652 | Open in IMG/M |
3300008266|Ga0114363_1215196 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 575 | Open in IMG/M |
3300008339|Ga0114878_1164772 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 779 | Open in IMG/M |
3300008448|Ga0114876_1184882 | Not Available | 721 | Open in IMG/M |
3300008450|Ga0114880_1081874 | Not Available | 1286 | Open in IMG/M |
3300008450|Ga0114880_1108939 | Not Available | 1058 | Open in IMG/M |
3300008450|Ga0114880_1236922 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 580 | Open in IMG/M |
3300009009|Ga0105105_10753904 | Not Available | 584 | Open in IMG/M |
3300009082|Ga0105099_10212094 | Not Available | 1112 | Open in IMG/M |
3300009085|Ga0105103_10579258 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 636 | Open in IMG/M |
3300009160|Ga0114981_10256431 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Vibrionales → Vibrionaceae → Vibrio → Vibrio cholerae | 953 | Open in IMG/M |
3300009168|Ga0105104_10128141 | Not Available | 1369 | Open in IMG/M |
3300009169|Ga0105097_10204057 | Not Available | 1088 | Open in IMG/M |
3300009169|Ga0105097_10551173 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 647 | Open in IMG/M |
3300009180|Ga0114979_10281945 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 990 | Open in IMG/M |
3300009183|Ga0114974_10591636 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 613 | Open in IMG/M |
3300010316|Ga0136655_1125860 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 768 | Open in IMG/M |
3300010370|Ga0129336_10036488 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2965 | Open in IMG/M |
3300010370|Ga0129336_10315406 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 866 | Open in IMG/M |
3300012012|Ga0153799_1025628 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1158 | Open in IMG/M |
3300012013|Ga0153805_1041974 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 777 | Open in IMG/M |
3300012017|Ga0153801_1028729 | Not Available | 983 | Open in IMG/M |
3300012017|Ga0153801_1042382 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 804 | Open in IMG/M |
3300012665|Ga0157210_1022825 | Not Available | 1004 | Open in IMG/M |
3300013005|Ga0164292_10877209 | Not Available | 564 | Open in IMG/M |
3300013372|Ga0177922_10099779 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 558 | Open in IMG/M |
3300013372|Ga0177922_11060652 | Not Available | 2302 | Open in IMG/M |
3300014811|Ga0119960_1101533 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 514 | Open in IMG/M |
3300017701|Ga0181364_1024674 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 983 | Open in IMG/M |
3300017722|Ga0181347_1062489 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1108 | Open in IMG/M |
3300017722|Ga0181347_1071189 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1025 | Open in IMG/M |
3300017722|Ga0181347_1096231 | Not Available | 849 | Open in IMG/M |
3300017723|Ga0181362_1038657 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1008 | Open in IMG/M |
3300017754|Ga0181344_1117122 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 769 | Open in IMG/M |
3300017754|Ga0181344_1195176 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 569 | Open in IMG/M |
3300017761|Ga0181356_1111084 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Vibrionales → Vibrionaceae → Vibrio → Vibrio cholerae | 883 | Open in IMG/M |
3300017761|Ga0181356_1235303 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 527 | Open in IMG/M |
3300017774|Ga0181358_1139114 | Not Available | 838 | Open in IMG/M |
3300017777|Ga0181357_1242537 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 629 | Open in IMG/M |
3300017778|Ga0181349_1267459 | Not Available | 565 | Open in IMG/M |
3300017778|Ga0181349_1282677 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 543 | Open in IMG/M |
3300017780|Ga0181346_1178944 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 777 | Open in IMG/M |
3300017780|Ga0181346_1228780 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 659 | Open in IMG/M |
3300017784|Ga0181348_1102495 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1116 | Open in IMG/M |
3300018065|Ga0180430_11010855 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 581 | Open in IMG/M |
3300018416|Ga0181553_10496271 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 653 | Open in IMG/M |
3300019784|Ga0181359_1139462 | Not Available | 845 | Open in IMG/M |
3300019784|Ga0181359_1194603 | Not Available | 658 | Open in IMG/M |
3300019784|Ga0181359_1239980 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 557 | Open in IMG/M |
3300020162|Ga0211735_10097049 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 679 | Open in IMG/M |
3300020172|Ga0211729_10690239 | Not Available | 767 | Open in IMG/M |
3300020493|Ga0208591_1021945 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 798 | Open in IMG/M |
3300020506|Ga0208091_1001397 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3825 | Open in IMG/M |
3300020506|Ga0208091_1028875 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 625 | Open in IMG/M |
3300020529|Ga0208233_1006683 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1798 | Open in IMG/M |
3300020530|Ga0208235_1000772 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 6613 | Open in IMG/M |
3300020553|Ga0208855_1037277 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 661 | Open in IMG/M |
3300020557|Ga0208231_1010865 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1657 | Open in IMG/M |
3300020571|Ga0208723_1033349 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 752 | Open in IMG/M |
3300021961|Ga0222714_10550048 | Not Available | 584 | Open in IMG/M |
3300022190|Ga0181354_1026630 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1871 | Open in IMG/M |
3300022190|Ga0181354_1066716 | Not Available | 1194 | Open in IMG/M |
3300022190|Ga0181354_1184767 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 631 | Open in IMG/M |
3300022198|Ga0196905_1046453 | Not Available | 1249 | Open in IMG/M |
3300022198|Ga0196905_1132097 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 650 | Open in IMG/M |
