| Basic Information | |
|---|---|
| Family ID | F030420 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 185 |
| Average Sequence Length | 40 residues |
| Representative Sequence | VVLGEDLRDLGAAVAVRVVRALGGSVELDGETLTVKLPE |
| Number of Associated Samples | 154 |
| Number of Associated Scaffolds | 185 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.54 % |
| % of genes near scaffold ends (potentially truncated) | 97.30 % |
| % of genes from short scaffolds (< 2000 bps) | 96.22 % |
| Associated GOLD sequencing projects | 150 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.62 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (88.108 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (17.297 % of family members) |
| Environment Ontology (ENVO) | Unclassified (26.486 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (56.757 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 26.87% β-sheet: 14.93% Coil/Unstructured: 58.21% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.62 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 185 Family Scaffolds |
|---|---|---|
| PF01070 | FMN_dh | 26.49 |
| PF00265 | TK | 11.89 |
| PF13637 | Ank_4 | 8.65 |
| PF12796 | Ank_2 | 7.57 |
| PF06831 | H2TH | 7.57 |
| PF00571 | CBS | 4.86 |
| PF01149 | Fapy_DNA_glyco | 2.70 |
| PF07883 | Cupin_2 | 2.16 |
| PF00561 | Abhydrolase_1 | 2.16 |
| PF01797 | Y1_Tnp | 1.62 |
| PF12697 | Abhydrolase_6 | 1.62 |
| PF13570 | PQQ_3 | 1.62 |
| PF00903 | Glyoxalase | 1.08 |
| PF01047 | MarR | 1.08 |
| PF01370 | Epimerase | 1.08 |
| PF03061 | 4HBT | 0.54 |
| PF13453 | zf-TFIIB | 0.54 |
| PF02126 | PTE | 0.54 |
| PF07690 | MFS_1 | 0.54 |
| PF00512 | HisKA | 0.54 |
| PF13460 | NAD_binding_10 | 0.54 |
| PF13360 | PQQ_2 | 0.54 |
| PF00848 | Ring_hydroxyl_A | 0.54 |
| PF13565 | HTH_32 | 0.54 |
| PF01636 | APH | 0.54 |
| PF04542 | Sigma70_r2 | 0.54 |
| PF13493 | DUF4118 | 0.54 |
| PF12680 | SnoaL_2 | 0.54 |
| PF00583 | Acetyltransf_1 | 0.54 |
| PF00023 | Ank | 0.54 |
| PF13857 | Ank_5 | 0.54 |
| COG ID | Name | Functional Category | % Frequency in 185 Family Scaffolds |
|---|---|---|---|
| COG0069 | Glutamate synthase domain 2 | Amino acid transport and metabolism [E] | 26.49 |
| COG1304 | FMN-dependent dehydrogenase, includes L-lactate dehydrogenase and type II isopentenyl diphosphate isomerase | Energy production and conversion [C] | 26.49 |
| COG1435 | Thymidine kinase | Nucleotide transport and metabolism [F] | 11.89 |
| COG0266 | Formamidopyrimidine-DNA glycosylase | Replication, recombination and repair [L] | 10.27 |
| COG1943 | REP element-mobilizing transposase RayT | Mobilome: prophages, transposons [X] | 1.62 |
| COG4638 | Phenylpropionate dioxygenase or related ring-hydroxylating dioxygenase, large terminal subunit | Inorganic ion transport and metabolism [P] | 1.08 |
| COG0568 | DNA-directed RNA polymerase, sigma subunit (sigma70/sigma32) | Transcription [K] | 0.54 |
| COG1191 | DNA-directed RNA polymerase specialized sigma subunit | Transcription [K] | 0.54 |
| COG1595 | DNA-directed RNA polymerase specialized sigma subunit, sigma24 family | Transcription [K] | 0.54 |
| COG1735 | Predicted metal-dependent hydrolase, phosphotriesterase family | General function prediction only [R] | 0.54 |
| COG4941 | Predicted RNA polymerase sigma factor, contains C-terminal TPR domain | Transcription [K] | 0.54 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 88.11 % |
| Unclassified | root | N/A | 11.89 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2124908016|OU_2_1_1_newblercontig96170 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 581 | Open in IMG/M |
| 2170459021|G14TP7Y01DTQAM | Not Available | 616 | Open in IMG/M |
| 3300000881|JGI10215J12807_1042522 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales | 1407 | Open in IMG/M |
| 3300000956|JGI10216J12902_113543720 | All Organisms → cellular organisms → Bacteria | 909 | Open in IMG/M |
| 3300002568|C688J35102_120982014 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 5106 | Open in IMG/M |
| 3300004114|Ga0062593_100816571 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 930 | Open in IMG/M |
| 3300004153|Ga0063455_100176581 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1022 | Open in IMG/M |
| 3300004479|Ga0062595_100801787 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 776 | Open in IMG/M |
| 3300004479|Ga0062595_101118048 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 691 | Open in IMG/M |
| 3300004479|Ga0062595_102126602 | All Organisms → cellular organisms → Bacteria | 547 | Open in IMG/M |
| 3300004479|Ga0062595_102322918 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 529 | Open in IMG/M |
| 3300004643|Ga0062591_101852927 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 617 | Open in IMG/M |
| 3300004643|Ga0062591_102307776 | Not Available | 562 | Open in IMG/M |
| 3300005177|Ga0066690_10667909 | All Organisms → cellular organisms → Bacteria | 691 | Open in IMG/M |
| 3300005179|Ga0066684_10414631 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 905 | Open in IMG/M |
| 3300005294|Ga0065705_10350637 | All Organisms → cellular organisms → Bacteria | 956 | Open in IMG/M |
| 3300005355|Ga0070671_100464113 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1087 | Open in IMG/M |
| 3300005355|Ga0070671_101776563 | All Organisms → cellular organisms → Bacteria | 548 | Open in IMG/M |
| 3300005434|Ga0070709_11333107 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 579 | Open in IMG/M |
| 3300005436|Ga0070713_100962252 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 823 | Open in IMG/M |
| 3300005438|Ga0070701_10643144 | All Organisms → cellular organisms → Bacteria | 707 | Open in IMG/M |
| 3300005445|Ga0070708_100716397 | All Organisms → cellular organisms → Bacteria | 941 | Open in IMG/M |
| 3300005459|Ga0068867_101273799 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 678 | Open in IMG/M |
| 3300005471|Ga0070698_101017897 | All Organisms → cellular organisms → Bacteria | 776 | Open in IMG/M |
| 3300005529|Ga0070741_10751448 | All Organisms → cellular organisms → Bacteria | 855 | Open in IMG/M |
| 3300005530|Ga0070679_100793971 | All Organisms → cellular organisms → Bacteria | 890 | Open in IMG/M |
| 3300005538|Ga0070731_10374814 | Not Available | 946 | Open in IMG/M |
| 3300005540|Ga0066697_10755609 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 530 | Open in IMG/M |
| 3300005548|Ga0070665_102528330 | All Organisms → cellular organisms → Bacteria | 515 | Open in IMG/M |
| 3300005549|Ga0070704_100262368 | All Organisms → cellular organisms → Bacteria | 1424 | Open in IMG/M |
| 3300005553|Ga0066695_10494731 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 752 | Open in IMG/M |
| 3300005554|Ga0066661_10164673 | All Organisms → cellular organisms → Bacteria | 1362 | Open in IMG/M |
