| Basic Information | |
|---|---|
| Family ID | F030398 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 185 |
| Average Sequence Length | 45 residues |
| Representative Sequence | GPLVVARRRAYHREWLLGFEGVTSRAAVESWRDQLVAVDE |
| Number of Associated Samples | 164 |
| Number of Associated Scaffolds | 185 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 3.24 % |
| % of genes near scaffold ends (potentially truncated) | 96.22 % |
| % of genes from short scaffolds (< 2000 bps) | 88.65 % |
| Associated GOLD sequencing projects | 153 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.29 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (56.216 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil (21.081 % of family members) |
| Environment Ontology (ENVO) | Unclassified (45.405 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (57.838 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 35.29% β-sheet: 0.00% Coil/Unstructured: 64.71% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.29 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 185 Family Scaffolds |
|---|---|---|
| PF01746 | tRNA_m1G_MT | 76.76 |
| PF01245 | Ribosomal_L19 | 11.35 |
| PF01351 | RNase_HII | 8.11 |
| PF14791 | DNA_pol_B_thumb | 1.62 |
| PF00886 | Ribosomal_S16 | 1.08 |
| PF04286 | DUF445 | 0.54 |
| PF02978 | SRP_SPB | 0.54 |
| COG ID | Name | Functional Category | % Frequency in 185 Family Scaffolds |
|---|---|---|---|
| COG0335 | Ribosomal protein L19 | Translation, ribosomal structure and biogenesis [J] | 11.35 |
| COG0164 | Ribonuclease HII | Replication, recombination and repair [L] | 8.11 |
| COG1039 | Ribonuclease HIII | Replication, recombination and repair [L] | 8.11 |
| COG0228 | Ribosomal protein S16 | Translation, ribosomal structure and biogenesis [J] | 1.08 |
| COG0541 | Signal recognition particle GTPase | Intracellular trafficking, secretion, and vesicular transport [U] | 0.54 |
| COG2733 | Uncharacterized membrane-anchored protein YjiN, DUF445 family | Function unknown [S] | 0.54 |
| COG4399 | Uncharacterized membrane protein YheB, UPF0754 family | Function unknown [S] | 0.54 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 56.22 % |
| Unclassified | root | N/A | 43.78 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001356|JGI12269J14319_10011329 | All Organisms → cellular organisms → Bacteria | 7114 | Open in IMG/M |
| 3300001661|JGI12053J15887_10648062 | Not Available | 502 | Open in IMG/M |
| 3300002907|JGI25613J43889_10144706 | Not Available | 613 | Open in IMG/M |
| 3300004058|Ga0055498_10078285 | All Organisms → cellular organisms → Bacteria | 635 | Open in IMG/M |
| 3300005167|Ga0066672_10598330 | Not Available | 714 | Open in IMG/M |
| 3300005171|Ga0066677_10625596 | All Organisms → cellular organisms → Bacteria | 608 | Open in IMG/M |
| 3300005172|Ga0066683_10165877 | All Organisms → cellular organisms → Bacteria | 1359 | Open in IMG/M |
| 3300005175|Ga0066673_10540949 | All Organisms → cellular organisms → Bacteria | 683 | Open in IMG/M |
| 3300005175|Ga0066673_10644376 | All Organisms → cellular organisms → Bacteria | 614 | Open in IMG/M |
| 3300005177|Ga0066690_10359589 | All Organisms → cellular organisms → Bacteria | 987 | Open in IMG/M |
| 3300005178|Ga0066688_10240405 | All Organisms → cellular organisms → Bacteria | 1158 | Open in IMG/M |
| 3300005179|Ga0066684_10226121 | All Organisms → cellular organisms → Bacteria | 1219 | Open in IMG/M |
| 3300005179|Ga0066684_10761717 | Not Available | 643 | Open in IMG/M |
| 3300005186|Ga0066676_10231619 | All Organisms → cellular organisms → Bacteria | 1199 | Open in IMG/M |
| 3300005187|Ga0066675_10225430 | All Organisms → cellular organisms → Bacteria | 1328 | Open in IMG/M |
| 3300005445|Ga0070708_100010154 | All Organisms → cellular organisms → Bacteria | 7619 | Open in IMG/M |
| 3300005446|Ga0066686_10456716 | All Organisms → cellular organisms → Bacteria | 872 | Open in IMG/M |
| 3300005447|Ga0066689_10311707 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 977 | Open in IMG/M |
| 3300005447|Ga0066689_10974738 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 522 | Open in IMG/M |
| 3300005450|Ga0066682_10147436 | All Organisms → cellular organisms → Bacteria | 1497 | Open in IMG/M |