3300022200|Ga0196901_1039905 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1794 | Open in IMG/M |
3300025635|Ga0208147_1122928 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 618 | Open in IMG/M |
3300025645|Ga0208643_1171687 | Not Available | 533 | Open in IMG/M |
3300025647|Ga0208160_1120813 | Not Available | 661 | Open in IMG/M |
3300025655|Ga0208795_1122430 | Not Available | 675 | Open in IMG/M |
3300027123|Ga0255090_1061629 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 546 | Open in IMG/M |
3300027131|Ga0255066_1033438 | Not Available | 723 | Open in IMG/M |
3300027151|Ga0255063_1016915 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1551 | Open in IMG/M |
3300027156|Ga0255078_1055048 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 795 | Open in IMG/M |
3300027586|Ga0208966_1154448 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 606 | Open in IMG/M |
3300027679|Ga0209769_1247428 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 543 | Open in IMG/M |
3300027688|Ga0209553_1068273 | Not Available | 1346 | Open in IMG/M |
3300027697|Ga0209033_1086311 | Not Available | 1050 | Open in IMG/M |
3300027756|Ga0209444_10170916 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 813 | Open in IMG/M |
3300027759|Ga0209296_1226456 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 784 | Open in IMG/M |
3300027764|Ga0209134_10055679 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1319 | Open in IMG/M |
3300027764|Ga0209134_10189655 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 708 | Open in IMG/M |
3300027764|Ga0209134_10244981 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 614 | Open in IMG/M |
3300027782|Ga0209500_10248610 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 777 | Open in IMG/M |
3300027785|Ga0209246_10169921 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 856 | Open in IMG/M |
3300027792|Ga0209287_10229063 | Not Available | 710 | Open in IMG/M |
3300027798|Ga0209353_10309730 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 667 | Open in IMG/M |
3300027808|Ga0209354_10275649 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 672 | Open in IMG/M |
3300027892|Ga0209550_10048977 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3434 | Open in IMG/M |
3300027892|Ga0209550_10843051 | Not Available | 509 | Open in IMG/M |
3300027973|Ga0209298_10191874 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 839 | Open in IMG/M |
3300028025|Ga0247723_1054542 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1128 | Open in IMG/M |
3300028269|Ga0255193_1016397 | Not Available | 1075 | Open in IMG/M |
3300028394|Ga0304730_1037364 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2456 | Open in IMG/M |
3300028394|Ga0304730_1338388 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 504 | Open in IMG/M |
3300028394|Ga0304730_1338500 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 504 | Open in IMG/M |
(restricted) 3300028553|Ga0247839_1072480 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1779 | Open in IMG/M |
3300031566|Ga0307378_11186385 | Not Available | 606 | Open in IMG/M |
3300031673|Ga0307377_10295154 | Not Available | 1230 | Open in IMG/M |
3300031758|Ga0315907_10210479 | Not Available | 1626 | Open in IMG/M |
3300031758|Ga0315907_10382197 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1139 | Open in IMG/M |
3300031857|Ga0315909_10010843 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 9680 | Open in IMG/M |
3300031857|Ga0315909_10454313 | Not Available | 899 | Open in IMG/M |
3300031857|Ga0315909_10750549 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 625 | Open in IMG/M |
3300031951|Ga0315904_10221143 | Not Available | 1840 | Open in IMG/M |
3300031951|Ga0315904_10495129 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1079 | Open in IMG/M |
3300031951|Ga0315904_11266702 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 560 | Open in IMG/M |
3300031963|Ga0315901_10591770 | Not Available | 844 | Open in IMG/M |
3300031963|Ga0315901_11039186 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 569 | Open in IMG/M |
3300032046|Ga0315289_11253415 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 591 | Open in IMG/M |
3300032046|Ga0315289_11253905 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 591 | Open in IMG/M |
3300032116|Ga0315903_10763061 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 712 | Open in IMG/M |
3300032118|Ga0315277_10751373 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 929 | Open in IMG/M |
3300032173|Ga0315268_12324727 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 550 | Open in IMG/M |
3300033521|Ga0316616_102937815 | Not Available | 642 | Open in IMG/M |
3300033521|Ga0316616_104148484 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 545 | Open in IMG/M |
3300033816|Ga0334980_0303511 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 619 | Open in IMG/M |
3300033981|Ga0334982_0269455 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 812 | Open in IMG/M |
3300033996|Ga0334979_0155771 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1378 | Open in IMG/M |
3300034012|Ga0334986_0521045 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 580 | Open in IMG/M |
3300034021|Ga0335004_0344562 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 864 | Open in IMG/M |
3300034022|Ga0335005_0243268 | Not Available | 1095 | Open in IMG/M |
3300034023|Ga0335021_0296532 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 869 | Open in IMG/M |
3300034061|Ga0334987_0351697 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 953 | Open in IMG/M |
3300034062|Ga0334995_0040647 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3893 | Open in IMG/M |
3300034062|Ga0334995_0240484 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1227 | Open in IMG/M |
3300034062|Ga0334995_0684672 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 580 | Open in IMG/M |
3300034062|Ga0334995_0743882 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 545 | Open in IMG/M |