| 3300005555|Ga0066692_10819243 | All Organisms → cellular organisms → Bacteria | 572 | Open in IMG/M |
| 3300005556|Ga0066707_10641691 | All Organisms → cellular organisms → Bacteria | 673 | Open in IMG/M |
| 3300005561|Ga0066699_10830907 | All Organisms → cellular organisms → Bacteria | 649 | Open in IMG/M |
| 3300005568|Ga0066703_10236927 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1109 | Open in IMG/M |
| 3300005568|Ga0066703_10642904 | All Organisms → cellular organisms → Bacteria | 614 | Open in IMG/M |
| 3300005575|Ga0066702_10889513 | All Organisms → cellular organisms → Bacteria | 531 | Open in IMG/M |
| 3300005587|Ga0066654_10019967 | All Organisms → cellular organisms → Bacteria | 2664 | Open in IMG/M |
| 3300005598|Ga0066706_10749549 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium | 774 | Open in IMG/M |
| 3300005616|Ga0068852_102532889 | All Organisms → cellular organisms → Bacteria | 533 | Open in IMG/M |
| 3300005713|Ga0066905_100375933 | All Organisms → cellular organisms → Bacteria | 1144 | Open in IMG/M |
| 3300005764|Ga0066903_106210190 | Not Available | 624 | Open in IMG/M |
| 3300005764|Ga0066903_107834905 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 549 | Open in IMG/M |
| 3300005888|Ga0075289_1009646 | All Organisms → cellular organisms → Bacteria | 1283 | Open in IMG/M |
| 3300006046|Ga0066652_100229952 | All Organisms → cellular organisms → Bacteria | 1612 | Open in IMG/M |
| 3300006046|Ga0066652_101539394 | Not Available | 614 | Open in IMG/M |
| 3300006058|Ga0075432_10145796 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 906 | Open in IMG/M |
| 3300006604|Ga0074060_11617921 | All Organisms → cellular organisms → Bacteria | 727 | Open in IMG/M |
| 3300006791|Ga0066653_10644582 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 542 | Open in IMG/M |
| 3300006797|Ga0066659_11506158 | Not Available | 563 | Open in IMG/M |
| 3300006852|Ga0075433_10182399 | All Organisms → cellular organisms → Bacteria | 1868 | Open in IMG/M |
| 3300006852|Ga0075433_10728817 | All Organisms → cellular organisms → Bacteria | 868 | Open in IMG/M |
| 3300006904|Ga0075424_100827239 | All Organisms → cellular organisms → Bacteria | 988 | Open in IMG/M |
| 3300006954|Ga0079219_10384959 | Not Available | 921 | Open in IMG/M |
| 3300006954|Ga0079219_12266647 | All Organisms → cellular organisms → Bacteria | 524 | Open in IMG/M |
| 3300007076|Ga0075435_100296881 | All Organisms → cellular organisms → Bacteria | 1381 | Open in IMG/M |
| 3300007076|Ga0075435_100808844 | All Organisms → cellular organisms → Bacteria | 816 | Open in IMG/M |
| 3300009012|Ga0066710_100506688 | All Organisms → cellular organisms → Bacteria | 1820 | Open in IMG/M |
| 3300009012|Ga0066710_100756725 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1486 | Open in IMG/M |
| 3300009038|Ga0099829_10742522 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 815 | Open in IMG/M |
| 3300009090|Ga0099827_10173321 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1779 | Open in IMG/M |
| 3300009090|Ga0099827_11015396 | Not Available | 720 | Open in IMG/M |
| 3300009100|Ga0075418_10434846 | All Organisms → cellular organisms → Bacteria | 1405 | Open in IMG/M |
| 3300009137|Ga0066709_100047419 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 4805 | Open in IMG/M |
| 3300009137|Ga0066709_100626969 | All Organisms → cellular organisms → Bacteria | 1535 | Open in IMG/M |
| 3300009137|Ga0066709_100796787 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1368 | Open in IMG/M |
| 3300009148|Ga0105243_10612041 | All Organisms → cellular organisms → Bacteria | 1050 | Open in IMG/M |
| 3300009162|Ga0075423_12779064 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 536 | Open in IMG/M |
| 3300009177|Ga0105248_11461926 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 774 | Open in IMG/M |
| 3300009817|Ga0105062_1063704 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 691 | Open in IMG/M |
| 3300010152|Ga0126318_11054176 | All Organisms → cellular organisms → Bacteria | 690 | Open in IMG/M |
| 3300010166|Ga0126306_11496622 | Not Available | 560 | Open in IMG/M |
| 3300010326|Ga0134065_10437147 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 533 | Open in IMG/M |
| 3300010335|Ga0134063_10103884 | All Organisms → cellular organisms → Bacteria | 1291 | Open in IMG/M |
| 3300010362|Ga0126377_11348089 | All Organisms → cellular organisms → Bacteria | 786 | Open in IMG/M |
| 3300010364|Ga0134066_10104238 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 828 | Open in IMG/M |
| 3300010371|Ga0134125_12205734 | All Organisms → cellular organisms → Bacteria | 599 | Open in IMG/M |
| 3300010401|Ga0134121_10785035 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 913 | Open in IMG/M |
| 3300010401|Ga0134121_12047377 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 606 | Open in IMG/M |
| 3300011269|Ga0137392_11472634 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 540 | Open in IMG/M |
| 3300012200|Ga0137382_10553618 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 819 | Open in IMG/M |
| 3300012200|Ga0137382_10670420 | All Organisms → cellular organisms → Bacteria | 743 | Open in IMG/M |
| 3300012201|Ga0137365_11248420 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 529 | Open in IMG/M |
| 3300012208|Ga0137376_10948061 | All Organisms → cellular organisms → Bacteria | 738 | Open in IMG/M |
| 3300012356|Ga0137371_10864630 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 688 | Open in IMG/M |
| 3300012356|Ga0137371_11419367 | All Organisms → cellular organisms → Bacteria | 508 | Open in IMG/M |
| 3300012359|Ga0137385_10345777 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 1273 | Open in IMG/M |
| 3300012469|Ga0150984_116412654 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 804 | Open in IMG/M |
| 3300012498|Ga0157345_1047174 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → unclassified Thermoleophilia → Thermoleophilia bacterium | 537 | Open in IMG/M |
| 3300012514|Ga0157330_1059827 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 563 | Open in IMG/M |
| 3300012941|Ga0162652_100098458 | All Organisms → cellular organisms → Bacteria | 522 | Open in IMG/M |
| 3300012951|Ga0164300_10378490 | All Organisms → cellular organisms → Bacteria | 770 | Open in IMG/M |
| 3300012958|Ga0164299_10702271 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 707 | Open in IMG/M |
| 3300012961|Ga0164302_10581357 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 808 | Open in IMG/M |
| 3300012961|Ga0164302_10830023 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 701 | Open in IMG/M |
| 3300012961|Ga0164302_11481865 | All Organisms → cellular organisms → Bacteria | 558 | Open in IMG/M |
| 3300012972|Ga0134077_10219141 | Not Available | 780 | Open in IMG/M |
| 3300012985|Ga0164308_11648809 | Not Available | 593 | Open in IMG/M |