| 3300005468|Ga0070707_100645400 | All Organisms → cellular organisms → Bacteria | 1021 | Open in IMG/M |
| 3300005536|Ga0070697_100967770 | All Organisms → cellular organisms → Bacteria | 756 | Open in IMG/M |
| 3300005540|Ga0066697_10191670 | All Organisms → cellular organisms → Bacteria | 1214 | Open in IMG/M |
| 3300005552|Ga0066701_10796940 | Not Available | 563 | Open in IMG/M |
| 3300005558|Ga0066698_10895234 | Not Available | 568 | Open in IMG/M |
| 3300005568|Ga0066703_10719401 | Not Available | 573 | Open in IMG/M |
| 3300005568|Ga0066703_10812991 | All Organisms → cellular organisms → Bacteria | 534 | Open in IMG/M |
| 3300005587|Ga0066654_10045462 | All Organisms → cellular organisms → Bacteria | 1914 | Open in IMG/M |
| 3300005598|Ga0066706_11418112 | All Organisms → cellular organisms → Bacteria | 524 | Open in IMG/M |
| 3300006034|Ga0066656_10092072 | All Organisms → cellular organisms → Bacteria | 1827 | Open in IMG/M |
| 3300006049|Ga0075417_10320961 | All Organisms → cellular organisms → Bacteria | 754 | Open in IMG/M |
| 3300006755|Ga0079222_10096636 | All Organisms → cellular organisms → Bacteria | 1539 | Open in IMG/M |
| 3300006755|Ga0079222_11517745 | Not Available | 629 | Open in IMG/M |
| 3300006791|Ga0066653_10282878 | Not Available | 840 | Open in IMG/M |
| 3300006796|Ga0066665_10078532 | All Organisms → cellular organisms → Bacteria | 2365 | Open in IMG/M |
| 3300006797|Ga0066659_10036892 | All Organisms → cellular organisms → Bacteria | 2980 | Open in IMG/M |
| 3300006871|Ga0075434_100945933 | Not Available | 876 | Open in IMG/M |
| 3300006954|Ga0079219_10062863 | All Organisms → cellular organisms → Bacteria | 1660 | Open in IMG/M |
| 3300007004|Ga0079218_13810838 | All Organisms → cellular organisms → Bacteria | 513 | Open in IMG/M |
| 3300007258|Ga0099793_10033253 | All Organisms → cellular organisms → Bacteria | 2204 | Open in IMG/M |
| 3300009090|Ga0099827_10046009 | All Organisms → cellular organisms → Bacteria | 3257 | Open in IMG/M |
| 3300009090|Ga0099827_11646663 | Not Available | 559 | Open in IMG/M |
| 3300009100|Ga0075418_10631720 | All Organisms → cellular organisms → Bacteria | 1153 | Open in IMG/M |
| 3300009137|Ga0066709_101100246 | All Organisms → cellular organisms → Bacteria | 1168 | Open in IMG/M |
| 3300009162|Ga0075423_10427103 | Not Available | 1391 | Open in IMG/M |
| 3300010107|Ga0127494_1080743 | Not Available | 1468 | Open in IMG/M |
| 3300010114|Ga0127460_1051004 | Not Available | 503 | Open in IMG/M |
| 3300010117|Ga0127449_1118279 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis | 1249 | Open in IMG/M |
| 3300010132|Ga0127455_1143644 | Not Available | 521 | Open in IMG/M |
| 3300010133|Ga0127459_1137467 | Not Available | 1001 | Open in IMG/M |
| 3300010134|Ga0127484_1123225 | Not Available | 540 | Open in IMG/M |
| 3300010136|Ga0127447_1177065 | Not Available | 540 | Open in IMG/M |
| 3300010142|Ga0127483_1176694 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 962 | Open in IMG/M |
| 3300010142|Ga0127483_1259982 | Not Available | 531 | Open in IMG/M |
| 3300010301|Ga0134070_10346679 | Not Available | 575 | Open in IMG/M |
| 3300010304|Ga0134088_10039726 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 2141 | Open in IMG/M |
| 3300010304|Ga0134088_10413747 | Not Available | 658 | Open in IMG/M |
| 3300010322|Ga0134084_10009996 | All Organisms → cellular organisms → Bacteria | 2375 | Open in IMG/M |
| 3300010323|Ga0134086_10207439 | Not Available | 734 | Open in IMG/M |
| 3300010325|Ga0134064_10157797 | Not Available | 789 | Open in IMG/M |
| 3300010335|Ga0134063_10360636 | Not Available | 707 | Open in IMG/M |
| 3300010359|Ga0126376_11193310 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 775 | Open in IMG/M |
| 3300010856|Ga0126358_1152263 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 512 | Open in IMG/M |
| 3300010905|Ga0138112_1098877 | Not Available | 548 | Open in IMG/M |
| 3300011269|Ga0137392_10048202 | All Organisms → cellular organisms → Bacteria | 3193 | Open in IMG/M |
| 3300011271|Ga0137393_10066209 | All Organisms → cellular organisms → Bacteria | 2868 | Open in IMG/M |