3300034071|Ga0335028_0531158 | Not Available | 645 | Open in IMG/M |
3300034073|Ga0310130_0234499 | Not Available | 576 | Open in IMG/M |
3300034092|Ga0335010_0322261 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 877 | Open in IMG/M |
3300034104|Ga0335031_0102451 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2017 | Open in IMG/M |
3300034104|Ga0335031_0156828 | Not Available | 1570 | Open in IMG/M |
3300034104|Ga0335031_0736986 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 560 | Open in IMG/M |
3300034105|Ga0335035_0239044 | Not Available | 1099 | Open in IMG/M |
3300034105|Ga0335035_0457903 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 708 | Open in IMG/M |
3300034106|Ga0335036_0554773 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 706 | Open in IMG/M |
3300034112|Ga0335066_0181496 | All Organisms → Viruses → Predicted Viral | 1261 | Open in IMG/M |
3300034118|Ga0335053_0106080 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1938 | Open in IMG/M |
3300034118|Ga0335053_0170283 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1454 | Open in IMG/M |
3300034119|Ga0335054_0145551 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1448 | Open in IMG/M |
3300034166|Ga0335016_0549948 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 640 | Open in IMG/M |
3300034200|Ga0335065_0565525 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 669 | Open in IMG/M |
3300034283|Ga0335007_0696808 | Not Available | 569 | Open in IMG/M |
3300034418|Ga0348337_058112 | Not Available | 1496 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 21.62% |
Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 16.22% |
Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 9.73% |
Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 6.49% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 5.95% |
Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 5.95% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 3.78% |
Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 3.78% |
Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 3.78% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 3.24% |
Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 3.24% |
Freshwater | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater | 2.16% |
Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 2.16% |
Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 1.62% |
Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 1.62% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.08% |
Soil | Environmental → Terrestrial → Soil → Clay → Unclassified → Soil | 1.08% |
Freshwater | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater | 0.54% |
Aquatic | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Aquatic | 0.54% |
Surface Ice | Environmental → Aquatic → Freshwater → Ice → Unclassified → Surface Ice | 0.54% |
Estuary Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water | 0.54% |
Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 0.54% |
Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 0.54% |
Estuarine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine | 0.54% |
Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 0.54% |
Hypersaline Lake Sediment | Environmental → Aquatic → Non-Marine Saline And Alkaline → Hypersaline → Sediment → Hypersaline Lake Sediment | 0.54% |
Deep Subsurface | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface | 0.54% |
Fracking Water | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Fracking Water | 0.54% |
Deep Subsurface Sediment | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface Sediment | 0.54% |
Visualization |
---|
Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300002408 | Freshwater microbial communities from Lake Mendota, WI, sample - 15JUL2010 deep hole epilimnion (Lake Mendota Combined assembly, ASSEMBLY_DATE=20140123) | Environmental | Open in IMG/M |
3300002835 | Freshwater microbial communities from Lake Mendota, WI - (Lake Mendota Combined Ray assembly, ASSEMBLY_DATE=20140605) | Environmental | Open in IMG/M |
3300003394 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SN | Environmental | Open in IMG/M |
3300003491 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.SD | Environmental | Open in IMG/M |
3300003497 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.DN | Environmental | Open in IMG/M |
3300004054 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (v2) | Environmental | Open in IMG/M |
3300005581 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF | Environmental | Open in IMG/M |
3300006484 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.535 | Environmental | Open in IMG/M |
3300006805 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA | Environmental | Open in IMG/M |
3300006917 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_<0.8_DNA | Environmental | Open in IMG/M |
3300006920 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 | Environmental | Open in IMG/M |
3300007165 | Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Utica-2 Time Series FC 2014_7_16 | Environmental | Open in IMG/M |
3300007214 | Combined Assembly of cyanobacterial bloom in Punggol water reservoir, Singapore (Diel cycle-Surface layer) 9 sequencing projects | Environmental | Open in IMG/M |
3300007234 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_<0.8_DNA | Environmental | Open in IMG/M |
3300007538 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_2 Viral MetaG | Environmental | Open in IMG/M |
3300007541 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG | Environmental | Open in IMG/M |
3300007559 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.541 | Environmental | Open in IMG/M |
3300007974 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460C_0.2um | Environmental | Open in IMG/M |
3300008012 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_<0.8_DNA | Environmental | Open in IMG/M |
3300008114 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-C-NA | Environmental | Open in IMG/M |
3300008117 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0108-C-NA | Environmental | Open in IMG/M |