| 3300012987|Ga0164307_10534497 | All Organisms → cellular organisms → Bacteria | 892 | Open in IMG/M |
| 3300012987|Ga0164307_11306325 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 606 | Open in IMG/M |
| 3300012989|Ga0164305_11283876 | Not Available | 639 | Open in IMG/M |
| 3300013105|Ga0157369_10651216 | All Organisms → cellular organisms → Bacteria | 1086 | Open in IMG/M |
| 3300013307|Ga0157372_12978335 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 542 | Open in IMG/M |
| 3300013308|Ga0157375_12461034 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 621 | Open in IMG/M |
| 3300013763|Ga0120179_1143751 | All Organisms → cellular organisms → Bacteria | 519 | Open in IMG/M |
| 3300014166|Ga0134079_10163485 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 907 | Open in IMG/M |
| 3300014166|Ga0134079_10553956 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 564 | Open in IMG/M |
| 3300014488|Ga0182001_10257390 | Not Available | 679 | Open in IMG/M |
| 3300014969|Ga0157376_11961787 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 623 | Open in IMG/M |
| 3300015161|Ga0167623_1013264 | All Organisms → cellular organisms → Bacteria | 2347 | Open in IMG/M |
| 3300015261|Ga0182006_1250610 | Not Available | 581 | Open in IMG/M |
| 3300015356|Ga0134073_10396031 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 519 | Open in IMG/M |
| 3300017656|Ga0134112_10381811 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 579 | Open in IMG/M |
| 3300017657|Ga0134074_1356041 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 541 | Open in IMG/M |
| 3300018032|Ga0187788_10479547 | Not Available | 535 | Open in IMG/M |
| 3300018066|Ga0184617_1133107 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 718 | Open in IMG/M |
| 3300018431|Ga0066655_10692089 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 690 | Open in IMG/M |
| 3300018431|Ga0066655_11417369 | All Organisms → cellular organisms → Bacteria | 505 | Open in IMG/M |
| 3300018433|Ga0066667_11953751 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 537 | Open in IMG/M |
| 3300018482|Ga0066669_10232413 | All Organisms → cellular organisms → Bacteria | 1442 | Open in IMG/M |
| 3300019996|Ga0193693_1048791 | All Organisms → cellular organisms → Bacteria | 685 | Open in IMG/M |
| 3300020001|Ga0193731_1000753 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 9791 | Open in IMG/M |
| 3300020150|Ga0187768_1143200 | Not Available | 551 | Open in IMG/M |
| 3300021445|Ga0182009_10651787 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 567 | Open in IMG/M |
| 3300021560|Ga0126371_10377934 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1556 | Open in IMG/M |
| 3300024055|Ga0247794_10064246 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1033 | Open in IMG/M |
| 3300024055|Ga0247794_10255628 | Not Available | 580 | Open in IMG/M |
| 3300024310|Ga0247681_1045015 | All Organisms → cellular organisms → Bacteria | 671 | Open in IMG/M |
| 3300025898|Ga0207692_10594651 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 711 | Open in IMG/M |
| 3300025906|Ga0207699_10432800 | All Organisms → cellular organisms → Bacteria | 941 | Open in IMG/M |
| 3300025921|Ga0207652_11573997 | All Organisms → cellular organisms → Bacteria | 561 | Open in IMG/M |
| 3300025929|Ga0207664_11939234 | All Organisms → cellular organisms → Bacteria | 512 | Open in IMG/M |
| 3300025932|Ga0207690_11381132 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 589 | Open in IMG/M |
| 3300025938|Ga0207704_11611473 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 558 | Open in IMG/M |
| 3300025949|Ga0207667_10882489 | All Organisms → cellular organisms → Bacteria | 887 | Open in IMG/M |
| 3300026078|Ga0207702_12493102 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 504 | Open in IMG/M |
| 3300026295|Ga0209234_1036827 | All Organisms → cellular organisms → Bacteria | 1861 | Open in IMG/M |
| 3300026295|Ga0209234_1085252 | All Organisms → cellular organisms → Bacteria | 1198 | Open in IMG/M |
| 3300026317|Ga0209154_1120903 | All Organisms → cellular organisms → Bacteria | 1107 | Open in IMG/M |
| 3300026323|Ga0209472_1105736 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1118 | Open in IMG/M |
| 3300026331|Ga0209267_1160471 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 916 | Open in IMG/M |
| 3300026523|Ga0209808_1167655 | All Organisms → cellular organisms → Bacteria | 809 | Open in IMG/M |
| 3300026527|Ga0209059_1208437 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 659 | Open in IMG/M |
| 3300026550|Ga0209474_10296549 | All Organisms → cellular organisms → Bacteria | 957 | Open in IMG/M |
| 3300026550|Ga0209474_10609097 | Not Available | 559 | Open in IMG/M |
| 3300026552|Ga0209577_10396484 | All Organisms → cellular organisms → Bacteria | 995 | Open in IMG/M |
| 3300026552|Ga0209577_10712836 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 566 | Open in IMG/M |
| 3300028379|Ga0268266_11649595 | All Organisms → cellular organisms → Bacteria | 617 | Open in IMG/M |
| 3300028381|Ga0268264_11372118 | All Organisms → cellular organisms → Bacteria | 717 | Open in IMG/M |
| 3300028563|Ga0265319_1214280 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 589 | Open in IMG/M |
| 3300028596|Ga0247821_10656513 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 681 | Open in IMG/M |
| 3300028705|Ga0307276_10012636 | All Organisms → cellular organisms → Bacteria | 1535 | Open in IMG/M |
| 3300028719|Ga0307301_10160304 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 725 | Open in IMG/M |
| 3300028720|Ga0307317_10169253 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 735 | Open in IMG/M |
| 3300028744|Ga0307318_10244127 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 625 | Open in IMG/M |
| 3300028744|Ga0307318_10376943 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 501 | Open in IMG/M |
| 3300028771|Ga0307320_10219286 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 746 | Open in IMG/M |
| 3300028771|Ga0307320_10484781 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 500 | Open in IMG/M |
| 3300028778|Ga0307288_10164444 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 841 | Open in IMG/M |
| 3300028800|Ga0265338_10469478 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 889 | Open in IMG/M |
| 3300028811|Ga0307292_10356373 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 618 | Open in IMG/M |
| 3300028814|Ga0307302_10219858 | All Organisms → cellular organisms → Bacteria | 929 | Open in IMG/M |
| 3300028828|Ga0307312_10205269 | All Organisms → cellular organisms → Bacteria | 1266 | Open in IMG/M |
| 3300028881|Ga0307277_10032728 | All Organisms → cellular organisms → Bacteria | 2076 | Open in IMG/M |
| 3300028884|Ga0307308_10256446 | All Organisms → cellular organisms → Bacteria | 838 | Open in IMG/M |