3300008119 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0110-C-NA | Environmental | Open in IMG/M |
3300008120 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0108-3-NA | Environmental | Open in IMG/M |
3300008264 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0108-53-LTR | Environmental | Open in IMG/M |
3300008265 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample HABS-E2014-0126-100-LTR | Environmental | Open in IMG/M |
3300008266 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample HABS-E2014-0108-C-NA | Environmental | Open in IMG/M |
3300008339 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - Sept 29, 2014 all contigs | Environmental | Open in IMG/M |
3300008448 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - August 4, 2014 all contigs | Environmental | Open in IMG/M |
3300008450 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - Oct 27, 2014 all contigs | Environmental | Open in IMG/M |
3300009009 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 1-3cm September2015 | Environmental | Open in IMG/M |
3300009082 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 1-3cm May2015 | Environmental | Open in IMG/M |
3300009085 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 10-12cm September2015 | Environmental | Open in IMG/M |
3300009160 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_MF_MetaG | Environmental | Open in IMG/M |
3300009168 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 19-21cm September2015 | Environmental | Open in IMG/M |
3300009169 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm May2015 | Environmental | Open in IMG/M |
3300009180 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140625_EF_MetaG | Environmental | Open in IMG/M |
3300009183 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG | Environmental | Open in IMG/M |
3300010316 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_15_0.8_DNA | Environmental | Open in IMG/M |
3300010370 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.2_DNA | Environmental | Open in IMG/M |
3300012012 | Freshwater microbial communities from Eastern Basin Lake Erie, Ontario, Canada - Station 879 - Top - Depth 1m | Environmental | Open in IMG/M |
3300012013 | Freshwater microbial communities from Eastern Basin Lake Erie, Ontario, Canada - Station 67 - Surface Ice | Environmental | Open in IMG/M |
3300012017 | Freshwater microbial communities from Central Basin Lake Erie, Ontario, Canada - Station 1208 - Top - Depth 1m | Environmental | Open in IMG/M |
3300012665 | Freshwater microbial communities from Talbot River, Ontario, Canada - S11 | Environmental | Open in IMG/M |
3300013005 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES117 metaG | Environmental | Open in IMG/M |
3300013372 | Freshwater microbial communities from Lake Erie, Ontario, Canada. Combined Assembly of 10 SPs | Environmental | Open in IMG/M |
3300014811 | Aquatic viral communities from ballast water - Michigan State University - AB_ballast water | Environmental | Open in IMG/M |
3300017701 | Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MM110.S.N | Environmental | Open in IMG/M |
3300017722 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.N | Environmental | Open in IMG/M |
3300017723 | Freshwater viral communities from Lake Michigan, USA - Su13.ND.MM110.S.N | Environmental | Open in IMG/M |
3300017754 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.D.D | Environmental | Open in IMG/M |
3300017761 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.N | Environmental | Open in IMG/M |
3300017774 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.D | Environmental | Open in IMG/M |
3300017777 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.D.N | Environmental | Open in IMG/M |
3300017778 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.D | Environmental | Open in IMG/M |
3300017780 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.D.N | Environmental | Open in IMG/M |
3300017784 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.D.N | Environmental | Open in IMG/M |
3300018065 | Hypersaline lake sediment archaeal communities from the Salton Sea, California, USA - SS_1_S_2 metaG | Environmental | Open in IMG/M |
3300018416 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011502XT metaG (megahit assembly) | Environmental | Open in IMG/M |
3300019784 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.D | Environmental | Open in IMG/M |
3300020162 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_201 megahit1 | Environmental | Open in IMG/M |
3300020172 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_102 megahit1 | Environmental | Open in IMG/M |
3300020493 | Freshwater microbial communities from Lake Mendota, WI - 14NOV2009 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
3300020506 | Freshwater microbial communities from Lake Mendota, WI - 26OCT2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
3300020529 | Freshwater microbial communities from Lake Mendota, WI - 07SEP2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
3300020530 | Freshwater microbial communities from Lake Mendota, WI - 22OCT2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
3300020553 | Freshwater microbial communities from Lake Mendota, WI - 17MAY2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
3300020557 | Freshwater microbial communities from Lake Mendota, WI - 15JUN2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
3300020571 | Freshwater microbial communities from Lake Mendota, WI - 31AUG2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
3300021961 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_3D | Environmental | Open in IMG/M |
3300022190 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.N | Environmental | Open in IMG/M |
3300022198 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG (v3) | Environmental | Open in IMG/M |
3300022200 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG (v3) | Environmental | Open in IMG/M |
3300025635 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_0.3_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
3300025645 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 (SPAdes) | Environmental | Open in IMG/M |
3300025647 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
3300025655 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_2 Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
3300025872 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
3300027123 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Yuk_RepA_8d | Environmental | Open in IMG/M |
3300027131 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Cont_RepA_8h | Environmental | Open in IMG/M |
3300027136 | Freshwater microbial communities from St. Lawrence River, New York, United States - Law_Cont_RepC_8h | Environmental | Open in IMG/M |
3300027151 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Cont_RepA_0h | Environmental | Open in IMG/M |
3300027156 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Atlam_RepA_8h | Environmental | Open in IMG/M |
3300027586 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG HU45MSRF (SPAdes) | Environmental | Open in IMG/M |
3300027679 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.DN (SPAdes) | Environmental | Open in IMG/M |
3300027688 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM110.DN (SPAdes) | Environmental | Open in IMG/M |
3300027697 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.DN (SPAdes) | Environmental | Open in IMG/M |
3300027756 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.DN (SPAdes) | Environmental | Open in IMG/M |
3300027759 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027764 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MLB.SN (SPAdes) | Environmental | Open in IMG/M |
3300027782 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027785 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SN (SPAdes) | Environmental | Open in IMG/M |
3300027792 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 1-3cm May2015 (SPAdes) | Environmental | Open in IMG/M |
3300027798 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD (SPAdes) | Environmental | Open in IMG/M |
3300027808 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.DD (SPAdes) | Environmental | Open in IMG/M |
3300027892 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (SPAdes) | Environmental | Open in IMG/M |
3300027963 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027973 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300028025 | Subsurface sediment microbial communities from gas well in West Virginia, United States - MSEEL Well Study Marcellus 5H_FC | Environmental | Open in IMG/M |
3300028269 | Freshwater microbial communities from Mississippi River, Louisiana, United States - Miss_Yuk_RepA_8h | Environmental | Open in IMG/M |
3300028394 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130628_MF_MetaG (v2) | Environmental | Open in IMG/M |
3300028553 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_16m | Environmental | Open in IMG/M |
3300031566 | Soil microbial communities from Risofladan, Vaasa, Finland - UN-1 | Environmental | Open in IMG/M |
3300031673 | Soil microbial communities from Risofladan, Vaasa, Finland - TR-3 | Environmental | Open in IMG/M |
3300031758 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA123 | Environmental | Open in IMG/M |
3300031857 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125 | Environmental | Open in IMG/M |
3300031951 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA120 | Environmental | Open in IMG/M |
3300031963 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA116 | Environmental | Open in IMG/M |
3300032046 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_40 | Environmental | Open in IMG/M |
3300032116 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA119 | Environmental | Open in IMG/M |
3300032118 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G05_15 | Environmental | Open in IMG/M |
3300032173 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C1_top | Environmental | Open in IMG/M |
3300033521 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D1_B | Environmental | Open in IMG/M |
3300033816 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME16Sep2004-rr0005 | Environmental | Open in IMG/M |
3300033981 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME24Aug2014-rr0011 | Environmental | Open in IMG/M |
3300033996 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Jul2016-rr0004 | Environmental | Open in IMG/M |
3300034012 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Aug2017-rr0027 | Environmental | Open in IMG/M |
3300034021 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME01Oct2014-rr0057 | Environmental | Open in IMG/M |
3300034022 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Apr2018-rr0058 | Environmental | Open in IMG/M |
3300034023 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME21Oct2016-rr0090 | Environmental | Open in IMG/M |
3300034061 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Sep2004-rr0028 | Environmental | Open in IMG/M |
3300034062 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Jul2012-rr0045 | Environmental | Open in IMG/M |
3300034071 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Oct2008D10-rr0110 | Environmental | Open in IMG/M |
3300034073 | Fracking water microbial communities from deep shales in Oklahoma, United States - MC-6-XL | Environmental | Open in IMG/M |
3300034092 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME03Aug2012-rr0069 | Environmental | Open in IMG/M |
3300034104 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Aug2005-rr0120 | Environmental | Open in IMG/M |
3300034105 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME15May2014-rr0127 | Environmental | Open in IMG/M |
3300034106 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME23Aug2013-rr0131 | Environmental | Open in IMG/M |
3300034112 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Aug2014-rr0191 | Environmental | Open in IMG/M |
3300034118 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME05Aug2017-rr0165 | Environmental | Open in IMG/M |