| 3300028884|Ga0307308_10418847 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 642 | Open in IMG/M |
| 3300028885|Ga0307304_10336573 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 672 | Open in IMG/M |
| 3300030006|Ga0299907_11074660 | Not Available | 586 | Open in IMG/M |
| 3300030336|Ga0247826_10687476 | All Organisms → cellular organisms → Bacteria | 793 | Open in IMG/M |
| 3300031240|Ga0265320_10060335 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1811 | Open in IMG/M |
| 3300031366|Ga0307506_10333559 | All Organisms → cellular organisms → Bacteria | 603 | Open in IMG/M |
| 3300031552|Ga0315542_1017367 | All Organisms → cellular organisms → Bacteria | 3343 | Open in IMG/M |
| 3300031716|Ga0310813_10497019 | All Organisms → cellular organisms → Bacteria | 1065 | Open in IMG/M |
| 3300031716|Ga0310813_11517262 | All Organisms → cellular organisms → Bacteria | 624 | Open in IMG/M |
| 3300031720|Ga0307469_11768743 | Not Available | 597 | Open in IMG/M |
| 3300031820|Ga0307473_10805149 | All Organisms → cellular organisms → Bacteria | 670 | Open in IMG/M |
| 3300031854|Ga0310904_10309559 | All Organisms → cellular organisms → Bacteria | 1004 | Open in IMG/M |
| 3300031996|Ga0308176_11993443 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 620 | Open in IMG/M |
| 3300032164|Ga0315283_10421004 | All Organisms → cellular organisms → Bacteria | 1452 | Open in IMG/M |
| 3300033412|Ga0310810_10897370 | All Organisms → cellular organisms → Bacteria | 779 | Open in IMG/M |
| 3300033551|Ga0247830_11377963 | Not Available | 564 | Open in IMG/M |
| 3300033805|Ga0314864_0078892 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 784 | Open in IMG/M |
| 3300034113|Ga0364937_100788 | Not Available | 590 | Open in IMG/M |
| 3300034172|Ga0334913_109293 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 586 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 17.30% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 15.14% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 5.95% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 5.95% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 4.86% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 4.32% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 4.32% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 3.78% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 2.70% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 2.16% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.62% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.62% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.62% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 1.62% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 1.62% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 1.08% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.08% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.08% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.08% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.08% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 1.08% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 1.08% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 1.08% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 1.08% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.08% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.08% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 0.54% |
| Soil | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil | 0.54% |
| Salt Marsh Sediment | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh Sediment | 0.54% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.54% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 0.54% |
| Glacier Forefield Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil | 0.54% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.54% |
| Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 0.54% |
| Sub-Biocrust Soil | Environmental → Terrestrial → Soil → Unclassified → Desert → Sub-Biocrust Soil | 0.54% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.54% |
| Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 0.54% |
| Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland | 0.54% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.54% |
| Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 0.54% |
| Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 0.54% |
| Soil | Environmental → Terrestrial → Agricultural Field → Unclassified → Unclassified → Soil | 0.54% |
| Environmental → Unclassified → Unclassified → Unclassified → Unclassified → | 0.54% | |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.54% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere | 0.54% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.54% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.54% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.54% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.54% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 0.54% |
| Switchgrass, Maize And Mischanthus Litter | Engineered → Solid Waste → Grass → Composting → Unclassified → Switchgrass, Maize And Mischanthus Litter | 0.54% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2124908016 | Sample 642 | Environmental | Open in IMG/M |
| 2170459021 | Litter degradation NP4 | Engineered | Open in IMG/M |
| 3300000881 | Soil microbial communities from Great Prairies - Wisconsin Restored Prairie soil | Environmental | Open in IMG/M |
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300002568 | Grasslands soil microbial communities from Hopland, California, USA - 2 | Environmental | Open in IMG/M |
| 3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
| 3300004153 | Grasslands soil microbial communities from Hopland, California, USA (version 2) | Environmental | Open in IMG/M |
| 3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
| 3300004643 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3 | Environmental | Open in IMG/M |
| 3300005177 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 | Environmental | Open in IMG/M |
| 3300005179 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 | Environmental | Open in IMG/M |
| 3300005294 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk Soil | Environmental | Open in IMG/M |
| 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
| 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
| 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Environmental | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Host-Associated | Open in IMG/M |
| 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
| 3300005529 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1 | Environmental | Open in IMG/M |
| 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Environmental | Open in IMG/M |
| 3300005538 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 | Environmental | Open in IMG/M |
| 3300005540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 | Environmental | Open in IMG/M |
| 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Environmental | Open in IMG/M |
| 3300005553 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 | Environmental | Open in IMG/M |
| 3300005554 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 | Environmental | Open in IMG/M |
| 3300005555 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 | Environmental | Open in IMG/M |
| 3300005556 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 | Environmental | Open in IMG/M |
| 3300005561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 | Environmental | Open in IMG/M |
| 3300005568 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 | Environmental | Open in IMG/M |
| 3300005575 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 | Environmental | Open in IMG/M |
| 3300005587 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103 | Environmental | Open in IMG/M |
| 3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
| 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Host-Associated | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005888 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_80N_103 | Environmental | Open in IMG/M |
| 3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
| 3300006058 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Host-Associated | Open in IMG/M |
| 3300006604 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLMB (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006791 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102 | Environmental | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
| 3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009817 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_10_20 | Environmental | Open in IMG/M |
| 3300010152 | Soil microbial communities from Oklahoma, USA to study soil gas exchange rates - GP-OK-ARM metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010166 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot27 | Environmental | Open in IMG/M |
| 3300010326 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09082015 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010364 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09212015 | Environmental | Open in IMG/M |
| 3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
| 3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
| 3300012498 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 | Host-Associated | Open in IMG/M |
| 3300012514 | Unplanted soil (control) microbial communities from North Carolina - M.Soil.1.old.130510 | Environmental | Open in IMG/M |
| 3300012941 | Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t4i015 | Environmental | Open in IMG/M |
| 3300012951 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MG | Environmental | Open in IMG/M |
| 3300012958 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MG | Environmental | Open in IMG/M |
| 3300012961 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG | Environmental | Open in IMG/M |
| 3300012972 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300012985 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MG | Environmental | Open in IMG/M |
| 3300012987 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MG | Environmental | Open in IMG/M |
| 3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
| 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Host-Associated | Open in IMG/M |
| 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Host-Associated | Open in IMG/M |
| 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
| 3300013763 | Permafrost microbial communities from Nunavut, Canada - A15_65cm_0M | Environmental | Open in IMG/M |
| 3300014166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09182015 | Environmental | Open in IMG/M |
| 3300014488 | Bulk soil microbial communities from Mexico - San Felipe (SF) metaG | Environmental | Open in IMG/M |
| 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Host-Associated | Open in IMG/M |
| 3300015161 | Arctic soil microbial communities from a glacier forefield, Russell Glacier, Kangerlussuaq, Greenland (Sample G1B, Ice margin) | Environmental | Open in IMG/M |
| 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Host-Associated | Open in IMG/M |
| 3300015356 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300017656 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_11112015 | Environmental | Open in IMG/M |
| 3300017657 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09212015 | Environmental | Open in IMG/M |
| 3300018032 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_BV01_MP10_20_MG | Environmental | Open in IMG/M |
| 3300018066 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_5_b1 | Environmental | Open in IMG/M |
| 3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300019996 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3a2 | Environmental | Open in IMG/M |
| 3300020001 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1a2 | Environmental | Open in IMG/M |
| 3300020150 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP10_20_MG | Environmental | Open in IMG/M |
| 3300021445 | Bulk soil microbial communities from the field in Mead, Nebraska, USA - 072115-187_1 MetaG | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300024055 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S046-202B-6 | Environmental | Open in IMG/M |
| 3300024310 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK22 | Environmental | Open in IMG/M |
| 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026295 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026317 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 (SPAdes) | Environmental | Open in IMG/M |
| 3300026323 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 (SPAdes) | Environmental | Open in IMG/M |
| 3300026331 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 (SPAdes) | Environmental | Open in IMG/M |
| 3300026523 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 (SPAdes) | Environmental | Open in IMG/M |
| 3300026527 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 (SPAdes) | Environmental | Open in IMG/M |
| 3300026550 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 (SPAdes) | Environmental | Open in IMG/M |
| 3300026552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 (SPAdes) | Environmental | Open in IMG/M |
| 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Host-Associated | Open in IMG/M |
| 3300028596 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Glycerol_Day14 | Environmental | Open in IMG/M |
| 3300028705 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_115 | Environmental | Open in IMG/M |