3300034119 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME21Jul2015-rr0166 | Environmental | Open in IMG/M |
3300034166 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME13Sep2012-rr0079 | Environmental | Open in IMG/M |
3300034200 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Jul2013-rr0190 | Environmental | Open in IMG/M |
3300034283 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Aug2003-rr0061 | Environmental | Open in IMG/M |
3300034418 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_28 (v4) | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Protein ID | Sample Taxon ID | Habitat | Sequence |
B570J29032_1092140382 | 3300002408 | Freshwater | MATTTNYGWTTPDDTDLVKDGAAAIRTLGSSVDTTTKNLNPSTT |
B570J29032_1099042283 | 3300002408 | Freshwater | MATTTNYGWTTPDDTSLVKDGAAAIRTLGSSVDTTTKNLNPETTLGDIAYR |
B570J40625_1010669691 | 3300002835 | Freshwater | MANTTNYNWETPDDTDLVKDGAAAIRTLGNSVDTTTKALNPETTLGDIAYRS |
JGI25907J50239_10034481 | 3300003394 | Freshwater Lake | MATTTNYGWTTPDDTALVKDGASAIRTLGSSVDTTTKNLN |
JGI25924J51412_10457412 | 3300003491 | Freshwater Lake | MATTTNYGWTTPDDTALVKDGASAIRTLGSSVDTTTKNLNPE |
JGI25925J51416_101436502 | 3300003497 | Freshwater Lake | MATTTNYGWTTPDDTALVKDGAAAIRTLGSSIDTTTKALNPS |
Ga0063232_102778642 | 3300004054 | Freshwater Lake | MATTTNYGWTTPDDTALVKDGASAIRTLGSSVDTTTKALNPET |
Ga0049081_101274412 | 3300005581 | Freshwater Lentic | MATTTNYNWETPDDTDLVKDGAAAIRTLGNSVDTTTKALNPETTL |
Ga0049081_103445192 | 3300005581 | Freshwater Lentic | MANTTNYNWETPDDTDLVKDGAAAIRTLGNSVDTTTKALNPETTL |
Ga0070744_101926431 | 3300006484 | Estuarine | MATTTNYGWTTPDDTALVKDGAAAIRTLGTSVDTTTKN |
Ga0075464_101517012 | 3300006805 | Aqueous | MATTTNFNWSTPDDTSLVKDGAAAIRTLGSSIDTSFVDLKGG |
Ga0075464_105306531 | 3300006805 | Aqueous | MPSTTNFGWTTPADTDYVKDGASAIRTLANGIDTSMA |
Ga0075464_109739512 | 3300006805 | Aqueous | MATTTNYGWTTPDDTALVKDGAAAIRTLGSSVDTTTKNLNPETTLG |
Ga0075472_100389521 | 3300006917 | Aqueous | MASTTNYGWSTPDDTSLVKDGASAIRTLGSSIDTTTKALNPE |
Ga0070748_11047902 | 3300006920 | Aqueous | MATTTNYGWTTPDDTDLVKDGAAAIRTLGSSVDTTTK |
Ga0079302_10764822 | 3300007165 | Deep Subsurface | MATTTNYGWTTPNDTDLVKDGAAAIRTLGSSIDTTTKALNPSTTLGDLEYRSA |
Ga0103959_11094871 | 3300007214 | Freshwater Lake | MPTTTNYGWTTPADTDLVKDGASAIRTLGTSIDTTTKNL |
Ga0075460_100069707 | 3300007234 | Aqueous | MATTTNYSWTTPDDTDLVKDGAAAIRTLGSSADTT |
Ga0099851_10488273 | 3300007538 | Aqueous | MATTTNYNWATPDDTDLVKDGASAIRTLGSSADTTVKNLNPGTTAG |
Ga0099848_10964862 | 3300007541 | Aqueous | MANTTNFGWTTPDDTDLVKDGAAAIRTLGSAIDTSLVDL |
Ga0102828_11588502 | 3300007559 | Estuarine | MATTTNYGWTTPDDTALVKDGADAIRTLGTSVDTTT |
Ga0105747_11496811 | 3300007974 | Estuary Water | MATTTNYGWTTPDNTALVKDGAAAIRTLGSSVDTTTKALNPS |
Ga0075480_105757771 | 3300008012 | Aqueous | MANTTNFNWETPDDTDLVKDGAAAIRTLGNSIDTSFVDLKG |
Ga0114347_11314241 | 3300008114 | Freshwater, Plankton | MATTTNYNWSTPDDTALVKDGAAAIRTLGSSIDTTTKALNPSTTLGDIEY |
Ga0114351_10469374 | 3300008117 | Freshwater, Plankton | MATTTNYSWSTPDDTALVKDGAAAIRSLGTAIDSTVFTNAG |
Ga0114354_10846612 | 3300008119 | Freshwater, Plankton | MATTTNYGWVTPDDTALVKDGASAIRTLGSSVDTT |
Ga0114355_12268311 | 3300008120 | Freshwater, Plankton | MPTTSNFGWTTPADTDLVKDGAAAIRTLGNGIDTSFL |
Ga0114353_12249192 | 3300008264 | Freshwater, Plankton | MATTTNYGWDTPDDTDLVKDGAAAIRTLGSSVDTPTKNLNPQTTTGALAYRS |
Ga0114361_11382782 | 3300008265 | Freshwater, Plankton | MATTTNYSWTTPDDTALVKDGASAIRSLGTAIDTTT |
Ga0114361_11837752 | 3300008265 | Freshwater, Plankton | MATTTNYGWTTPDDTSLVKDGASAIRTLGSAIDTSLVD |
Ga0114361_11926771 | 3300008265 | Freshwater, Plankton | MANTTNYNWETPDDTDLVKDGAAAIRTLGNSIDTTTKALNPQTTLGDIAY |
Ga0114363_10502571 | 3300008266 | Freshwater, Plankton | MATTTNFGWETPDDTDLVKDGAAAMRTLGSAIDTSLV |
Ga0114363_11862632 | 3300008266 | Freshwater, Plankton | MATTTNYGWTTPNDTDLVKDGAAAIRTLGSSIDTTTKALNP |
Ga0114363_12046342 | 3300008266 | Freshwater, Plankton | MPTTTNYSWTTPADTDLVKDGAAAIRTLGTAIDTTVFN |
Ga0114363_12151961 | 3300008266 | Freshwater, Plankton | MATTTNYGWETPDDTDLVKDGAAAIRTLGSSVDTTTKALNPSTTLGD |
Ga0114878_11647721 | 3300008339 | Freshwater Lake | MANTTNFNWETPDDTDLVKDGAAAIRTLGNSIDTS |
Ga0114876_11848821 | 3300008448 | Freshwater Lake | MATTTNYGWTTPNDTDLVKDGAAAIRTLGSSIDTTTKALNPSTTLGDIE |
Ga0114880_10818741 | 3300008450 | Freshwater Lake | MANTTNFGWETPDDTDLVKDGAAAMRTLGNSIDSSF |
Ga0114880_11089392 | 3300008450 | Freshwater Lake | MATTTNYSWSTPDDTALVKDGAAAIRTLGSSIDTTTK |
Ga0114880_12369221 | 3300008450 | Freshwater Lake | MANTTNYNWETPDDSDLVKDGAAAIRTLGNSIDTTTKNLNPETTTGDIAYRS |
Ga0105105_107539042 | 3300009009 | Freshwater Sediment | MASTTNYSWTTPDDTALVKDGAAAIRSLGSAIDTTTKALNPSTTLGDIEYRS |
Ga0105099_102120942 | 3300009082 | Freshwater Sediment | MATTTNYGWETPDDTDLVKDGAAAIRTLGNSIDTTMA |
Ga0105103_105792581 | 3300009085 | Freshwater Sediment | MATTTNFGWTTPDNTGYVKDGALAIRTLGSAIDSTL |
Ga0114981_102564312 | 3300009160 | Freshwater Lake | MATTTNYSWTTPDDTALVKDGASAIRALGTAIDTSM |
Ga0105104_101281411 | 3300009168 | Freshwater Sediment | MATTTNYGWTTPNDTDLVKDGAAAIRTLGSSVDTTTKAL |
Ga0105097_102040572 | 3300009169 | Freshwater Sediment | MATTTNYSWTTPDDTSLVKDGAAAIRSLGTSIDTTTKA |
Ga0105097_105511732 | 3300009169 | Freshwater Sediment | MANTTYFGWETPDDTDLVKDGAAAIRTLGQAIDTSM |
Ga0114979_102819452 | 3300009180 | Freshwater Lake | MATTTNYGWTTPDDTALVKDGAAAIRTLGTSVDTTTKNLNPET |
Ga0114974_105916362 | 3300009183 | Freshwater Lake | MATTTNYGWTTPDDTALVKDGAAAIRTLGSSVDTTT |
Ga0136655_11258601 | 3300010316 | Freshwater To Marine Saline Gradient | MATTTNFGWDTPDDTDLVKDGALAIRTLGSSIDTSFVD |
Ga0129336_100364883 | 3300010370 | Freshwater To Marine Saline Gradient | MPTTSNFGWTTPADTDLVKDGAAAIRTLGNGIDTSF |
Ga0129336_103154061 | 3300010370 | Freshwater To Marine Saline Gradient | MANTTNFGWETPDDTDLVKDGAAAMRTLGNSIDTS |
Ga0153799_10256282 | 3300012012 | Freshwater | MATTTNYGWTTPDDTALVKDGASAIRTLGSSVDTTTKNLNPET |
Ga0153805_10419742 | 3300012013 | Surface Ice | MATTTNYGWTTPNDTDLVKDGAAAIRTLGSSVDTTTKALNPS |
Ga0153801_10287291 | 3300012017 | Freshwater | MATTTNYSWETPDDTDLVKDGAAAIRTLGSSIDTTTKALN |
Ga0153801_10423821 | 3300012017 | Freshwater | MANTTNFNWETPDDTDLVKDGAAAIRTLAGAIDTS |
Ga0157210_10228251 | 3300012665 | Freshwater | MANTTNYNWETPDDTDLVKDGAAAIRTLGSSIDTTTKNLNPQTTTGALAYR |
Ga0164292_108772092 | 3300013005 | Freshwater | MATTTNYGWTTPDDTALVKDGASAIRTLGSSIDSTLKTQIDA |
Ga0177922_100997792 | 3300013372 | Freshwater | MANTANFGWETPDDTDLVKDGAASIRTLGSAIDTSM |
Ga0177922_110606523 | 3300013372 | Freshwater | MATTTNYGWTTPDDTALVKDGASAIRSLGSSVDTTVKNLN |
Ga0119960_11015332 | 3300014811 | Aquatic | MATTTNYGWTTPDDTALVKDGAAAIRTLGSSVDTTPKDRDWE |
Ga0181364_10246741 | 3300017701 | Freshwater Lake | MATTTNYGWDTPDDTDLVKDGAAAIRTLGSSVDTTTKN |
Ga0181347_10624892 | 3300017722 | Freshwater Lake | MATTTNYGWDTPDDTDLVKDGAAAIRTLGSSVDTTTKNLN |
Ga0181347_10711892 | 3300017722 | Freshwater Lake | MANTTNYNWETPDDTDLVKDGAAAIRTLGSSVDTTTKALNPSTTLGDIE |
Ga0181347_10962311 | 3300017722 | Freshwater Lake | MATTTNYSWETPDDTDLVKDGAAAIRTLGSSIDTTTKNLNPQTTTGAI |
Ga0181362_10386572 | 3300017723 | Freshwater Lake | MATTTNYGWTTPHDTALVKDGAAAIRTLGSSVDTNTKNLNPE |
Ga0181344_11171222 | 3300017754 | Freshwater Lake | MATTTNYGWTTPDDTALVKDGASAIRTLGSSIDTTTK |
Ga0181344_11951762 | 3300017754 | Freshwater Lake | MATTTNYGWDTPDDTDLVKDGAAAIRTLGSSVDTTTKNL |
Ga0181356_11110842 | 3300017761 | Freshwater Lake | MATTTNNGWTTPDNTALVKDGASAIRTLGQAIDTTLGV |
Ga0181356_12353032 | 3300017761 | Freshwater Lake | MANTTNYNWETPDDTDLVKDGAAAIRTLGSSIDTTTKALNPS |
Ga0181358_10369673 | 3300017774 | Freshwater Lake | MPTTTNNGWTTPADTDLVKNGASAIRTLGNAIDSTLGVYVAST |
Ga0181358_11391142 | 3300017774 | Freshwater Lake | MATTTNYGWSTPDDTALVKDGAAAIRTLGSSVDTTTKNLNPQTTTGALAYR |
Ga0181357_12425371 | 3300017777 | Freshwater Lake | MATTTNYGWTTPDDTALVKDGAAAIRTLGSSVDTTTKN |
Ga0181349_12674592 | 3300017778 | Freshwater Lake | MATTTNYGWDTPDDTDLVKDGAAAIRTLGSSVDTTTKNLNPQTTTGALAYRSA |
Ga0181349_12826772 | 3300017778 | Freshwater Lake | MANTTNYNWETPDDTDLVKDGAAAIRTLGSSVDTT |
Ga0181346_11789442 | 3300017780 | Freshwater Lake | MATTTNYGWTTPDDTSLVKDGASAIRTLGTAIDTTTFNNASA |
Ga0181346_12287801 | 3300017780 | Freshwater Lake | MATTTNFGWETPDDTDLVKDGALAMRTLGNAIDTSLV |
Ga0181348_11024952 | 3300017784 | Freshwater Lake | MATTTNYGWDTPDDTDLVKDGAAAIRTLGSSVDTTTKNLNPQT |
Ga0180430_110108552 | 3300018065 | Hypersaline Lake Sediment | MATTANYSWPTPDDTDLVRDGAAAIRALGSAAAAT |
Ga0181553_104962712 | 3300018416 | Salt Marsh | MPSTTNFSWTTPADTDYVKDGASAIRTLANGIDTSMAQL |
Ga0181359_11394622 | 3300019784 | Freshwater Lake | MATTTNYGWSTPDDTALVKDGAAAIRTLGSSVDTTTKNLNPQT |
Ga0181359_11946031 | 3300019784 | Freshwater Lake | MANTTNYNWETPDDTDLVKDGAAAIRTLGNSVDTTTKALNPETTLGDIAY |
Ga0181359_12399802 | 3300019784 | Freshwater Lake | MPTTTNNGWTTPADTALVKDGASAIRTLGNNIDST |
Ga0211735_100970492 | 3300020162 | Freshwater | MATTTNYGWTTPDDTSLVKDGASAIRTLGTSVDTTTKNLNPS |
Ga0211729_106902392 | 3300020172 | Freshwater | MANTTNYNWETPDDTDLVKDGAAAIRTLGNSIDTTTKNLNPETTTGD |
Ga0208591_10219452 | 3300020493 | Freshwater | MATTTNNGWETPDDTDLVKDGALAMRTLGQAIDTSVGTG |
Ga0208091_10013976 | 3300020506 | Freshwater | MANTTNFGWETPDDTDLVKDGAAAIRTLGSAIDTSLADLEGG |
Ga0208091_10288751 | 3300020506 | Freshwater | MATTTNYSWSTPDDTALVKDGAAAIRTLGSSADTTVKALNPGTTAG |
Ga0208233_10066831 | 3300020529 | Freshwater | MANTTNYNWETPDDTDLVKDGAAAIRTLGSSIDTTTKN |
Ga0208235_100077210 | 3300020530 | Freshwater | MATTTNYSWTTPDDTALVKDGALAIRTLGSSVDTTVKN |
Ga0208855_10372771 | 3300020553 | Freshwater | MATTTNYGWTTPDDTALVKDGAAAIRTLGSSVDTTTK |
Ga0208231_10108651 | 3300020557 | Freshwater | MANTTNFGWETPDDTDLVKDGAAAIRTLGSAIDTS |
Ga0208723_10333491 | 3300020571 | Freshwater | MATTTNYSWTTPDDTDLVKDGAAAIRTLGSSVDTTTKA |
Ga0222714_105500481 | 3300021961 | Estuarine Water | MASTTNYSWTTPDDTSLVKDGAAAIRTLGSSIDTTTKALNPSTTLGDIE |
Ga0181354_10266303 | 3300022190 | Freshwater Lake | MATTTNYGWTTPDDTALVKDGASAIRTLGTSVDTTTKNLNPET |
Ga0181354_10667162 | 3300022190 | Freshwater Lake | MATTTNYGWDTPDDTDLVKDGAAAIRTLGSSVDTTTKNLNPQTT |
Ga0181354_11847672 | 3300022190 | Freshwater Lake | MANTTNYNWETPDDTDLVKDGAAAIRTLGSSVDTTTK |
Ga0196905_10464532 | 3300022198 | Aqueous | MASTTNYSWTTPDDTDLVKDGAAAIRTLGSSADTTV |
Ga0196905_11320972 | 3300022198 | Aqueous | MATTTNYSWTTPDDTDLVKDGASAIRTLGSSADTTLKALNPGT |
Ga0196901_10399053 | 3300022200 | Aqueous | MATTTNYNWATPDDSDLLKDGASAIRTLGSSADTTVKNLNPGTT |
Ga0208147_11229282 | 3300025635 | Aqueous | MATTTNYGWTTPNDTDLVKDGAAAIRTLGSSVDTTTKALNPETTL |
Ga0208643_11716871 | 3300025645 | Aqueous | MATTTNYSWSTPDDTSLVKDGAAAIRTLGSSIDTTTKALNPSTTLGDIEYR |
Ga0208160_11208131 | 3300025647 | Aqueous | MATTTNYAWETPDDTDLVKDGAAAIRTLGSSIDTTTKALNPS |
Ga0208795_11224301 | 3300025655 | Aqueous | MATTTNFGWTTPDDTDLVKDGAAAIRTLGSAIDTSLVDLKGG |
Ga0208783_100577443 | 3300025872 | Aqueous | MPTTTNNGWTTPADTDIVRNGAQAMRTLGNNIDASIGKL |
Ga0255090_10616292 | 3300027123 | Freshwater | MANTTNYNWETPDDTDLVKDGAAAIRTLGSSIDTTTKNLNPQTTT |
Ga0255066_10334382 | 3300027131 | Freshwater | MATTTNYSWETPDDTDLVKDGAAAIRTLGSSIDTTTK |
Ga0255107_10008271 | 3300027136 | Freshwater | MATTTNYGWSTPDNTAYVKDGASAIRTLGSAIDTTA |
Ga0255063_10169153 | 3300027151 | Freshwater | MATTTNYGWTTPDDTALVKDGASAIRTLGTSVDTTTKNL |
Ga0255078_10550481 | 3300027156 | Freshwater | MANTTNYNWETPDDTDLVKDGAAAIRTLGSSIDTT |
Ga0208966_11544481 | 3300027586 | Freshwater Lentic | MATTTNYGWTTPDDTALVKDGASAIRTLGSSVDTTTKNLNPETT |
Ga0209769_12474282 | 3300027679 | Freshwater Lake | MATTTNYGWTTPDDTALVKDGAAAIRTLGSSVDTTTKNLNPETT |
Ga0209553_10682731 | 3300027688 | Freshwater Lake | MATTTNYGWETPDDTDLVKDGAAAIRTLGNSVDTTTKAL |
Ga0209033_10863112 | 3300027697 | Freshwater Lake | MATTTNYGWDTPDDTDLVKDGAAAIRTLGSSIDTT |
Ga0209444_101709161 | 3300027756 | Freshwater Lake | MANTTNYNWETPDDTDLVKDGAAAIRTLGSSIDTTTK |
Ga0209296_12264561 | 3300027759 | Freshwater Lake | MATTTNYGWATPDDTALVKDGAAAIRTLGTSVDTTTKNLNPSTTLGDIEYR |
Ga0209134_100556791 | 3300027764 | Freshwater Lake | MATTTNYGWTTPDDTALVKDGAAAIRTLGSSVDTTTKNLNPE |
Ga0209134_101896551 | 3300027764 | Freshwater Lake | MATTTNYSWTTPDDTALVKDGAAAIRSLGTAIDTTVF |
Ga0209134_102449811 | 3300027764 | Freshwater Lake | MATTTNYGWTTPDDTALVKDGAAAIRTLGSSVDTTTKALNPST |
Ga0209500_102486101 | 3300027782 | Freshwater Lake | MATTTNYGWTTPNDTDYVYQGAAAIRTTANSIDTTVYSLPQ |
Ga0209246_101699212 | 3300027785 | Freshwater Lake | MATTTNYGWSTPDDTALVKDGAAAIRTLGSSVDTTTKNLNPQTTTGALAYRS |