| 3300028719 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_182 | Environmental | Open in IMG/M |
| 3300028720 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_357 | Environmental | Open in IMG/M |
| 3300028744 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_367 | Environmental | Open in IMG/M |
| 3300028771 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_369 | Environmental | Open in IMG/M |
| 3300028778 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_142 | Environmental | Open in IMG/M |
| 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Host-Associated | Open in IMG/M |
| 3300028811 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_149 | Environmental | Open in IMG/M |
| 3300028814 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_183 | Environmental | Open in IMG/M |
| 3300028828 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202 | Environmental | Open in IMG/M |
| 3300028881 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_116 | Environmental | Open in IMG/M |
| 3300028884 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_195 | Environmental | Open in IMG/M |
| 3300028885 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_185 | Environmental | Open in IMG/M |
| 3300030006 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT152D67 | Environmental | Open in IMG/M |
| 3300030336 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day1 | Environmental | Open in IMG/M |
| 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Host-Associated | Open in IMG/M |
| 3300031366 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 25_S | Environmental | Open in IMG/M |
| 3300031552 | Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - Salt Marsh Sediment SW1601-20 | Environmental | Open in IMG/M |
| 3300031716 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3 | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
| 3300031854 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D1 | Environmental | Open in IMG/M |
| 3300031996 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R2 | Environmental | Open in IMG/M |
| 3300032164 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_0 | Environmental | Open in IMG/M |
| 3300033412 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NC | Environmental | Open in IMG/M |
| 3300033551 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day5 | Environmental | Open in IMG/M |
| 3300033805 | Tropical peat soil microbial communities from peatlands in Loreto, Peru - MAQ_50_10 | Environmental | Open in IMG/M |
| 3300034113 | Sediment microbial communities from East River floodplain, Colorado, United States - 7_s17 | Environmental | Open in IMG/M |
| 3300034172 | Sub-biocrust soil microbial communities from Mojave Desert, California, United States - 9HMS | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| OU_00045220 | 2124908016 | VVTGADLRDLGAAVAVLLVAALGAPSASEGDGVTV | |
| 4NP_04023680 | 2170459021 | Switchgrass, Maize And Mischanthus Litter | VLLGEDLRDLGAAIAVRQLRAQGSSLELDGERLTVALG |
| JGI10215J12807_10425221 | 3300000881 | Soil | EDLRDLGAAVAVRVIRARGGSIEVDGETLRVRLV* |
| JGI10216J12902_1135437201 | 3300000956 | Soil | LGEELRDLGAAVAVRTIEALGGSVEVDGDVLRVRV* |
| C688J35102_1209820147 | 3300002568 | Soil | AASAPVVLGEDLRDLGAAVGVRLVRRLGGSVSVDGETLRIELA* |
| Ga0062593_1008165711 | 3300004114 | Soil | ASAPVVLGEDLRDLGAAVANTLLVATGGSVALHEQTLVVRLEP* |
| Ga0063455_1001765811 | 3300004153 | Soil | APVVLGDDLRDLGAAVAVRLVRRLGGSVSVDGETLKVALA* |
| Ga0062595_1008017871 | 3300004479 | Soil | VVLGEDLRDLGAAVAVRVVRALGGSVELDGETLTVKLPE* |
| Ga0062595_1011180481 | 3300004479 | Soil | ASAPVVLGEDLRDLGAAVAVRLVRHLGGSVSVSGEKVEIRLA* |
| Ga0062595_1021266021 | 3300004479 | Soil | SAPVVLGEDLRDLGAAIAVRLLRAQEGSVALEGETLEIRPA* |
| Ga0062595_1023229181 | 3300004479 | Soil | ISPVTAASGPVLLGEDLRDLGAAVAVLLIGAHGGSVHLDGDVLSVRLPA* |
| Ga0062591_1018529272 | 3300004643 | Soil | SAPVVLGEDLRDLGAAVAALLVRALGGSVTVEGETLHVRLPE* |
| Ga0062591_1023077761 | 3300004643 | Soil | PVTPASAPVLLGEDLRDLGAAIAGLAIRAQGGEVTLAGEELQVRLPGS* |
| Ga0066690_106679091 | 3300005177 | Soil | VVLGEDLRDLGAAVAVRLVRTLGGSVAVESETLHVTLPGG* |
| Ga0066684_104146312 | 3300005179 | Soil | PVVLGEDMRDLGAAVAVRLIGALGGSVSLEGETLSVSFHQ* |
| Ga0065705_103506371 | 3300005294 | Switchgrass Rhizosphere | APVLLGEDLRDLGAAVAVRVVRARGGSVAVEGETLTVRFT* |
| Ga0070671_1004641131 | 3300005355 | Switchgrass Rhizosphere | SAPVLLGEDLRDLGAAVAVRVVQARGGDVVVTGDELTIRLA* |
| Ga0070671_1017765632 | 3300005355 | Switchgrass Rhizosphere | APVLLGEDLRDLGAAVAVRVIEARGGTVAVEGDTLTVRRV* |
| Ga0070709_113331071 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | PVVLGEDLRDLGAAVAALLVRALGGSVTVEGETLHVRLPE* |
| Ga0070713_1009622521 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | SSAPVVVGDDLRDLGAAVAVRVVRALGGSVELAGETLLVTLPE* |
| Ga0070701_106431442 | 3300005438 | Corn, Switchgrass And Miscanthus Rhizosphere | APVLLGDDLRDLGAAVAVRVVEARGGSVAVDGETLTIRFV* |
| Ga0070708_1007163972 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | LLGEDLRDLGAAIAVRQIRAQGGSVELEGDQLIVRLVARGVAA* |
| Ga0068867_1012737992 | 3300005459 | Miscanthus Rhizosphere | PVVLGQDLRDLGAAVAVRHVAWLGGSVSVDGETLTIRLAAT* |
| Ga0070698_1010178971 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | APVVLGEDLRDLGAAVAALLLRALGGSVSVENETLHVRLPE* |
| Ga0070741_107514481 | 3300005529 | Surface Soil | QDLRDLGAAVAVRLVSTLGGSVSVSGPTLTIRLA* |
| Ga0070679_1007939712 | 3300005530 | Corn Rhizosphere | SAPVLLGEDLRDLGAAVAVRVVEARGGAVEVDGETLIVRLA* |
| Ga0070731_103748143 | 3300005538 | Surface Soil | LGEDLRDLGAAVAARLVVRLGGSLAVEGETLVLRLA* |
| Ga0066697_107556091 | 3300005540 | Soil | VVTGADLRDLGAAVAVMLLETLGGGVSVEGETLTVRLPG* |
| Ga0070665_1025283302 | 3300005548 | Switchgrass Rhizosphere | PASAPVVLGEDLRDLGAAVAVLHLRRLGGSVVLDGETLTIRFV* |
| Ga0070704_1002623683 | 3300005549 | Corn, Switchgrass And Miscanthus Rhizosphere | SAPVVLGEDLRDLGAAVAVLLVRALGGTIGLDGETLRVRLPE* |
| Ga0066695_104947311 | 3300005553 | Soil | PVVLGEDLRDLGAAVAVLLVRTLGGSVELDGEALLVRLPA* |
| Ga0066661_101646731 | 3300005554 | Soil | PVVLGQDLRDLGAAVAVRLIAALGGSVSLDGDTVVVNLPS* |
| Ga0066692_108192431 | 3300005555 | Soil | ASAPVVLGEDLRDLGAAVAVRLLRAQGGSVELDGETLRIGLV* |
| Ga0066707_106416912 | 3300005556 | Soil | ARAVILGEELRDLGAAAAVLIVRSLGGSVELDGDALRVTLA* |
| Ga0066699_108309073 | 3300005561 | Soil | VTGADLRDLGAAVAVLLLETLGGGVSVEGETLTVRLPG* |
| Ga0066703_102369274 | 3300005568 | Soil | LLGDDLRDLGAAVAVRLITALGGSVALDGEAIVVSLPS* |
| Ga0066703_106429043 | 3300005568 | Soil | GEDLRDLGAAVAVRLVAELGGRVSRDDDAVIVQLPV* |
| Ga0066702_108895131 | 3300005575 | Soil | PVVLGEDLRDLGAAVAVRLVAELGGRVSRDDDAVIVQLPV* |
| Ga0066654_100199671 | 3300005587 | Soil | SAPVVLGDDLRDLGAAVAVRVVRALGGSVAVEGETLSVALPG* |
| Ga0066706_107495492 | 3300005598 | Soil | GEDLRDLGAAIAGRALRALGGGLELDGETLRVRLPS* |
| Ga0068852_1025328891 | 3300005616 | Corn Rhizosphere | VVLGEDLRDLGAAVAVRLIRAQGGSVALEGDTLKVRLA* |