Ga0209287_102290631 | 3300027792 | Freshwater Sediment | MATTTNYAWETPDDTDLVKDGAAAIRTLGSSIDTTT |
Ga0209353_103097301 | 3300027798 | Freshwater Lake | MATTTNYGWTTPDDTALVKDGAAAIRTLGSSVDTT |
Ga0209354_100133021 | 3300027808 | Freshwater Lake | MATTTNYGWTTPDDTSLVKDGASAIRTLGTAIDTTTFNNAS |
Ga0209354_102756492 | 3300027808 | Freshwater Lake | MATTTNYGWTTPDDTALVKDGASAIRTLGSSVDTTTKALNP |
Ga0209550_100489775 | 3300027892 | Freshwater Lake | MANTTNFNWETPDDTDLVKDGAAAIRTLAGAIDTSL |
Ga0209550_108430512 | 3300027892 | Freshwater Lake | MATTTNYGWETPDDTGLVKDGAAAIRTLGSSVDTT |
Ga0209400_11030903 | 3300027963 | Freshwater Lake | MATTTNFGWSTPDDSANVKDGAAAIRSLGTAVDTTVATMVPKT |
Ga0209298_101918741 | 3300027973 | Freshwater Lake | MATTTNFLWATPDDTALVKNGASAIRTLGSSADSTVQ |
Ga0247723_10545421 | 3300028025 | Deep Subsurface Sediment | MATTTNYGWTTPDDTALVKDGAAAIRTLGSSVDTTTKALN |
Ga0255193_10163972 | 3300028269 | Freshwater | MATTTNYSWTTPDDTDLVKDGAAAIRTLGSSADTTVKN |
Ga0304730_10373641 | 3300028394 | Freshwater Lake | MATTTNYGWTTPDDTALVKDGASAIRTLGSSVDTTTKNLNPETTLGDISYR |
Ga0304730_10956882 | 3300028394 | Freshwater Lake | MATTTNNGWTTPNDTDLVRNGASAIRSLGSAIDSSLGKASY |
Ga0304730_13383882 | 3300028394 | Freshwater Lake | MATTTNYGWTTPDDTGLVKDGASAIRTLGTSVDTTTKNL |
Ga0304730_13385001 | 3300028394 | Freshwater Lake | MATTTNYSWTTPDDTALVKDGASAIRTLGTSIDTTTKNLNPS |
(restricted) Ga0247839_10724803 | 3300028553 | Freshwater | MATTTNYGWTTPDDTALVKDGASAIRTLGSSVDTTTKNLNPETTLG |
Ga0307378_111863851 | 3300031566 | Soil | MATTTNYSWTTPDDTDLVKDGAAAIRTLGSSADTTVKA |
Ga0307377_102951542 | 3300031673 | Soil | MATTTNYSWTTPDDTDLVKDGASAIRTLGSAIDTTVF |
Ga0315907_102104793 | 3300031758 | Freshwater | MATTTNYAWETPDDTDLVKDGAAAIRTLGSSIDTTTKALNPSTTLGDIEY |
Ga0315907_103821972 | 3300031758 | Freshwater | MATTTNYSWTTPDDTALVKDGAAAIRSLGTAIDTTVFTNAG |
Ga0315909_1001084311 | 3300031857 | Freshwater | MATTTNYGWTTPNDTDLVKDGAAAIRTLGSSIDTTTK |
Ga0315909_104543131 | 3300031857 | Freshwater | MATTTNYGWTTPDDTSLVKDGASAIRSLGTAIDTTTK |
Ga0315909_107505492 | 3300031857 | Freshwater | MANTTNFNWETPDDTDLVKDGAAAIRTLGSAIDTSLVDLK |
Ga0315904_102211431 | 3300031951 | Freshwater | MATTTNYGWTTPNDTDLVKDGASAIRTLGSSIDTTVF |
Ga0315904_104951292 | 3300031951 | Freshwater | MPSTTNFGWTTPADTDLVKDGAAAIRTLGNGIDTSFL |
Ga0315904_112667022 | 3300031951 | Freshwater | MATTTNYGWTTPNDTDLVKDGAAAIRTLGSSIDTTTKALNPST |
Ga0315901_105917701 | 3300031963 | Freshwater | MATTTNYGWTTPNDTDLVKDGAAAIRTLGSSIDTTT |
Ga0315901_110391861 | 3300031963 | Freshwater | MATTTNYGWTTPDDTALVKDGAAAIRTLGSSVDTTTKA |
Ga0315289_112534151 | 3300032046 | Sediment | MATTTNYGWTTPDDTALVKDGASAIRTLGSSVDTTTKNLNPETTLGD |
Ga0315289_112539051 | 3300032046 | Sediment | MASTTNYSWVTPDDTSLVKDGASAIRTLGSSVDTTTKNLNP |
Ga0315903_107630612 | 3300032116 | Freshwater | MATTTNYGWTTPDDTALVKDGASAIRSLGTAIDTTTKNLNPSTTLGDIEYRSA |
Ga0315277_107513732 | 3300032118 | Sediment | MATTTNYSWTTPDDTALVKDGASAIRSLGTAIDTTTYN |
Ga0315268_123247272 | 3300032173 | Sediment | MATTTNYGWTTPDDTALVKDGASAIRTLGTSVDTTTK |
Ga0316616_1029378152 | 3300033521 | Soil | MANTTNFNWETPDDTDLVKDGAAAIRTLGNSIDTSFV |
Ga0316616_1041484841 | 3300033521 | Soil | MASTTNYNWTTPDDTDLVKNGASAIRSLGSSVDTALWSAGYQAG |
Ga0334980_0303511_497_619 | 3300033816 | Freshwater | MATTTNYSWTTPDDTALVKDGAAAIRSLGTAIDSTVFTNAG |
Ga0334982_0269455_2_109 | 3300033981 | Freshwater | MANTTNYNWETPDDTDLVKDGAAAIRTLGSSVDTTT |
Ga0334979_0155771_2_151 | 3300033996 | Freshwater | MATTTNFGWTTPDNTGYVKDGALAIRTLGSAIDSTLYDLDRVGQVVQTTG |
Ga0334986_0521045_430_579 | 3300034012 | Freshwater | MATTTNYGWTTPDDTALVKDGAAAIRTLGSSVDTTTKNLNPETTLGDIAY |
Ga0335004_0344562_732_863 | 3300034021 | Freshwater | MATTTNYSWSTPDDTALVKDGAAAIRTLGSSADTTVKALNPGTT |
Ga0335005_0243268_2_115 | 3300034022 | Freshwater | MATTTNYGWTTPDDTDLVKDGASAIRTLGSSIDTSVKS |
Ga0335021_0296532_747_869 | 3300034023 | Freshwater | MANTTNYNWETPDDTDLVKDGAAAIRTLGNSVDTTTKALNP |
Ga0334987_0351697_2_115 | 3300034061 | Freshwater | MATTTNYGWTTPDDTDLVKNGADAIRVLGASIDTSMNT |
Ga0334995_0040647_3774_3893 | 3300034062 | Freshwater | MATTTNYSWSTPDDTALVKDGAAAIRSLGTAIDSTVFTNA |
Ga0334995_0240484_3_125 | 3300034062 | Freshwater | MATTTNYSWSTPDDTALVKDGAAAIRSLGTAIDTTVFTNAG |
Ga0334995_0476232_652_756 | 3300034062 | Freshwater | MATTTNFGWSTPDDSANVKDGAAAIRSLGTAIDTS |
Ga0334995_0684672_1_105 | 3300034062 | Freshwater | MATTPTYGWETPDDTDYVNQGALAMRTLGNSIDST |
Ga0334995_0743882_3_122 | 3300034062 | Freshwater | MATTTNYSWTTPDDTALVKDGAAAIRSLGTAIDSTVFTNA |
Ga0335028_0531158_1_135 | 3300034071 | Freshwater | MATTTNYSWETPDDTDLVKDGAAAIRTLGSSIDTTTKALNPSTTL |
Ga0310130_0234499_417_575 | 3300034073 | Fracking Water | MATTTNYSWTTPDDTDLVKDGASAIRTLGSSADTTVKNLNPGTTAGDIDYYTS |
Ga0335010_0322261_773_877 | 3300034092 | Freshwater | MATTTNYSWSTPDDTALVKDGAAAIRSLGTAIDST |
Ga0335031_0102451_3_110 | 3300034104 | Freshwater | MANTTNFNWETPDDTDLVKDGAAAIRTLGSAIDTSL |
Ga0335031_0156828_2_142 | 3300034104 | Freshwater | MATTTNYGWDTPDDTDLVKDGAAAIRTLGSSIDTTTKNLNPQTTTGA |
Ga0335031_0736986_426_560 | 3300034104 | Freshwater | MATTTNYGWTTPDDTALVKDGAAAIRTLGSSIDTTTKALNPSTTL |
Ga0335035_0239044_990_1097 | 3300034105 | Freshwater | MATTTNYGWDTPDDTDLVKDGAAAIRTLGSSIDTTT |
Ga0335035_0457903_586_708 | 3300034105 | Freshwater | MATTTNYGWDTPDDTDLVKDGAAAIRTLGSSIDTTTKNLNP |
Ga0335036_0554773_1_144 | 3300034106 | Freshwater | MANTTNYNWETPDDTDLVKDGAAAIRTLGSSVDTTTKALNPSTTLGDI |
Ga0335066_0181496_1_123 | 3300034112 | Freshwater | MATTTNYAWETPDDTDLVKDGAAAIRTLGSSIDTTTKALNP |
Ga0335053_0106080_3_107 | 3300034118 | Freshwater | MATTTNYGWTTPDNTDLVKDGALAIRTLGSSVDTT |
Ga0335053_0170283_3_158 | 3300034118 | Freshwater | MANTTNYNWETPDDTDLVKDGAAAIRTLGSSIDTTTKNLNPQTTTGALAYRS |
Ga0335054_0145551_2_163 | 3300034119 | Freshwater | MATTTNYSWSTPDDTALVKDGALAIRTLGSSVDTTVKNLNPETTTGAISYRGAT |
Ga0335016_0549948_525_638 | 3300034166 | Freshwater | MANTTNYNWETPDDTDLVKDGAAAIRTLGSSVDTTTKA |
Ga0335065_0565525_1_126 | 3300034200 | Freshwater | MATTTNYGWTTPDDTALVKDGAAAIRTLGSSVDTTTKALNPS |
Ga0335007_0696808_464_568 | 3300034283 | Freshwater | MATTTNFGWETPDDTDLVKDGAAAMRTLGNSIDTS |
Ga0348337_058112_1_165 | 3300034418 | Aqueous | MATTTNYSWTTPDDTDLVKDGASAIRTLGSSVDTTVKDLNPGTTAGDIDYYTSST |
⦗Top⦘ |