| Ga0066905_1003759331 | 3300005713 | Tropical Forest Soil | AAAPVLLGKDLRDLGAAIAVRQLRAQGSSLELEGERLLISL* |
| Ga0066903_1062101902 | 3300005764 | Tropical Forest Soil | AAPVVLGDDLRDLGAAVAARLVRRLGGSLFVEGETLTIRLA* |
| Ga0066903_1078349051 | 3300005764 | Tropical Forest Soil | ASEPVLLGTDLRDLGAAVAGRALRAVGAAVEAEGERLRITLRAAQ* |
| Ga0075289_10096461 | 3300005888 | Rice Paddy Soil | APVVLGEDLRDLGAAVAVMHVGWLGGSVAVAGETLTIALPA* |
| Ga0066652_1002299521 | 3300006046 | Soil | DLRDLGAAVAVALVTALGGSVAREGDAIAVRLPE* |
| Ga0066652_1015393942 | 3300006046 | Soil | LGEDLRDLGAAVAVRAVAALGGSVSLDGETLTIRLS* |
| Ga0075432_101457961 | 3300006058 | Populus Rhizosphere | EDLRDLGAAVANTLLAATGASVALHEQTLVVRLGP* |
| Ga0074060_116179212 | 3300006604 | Soil | TAASAPVVLGEDLRDLGAAVAVRLVRRLGGSVEVEGETLRVVL* |
| Ga0066653_106445821 | 3300006791 | Soil | VVGQDLRDLGAAVAVIHVERLGGSVAVDGDTLTVRLP* |
| Ga0066659_115061582 | 3300006797 | Soil | EDLRDLGAAVAVRAIAALGGSVSLDGETLTIRFP* |
| Ga0075433_101823995 | 3300006852 | Populus Rhizosphere | RLVLVGEELRDLGAAVAVRLVQALGGSVELDGDSLVVRLPE* |
| Ga0075433_107288171 | 3300006852 | Populus Rhizosphere | EDLRDLGAAIAVRLLRAQGGSVAVEGETLEIRLA* |
| Ga0075424_1008272393 | 3300006904 | Populus Rhizosphere | PIVLGEELRDLGAAVAVRTVEALGGSVERANDSVLIRLRR* |
| Ga0079219_103849592 | 3300006954 | Agricultural Soil | SSAPVVVGEDLRDLGAAVAVMHIKHLGGSVLVEGDTLTISLPPSS* |
| Ga0079219_122666471 | 3300006954 | Agricultural Soil | GKDLRDLGAAVAVRVVQARGGEVAVAGDELTIRLA* |
| Ga0075435_1002968811 | 3300007076 | Populus Rhizosphere | APVVLGEDLRDLGAAVAALLVRALGGSVTVEGETLHVRLPE* |
| Ga0075435_1008088443 | 3300007076 | Populus Rhizosphere | VTASSGPVLLGEDLRDLGAAVAVLLVDALGGSVAMDGDAVVVSLPQ* |
| Ga0066710_1005066881 | 3300009012 | Grasslands Soil | GPVLLGEDLRDLGAAVAVLLVEALGGSVVLDTDAVVVRLPA |
| Ga0066710_1007567254 | 3300009012 | Grasslands Soil | GATISIFPVTAASGPVLLGEDLRDLGAAVAVLVVQAHGGSVQLDGDTLSVSLAE |
| Ga0099829_107425222 | 3300009038 | Vadose Zone Soil | VLGEDLRDLGAAVAVRAIAALGGSVSLTGETLTIRFPG* |
| Ga0099827_101733214 | 3300009090 | Vadose Zone Soil | SAPVVLGEDLRDLGAAVAVRLLHALGGSVELEGERLLVRLPENAA* |
| Ga0099827_110153963 | 3300009090 | Vadose Zone Soil | VLGEELRDLGAAVAVRLLHALGGSVQLEGERLLVRLPESAAQNE* |
| Ga0075418_104348463 | 3300009100 | Populus Rhizosphere | PVVLGEDLRDLGAAVAVRVIRAHGGSIEVDGETLRVRLV* |
| Ga0066709_1000474197 | 3300009137 | Grasslands Soil | LGEDLRDLGAAVAVLLVRALGGSVTLEGDTLHVRLPD* |
| Ga0066709_1006269695 | 3300009137 | Grasslands Soil | VVLGDELRDLGAAVAVRVIRALGGSVDLDGETLTVRLPQ* |
| Ga0066709_1007967871 | 3300009137 | Grasslands Soil | MLEQELRDLGAAVAVIVIRALGGSVAVDGGTLAVKLPE* |
| Ga0105243_106120412 | 3300009148 | Miscanthus Rhizosphere | LGEDLRDLGAAVAALLVRALGGSVSVEDETLHVRLPE* |
| Ga0075423_127790641 | 3300009162 | Populus Rhizosphere | GPVLLGQELRDLGAAVAVLVVSAHGGTVTLQDDSLHVRLPK* |
| Ga0105248_114619261 | 3300009177 | Switchgrass Rhizosphere | VLGEDLRDLGAAVAVLHLRRLGGSVALDGETLTIRFA* |
| Ga0105062_10637043 | 3300009817 | Groundwater Sand | EELRDLGAAVAVQVIRALGGSVEVEGETLRVRLPE* |
| Ga0126318_110541761 | 3300010152 | Soil | DELRDLGAAVAVRLVEALGGSLAVEGETLRISLPEGGGADPSA* |
| Ga0126306_114966221 | 3300010166 | Serpentine Soil | DDVAPIILGEDLRDLGAAVAVRAIAALGGTSEVADRRLVVQLPAA* |
| Ga0134065_104371471 | 3300010326 | Grasslands Soil | VVLGEDLRDLGAAVGVRLVRALGGSVELDGETLHVRLPQ* |
| Ga0134063_101038841 | 3300010335 | Grasslands Soil | LLGDELRDLGAAVAGIAIRAQGGSLELDGETLTIRLG* |
| Ga0126377_113480892 | 3300010362 | Tropical Forest Soil | VVLGEDLRDLGAAVAARLVARLGGSLSLEGESLAISLA* |
| Ga0134066_101042383 | 3300010364 | Grasslands Soil | VLGEDLRDLGAAVAVRVVRRLGGSVSVDGETLEIRLG* |
| Ga0134125_122057342 | 3300010371 | Terrestrial Soil | TPVTPASAPVLLGEDLRDLGAAIAGLAIRAQGGEVELAGESLHVRLPGS* |
| Ga0134121_107850353 | 3300010401 | Terrestrial Soil | GEDLRDLGAAVAVRLVRRLGGSVSVDGETVTIRLA* |
| Ga0134121_120473773 | 3300010401 | Terrestrial Soil | GDVLRELGAAVAVRVVRALGGSVELAGATVTITLPE* |
| Ga0137392_114726342 | 3300011269 | Vadose Zone Soil | AARVILGEDLKDLGAAVAVRIVRALGGSAQLDGASLVVSLSTL* |
| Ga0137382_105536181 | 3300012200 | Vadose Zone Soil | ELRDLGAAVAVIVICAIGGSVALDGDTLTVKLPE* |
| Ga0137382_106704201 | 3300012200 | Vadose Zone Soil | TKSSAPVLLGDELRDLGAAVAGIAIRAQGGSLELDGETLTIRLG* |
| Ga0137365_112484201 | 3300012201 | Vadose Zone Soil | PVLMGDDLRDLGAAVAVRVVAAMGGAVALDGDTVVVRLSS* |
| Ga0137376_109480611 | 3300012208 | Vadose Zone Soil | LGEDLRDLGAAVAVRLVRTLGGSVAVESETLHVTLPGG* |
| Ga0137371_108646301 | 3300012356 | Vadose Zone Soil | SAPVVLGEDLRDLGAAVAVMHVERLGGSVGVEGDSLTIRLPT* |
| Ga0137371_114193672 | 3300012356 | Vadose Zone Soil | DLRDLGAAVAVRLLEVQGGSIAVEGETLRVALTSR* |
| Ga0137385_103457771 | 3300012359 | Vadose Zone Soil | VVLGEDLRDLGAAAAVRLVGALGGEVSVEGETLRVRLPG* |
| Ga0150984_1164126543 | 3300012469 | Avena Fatua Rhizosphere | PVTASSAPVVVGDDLRDLGAAVAVLVVRALGGSVELDGETVLVTLPE* |
| Ga0157345_10471741 | 3300012498 | Arabidopsis Rhizosphere | DLRDLGAAVAVRLVERLGGELSVDGDELRVRLPA* |
| Ga0157330_10598272 | 3300012514 | Soil | APVVLGQDLRDLGAAVAVMHVERLGGSVSVNGDTLTVRLP* |
| Ga0162652_1000984581 | 3300012941 | Soil | ASAPVVLGEDLRDLGAAVAVRVVRARGGSVELDGETLRVRLA* |
| Ga0164300_103784902 | 3300012951 | Soil | VVLGEDLRDLGAAVAALLVRALGGSVSVEDETLHVRLPE* |
| Ga0164299_107022711 | 3300012958 | Soil | VLGQDLRDLGAAVAVLLVHALGGTIGLDGETLRVRLPE* |
| Ga0164302_105813573 | 3300012961 | Soil | GEELRDLGAAVAVIVIRANHGSVSVNGDTLAVKLPE* |
| Ga0164302_108300231 | 3300012961 | Soil | ASAPVVLGEDLRDLGAAVAVLHLRRLGGSVTLDGETLTVRFA* |
| Ga0164302_114818651 | 3300012961 | Soil | PVLLGEDLRDLGAAVAVRVVQARGGSVAVEGETLTIRLT* |
| Ga0134077_102191411 | 3300012972 | Grasslands Soil | SAPVVLGQDLRDLGAAVAVYVIGTLGGAVTVDGDTLTIRLG* |
| Ga0164308_116488092 | 3300012985 | Soil | LGEDLRDLGAAVAVRLVAALGGAVSLEGETLTVRLA* |
| Ga0164307_105344973 | 3300012987 | Soil | VLGEDLRDLGAAVAVRLVDALGGSVSLDGETLTVQVA* |
| Ga0164307_113063251 | 3300012987 | Soil | ELRDLGAAVAVRVVRALGGSVELDGDRLTITLPE* |
| Ga0164305_112838763 | 3300012989 | Soil | EDLRDLGAAVAVRLLDALGGSVSLDGETLTVRVG* |
| Ga0157369_106512162 | 3300013105 | Corn Rhizosphere | APVLLGEDLRDLGAAVAVRVVQARGGDVVVTGDELTIRLA* |
| Ga0157372_129783351 | 3300013307 | Corn Rhizosphere | PASAPVVLGEDLRDLGAAVAVLHLRRLGGSVTLDGETLTVRFA* |
| Ga0157375_124610342 | 3300013308 | Miscanthus Rhizosphere | VLGQDLRDLGAAVAVMHVERLGGSVSVNGDTLKIALPAS* |
| Ga0120179_11437512 | 3300013763 | Permafrost | PIAEAAGPIILGEELRDLGAAVAVRTVSALGGSVSLDGETLRIVL* |
| Ga0134079_101634853 | 3300014166 | Grasslands Soil | GADLRDLGAAVAVRLIDALGGSVSLEDDAVNVRLPG* |
| Ga0134079_105539563 | 3300014166 | Grasslands Soil | VLGQELRDLGAAVAVRVVHALGGSVELDGETLTVKLPE* |
| Ga0182001_102573902 | 3300014488 | Soil | VPSAAPVVLGEDLRDLGAAVAGRAVRALGGSVELDGETLRVRLPT* |
| Ga0157376_119617872 | 3300014969 | Miscanthus Rhizosphere | PVVLGEDLRDLGAAVAVLHLRRLGGSVALDGETLTIRFA* |
| Ga0167623_10132644 | 3300015161 | Glacier Forefield Soil | VSAQAAPVVLGDDLRDLGSAIGRRVVEKLGGSVAVKGESLAVRL* |
| Ga0182006_12506102 | 3300015261 | Rhizosphere | DDLRDLRAAVAVRLIRALGGSVAVEGETLHVRLA* |
| Ga0134073_103960312 | 3300015356 | Grasslands Soil | EDLRDLGAAVGVRLVRTLGGSVELDGETLHVRLPQ* |
| Ga0134112_103818113 | 3300017656 | Grasslands Soil | RVDGPTIAISPVTPASGPVLLGEDLRDLGAAVAVLVVGAHGGSVGLDGDILSVRLAV |
| Ga0134074_13560413 | 3300017657 | Grasslands Soil | PVTAASGPVLLGQDLRDLGAAVAVLLVQALGGSVSLDGEAVVVHLPK |
| Ga0187788_104795472 | 3300018032 | Tropical Peatland | SAPVVVGQDLRDLGAAVAVMHVERLGGSVTLDGDSLSIRLPS |
| Ga0184617_11331071 | 3300018066 | Groundwater Sediment | SAPVVLGEDLRDLGAAIAVLLIRAQGGSVALDGETLRVRFV |
| Ga0066655_106920893 | 3300018431 | Grasslands Soil | GDVLLGRDLRDLGAAVAVRLVDMLGGSVERDGDAVVVRLPA |
| Ga0066655_114173692 | 3300018431 | Grasslands Soil | ASAPVLLGEDLRDLGAAVAVRVLRAQGGSVELEGETLHIGLA |
| Ga0066667_119537513 | 3300018433 | Grasslands Soil | GEDRRDLGAAVAVRLVDALGGSVELDGDAVVVRLPE |
| Ga0066669_102324133 | 3300018482 | Grasslands Soil | GEDLRDLGAAVGVRLVRALGGSVVLDGETLHFRLPQ |
| Ga0193693_10487911 | 3300019996 | Soil | LGEDLRDLGAAVAALLVRALGGSVSVEDETLHVRLPE |
| Ga0193731_10007537 | 3300020001 | Soil | VLGEDLRDLGAAVAVLLVRALGGSIALDGETLRVRLPE |
| Ga0187768_11432001 | 3300020150 | Tropical Peatland | APVVLGDDLRDLGAAVAVLLVRRLGGSVEIDGETLRIRLA |
| Ga0182009_106517871 | 3300021445 | Soil | ASSAPVVLGEDMRDLGAAVAVRVVRALGGSVELDGDTVRITLPK |
| Ga0126371_103779341 | 3300021560 | Tropical Forest Soil | VVLGDDLRDLGAAVAVRLVRRLGGSVVVEGETLEIRLV |
| Ga0247794_100642461 | 3300024055 | Soil | PVVLGDDLRDLGAAVAVRLVRRLGGSVAIDGETVKIRLS |
| Ga0247794_102556282 | 3300024055 | Soil | LGEDLRDLGAAVAVRLVRRLGGSVAVDGETLQIRLA |
| Ga0247681_10450152 | 3300024310 | Soil | TPASAPVLLGEDLRDLGAAVAVRVVEARGGAVEVDGETLIVRLA |
| Ga0207692_105946511 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | APVVVGDDLRDLGAAVAVRVVRALGGSVELAGETLLVTLPE |
| Ga0207699_104328001 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | ASAPVLLGEDLRDLGAAVAVRVVEARGGAVEVDGETLIVRLA |
| Ga0207652_115739972 | 3300025921 | Corn Rhizosphere | PASAPVLLGEDLRDLGAAVAVRVVEARGGAVEVDGETLIVRLA |
| Ga0207664_119392342 | 3300025929 | Agricultural Soil | TPASAPVVLGEDLRDLRAAVAVRVLRALGGDAAVDGDVLTLRLA |
| Ga0207690_113811322 | 3300025932 | Corn Rhizosphere | LGEDLRDLGAAVAVLHLRRLGGSVALDGETLTIRFA |
| Ga0207704_116114732 | 3300025938 | Miscanthus Rhizosphere | SAPVVLGEDLRDLGAAVAVLHLRRLGGSVSLDGETLTIRFA |
| Ga0207667_108824893 | 3300025949 | Corn Rhizosphere | PVVLGEDLRDLGAAVAVRLVRRLGGSVAVDGETLQIRLA |
| Ga0207702_124931021 | 3300026078 | Corn Rhizosphere | DLRDLGAAVAVMHVERLGGSVSVNGDTLKIALPAS |
| Ga0209234_10368271 | 3300026295 | Grasslands Soil | VVLGEDLRDLGAAVAALLVRALGGSVSVEDETLHVRLPE |
| Ga0209234_10852521 | 3300026295 | Grasslands Soil | AASGPVVLGQDLRDLGAAVAVRLIAALGGSVSLDGDTVVVNLPS |
| Ga0209154_11209031 | 3300026317 | Soil | LGEDLRDLGAAVAVRAIAALGGSVSLDGETLTIAFS |
| Ga0209472_11057361 | 3300026323 | Soil | PVVLGEELRDLGAAVAVRVVRALGGSVALDGDTLTITLPE |
| Ga0209267_11604711 | 3300026331 | Soil | MLGQDLRDLGAAVAVLLVGAHGGKVALDGEVLSVRFAT |
| Ga0209808_11676552 | 3300026523 | Soil | ELSPVTKSSAPVLLGDELRDLGAAVAGIAIRAQGGSLELDGETLTIRLG |
| Ga0209059_12084372 | 3300026527 | Soil | VLGEELRDLGAAVAVRVVRALGGSVDLDGETLTVRLPQ |
| Ga0209474_102965493 | 3300026550 | Soil | RVTAASAPVVLGDDLRDLGAAVAVRLVRRLGGCVSVDGETLAICLA |
| Ga0209474_106090972 | 3300026550 | Soil | TPASAPVVLGEDLRDLGAAVAVRLFTRLGGSVSVDGETVKILLA |
| Ga0209577_103964841 | 3300026552 | Soil | ASAPVVLGEDLRDLGAAVAVRLVNALGGSVSVEEETLHVCLPE |
| Ga0209577_107128362 | 3300026552 | Soil | PASAPVVLGEDLRDLGAAVAVRAVRALGGSVELAGDALLVRLPA |
| Ga0268266_116495952 | 3300028379 | Switchgrass Rhizosphere | PASAPVVLGEDLRDLGAAVAVLHLRRLGGSVVLDGETLTIRFV |
| Ga0268264_113721181 | 3300028381 | Switchgrass Rhizosphere | VLGEDLRDLGAAIAVRLIRAQGGSVALEGDTLKVRLA |
| Ga0265319_12142802 | 3300028563 | Rhizosphere | PVVLGEDLRDLGAAVAVRHVEWLGGSVAVDGETLTIRFG |
| Ga0247821_106565131 | 3300028596 | Soil | APVTDDSAGVLLGEDLRDFGAAVAGRIVSALGGSVAVEGEALVVRLPVAKS |
| Ga0307276_100126361 | 3300028705 | Soil | LGEELRDLGAAVAVRVVRALGGSVTLDGETLTVTLPE |
| Ga0307301_101603043 | 3300028719 | Soil | PSSAPVVLGEELRDLGAAVAVLVVRALGGSVALDGDKLTVKLPE |
| Ga0307317_101692531 | 3300028720 | Soil | LLGEELRDLGAAVAVIVIRANRGSVSVNGDTLAVKLPE |
| Ga0307318_102441273 | 3300028744 | Soil | EELRDLGAAVAVIVIRANRGSVSVNGDTLAVKLPE |
| Ga0307318_103769431 | 3300028744 | Soil | LGEELRDLGAAVAVIVIRALGGSVAVNDDTLAVKLPE |
| Ga0307320_102192863 | 3300028771 | Soil | VLLGEELRDLGAAVAVIVIRALRGSVSVNGDTLAVKLPE |
| Ga0307320_104847812 | 3300028771 | Soil | APVTPASAPVLLGEDLRDLGAAVAVRALRAQGGSVELDGETFRLRLPR |
| Ga0307288_101644443 | 3300028778 | Soil | LGEELRDLGAAVAVIVIRANRGSVSVNGDTLAVKLPE |
| Ga0265338_104694781 | 3300028800 | Rhizosphere | KVVLGQDLRDLGAAVAVRVLAARGGSVSVSGQTLTMQLA |
| Ga0307292_103563732 | 3300028811 | Soil | PVVLGEDLRDLGAAVAVIHIRRLGGSVVLDGETLTIRFA |
| Ga0307302_102198581 | 3300028814 | Soil | PVVLGEDLRDLGAAVAALLVRALGGSVSVEDETLHVRLPE |
| Ga0307312_102052695 | 3300028828 | Soil | SSAPVVLGEELRDLGAAVAVLVVRALGGSVALDGDKLTVKLPE |
| Ga0307277_100327283 | 3300028881 | Soil | AASAPVVLGEDLRDLGAAVAVRLLAAQGGSVAVEGETLRITLTGP |
| Ga0307308_102564462 | 3300028884 | Soil | VVLGEDLRDLGAAVAVRLIRARGGSVEVDGKTLKIKLA |
| Ga0307308_104188471 | 3300028884 | Soil | GPVVTGADLRDLGAAVAVLVVEALGGSVDLDGDAVAVQLPT |
| Ga0307304_103365732 | 3300028885 | Soil | APVVLGEDLRDLGAAVAALLVRALGGSVSVEDETLHVRLPE |
| Ga0299907_110746602 | 3300030006 | Soil | ELRDLGAAVAVRVLDALGGSVEEEGETLRVRLPLAPVVG |
| Ga0247826_106874762 | 3300030336 | Soil | ASAPVVLGEDLRDLGAAIAVRLIRAQGGSVTLDGETLRIRLA |
| Ga0265320_100603354 | 3300031240 | Rhizosphere | TDLRDLGAAVAVRLIEFLGGSVDVDDGTLTIALAG |
| Ga0307506_103335591 | 3300031366 | Soil | PASAPVVLGEDLRDLGAAVAVIHIRRLGGTVSLDGETLTIRF |
| Ga0315542_10173675 | 3300031552 | Salt Marsh Sediment | SAPVVLGDDLRDLGAAVAALLVTRLGGSLAVEGETLVVRLG |
| Ga0310813_104970192 | 3300031716 | Soil | EDLRDLGAAVAALLVRALGGSVSVEDETLHVRLPE |
| Ga0310813_115172622 | 3300031716 | Soil | ASAPVVLGEALRDLGAAVAVRLVRALGGSVELDGETLHVRLPR |
| Ga0307469_117687432 | 3300031720 | Hardwood Forest Soil | LGQDLRDLGAAVAVRVIERLGGTVAVEGVTLSIALV |
| Ga0307473_108051491 | 3300031820 | Hardwood Forest Soil | VLGEDLRDLGAAVAALLVRALGGSVTVEGETLHVRLPE |
| Ga0310904_103095591 | 3300031854 | Soil | GEDLRDLGAAVAALLVRALGGSVTVEGETLHVRLPE |
| Ga0308176_119934432 | 3300031996 | Soil | ASAPVLLGEDLRDLGAAVAVRVLRTLGGDVSVEGEAARIALAP |
| Ga0315283_104210041 | 3300032164 | Sediment | APILLGEELRDLGAAVAVRHLRALGATVSLEGETLVLVLPR |
| Ga0310810_108973702 | 3300033412 | Soil | VTPASAPVLLGEDLRDLGAAIAVLAIRAQGGEVTLGGDELHVRLPGS |
| Ga0247830_113779631 | 3300033551 | Soil | LGEDLRDLGAAVAVRVVRARGGSVAVEGETLTVRFT |
| Ga0314864_0078892_652_783 | 3300033805 | Peatland | PASAPVVLGEDLRDLGAAVAVRLVSRLGGGVEIEGETLEIRLA |
| Ga0364937_100788_1_123 | 3300034113 | Sediment | LGEDLRDLGAAVAVRVVAALGGSTELDGEVLRVRLPRTAS |
| Ga0334913_109293_3_146 | 3300034172 | Sub-Biocrust Soil | VTPASAPVLVGEDLRDLGAAVAARVLEARGGGASVDGETLRIRLASL |
| ⦗Top⦘ |