| 3300011271|Ga0137393_10893789 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 758 | Open in IMG/M |
| 3300012035|Ga0137445_1113102 | Not Available | 552 | Open in IMG/M |
| 3300012096|Ga0137389_10110654 | All Organisms → cellular organisms → Bacteria | 2198 | Open in IMG/M |
| 3300012096|Ga0137389_10758895 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 833 | Open in IMG/M |
| 3300012189|Ga0137388_10623502 | All Organisms → cellular organisms → Bacteria | 1002 | Open in IMG/M |
| 3300012200|Ga0137382_10738218 | All Organisms → cellular organisms → Bacteria | 706 | Open in IMG/M |
| 3300012203|Ga0137399_11216010 | Not Available | 634 | Open in IMG/M |
| 3300012204|Ga0137374_10364824 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis | 1160 | Open in IMG/M |
| 3300012208|Ga0137376_10345806 | All Organisms → cellular organisms → Bacteria | 1291 | Open in IMG/M |
| 3300012208|Ga0137376_11490812 | Not Available | 567 | Open in IMG/M |
| 3300012209|Ga0137379_10489468 | All Organisms → cellular organisms → Bacteria | 1138 | Open in IMG/M |
| 3300012210|Ga0137378_11150261 | Not Available | 691 | Open in IMG/M |
| 3300012211|Ga0137377_11787215 | Not Available | 534 | Open in IMG/M |
| 3300012285|Ga0137370_10513483 | Not Available | 734 | Open in IMG/M |
| 3300012349|Ga0137387_10664306 | Not Available | 755 | Open in IMG/M |
| 3300012349|Ga0137387_11336655 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 500 | Open in IMG/M |
| 3300012354|Ga0137366_10482031 | Not Available | 897 | Open in IMG/M |
| 3300012355|Ga0137369_10616431 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 753 | Open in IMG/M |
| 3300012356|Ga0137371_10832444 | Not Available | 703 | Open in IMG/M |
| 3300012359|Ga0137385_11628369 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 509 | Open in IMG/M |
| 3300012373|Ga0134042_1165741 | Not Available | 794 | Open in IMG/M |
| 3300012376|Ga0134032_1171915 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 525 | Open in IMG/M |
| 3300012379|Ga0134058_1262144 | Not Available | 710 | Open in IMG/M |
| 3300012387|Ga0134030_1145104 | Not Available | 570 | Open in IMG/M |
| 3300012388|Ga0134031_1035065 | Not Available | 846 | Open in IMG/M |
| 3300012389|Ga0134040_1311766 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 548 | Open in IMG/M |
| 3300012395|Ga0134044_1240444 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis | 1239 | Open in IMG/M |
| 3300012396|Ga0134057_1013926 | Not Available | 624 | Open in IMG/M |
| 3300012400|Ga0134048_1108006 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 700 | Open in IMG/M |
| 3300012402|Ga0134059_1407188 | Not Available | 832 | Open in IMG/M |
| 3300012469|Ga0150984_121929288 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 577 | Open in IMG/M |
| 3300012532|Ga0137373_10079394 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2929 | Open in IMG/M |
| 3300012918|Ga0137396_11108484 | Not Available | 565 | Open in IMG/M |
| 3300012922|Ga0137394_10164813 | All Organisms → cellular organisms → Bacteria | 1889 | Open in IMG/M |
| 3300012925|Ga0137419_11033416 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 682 | Open in IMG/M |
| 3300012927|Ga0137416_11403326 | Not Available | 633 | Open in IMG/M |
| 3300012929|Ga0137404_10310613 | All Organisms → cellular organisms → Bacteria | 1370 | Open in IMG/M |
| 3300012929|Ga0137404_11454440 | Not Available | 634 | Open in IMG/M |
| 3300012944|Ga0137410_10083394 | All Organisms → cellular organisms → Bacteria | 2341 | Open in IMG/M |
| 3300012971|Ga0126369_10216509 | All Organisms → cellular organisms → Bacteria | 1860 | Open in IMG/M |
| 3300012975|Ga0134110_10455053 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 576 | Open in IMG/M |
| 3300012977|Ga0134087_10053983 | All Organisms → cellular organisms → Bacteria | 1591 | Open in IMG/M |
| 3300014154|Ga0134075_10271933 | Not Available | 735 | Open in IMG/M |
| 3300015257|Ga0180067_1069184 | Not Available | 769 | Open in IMG/M |
| 3300015358|Ga0134089_10366136 | Not Available | 610 | Open in IMG/M |
| 3300015359|Ga0134085_10076962 | All Organisms → cellular organisms → Bacteria | 1363 | Open in IMG/M |
| 3300015359|Ga0134085_10350639 | Not Available | 656 | Open in IMG/M |
| 3300017654|Ga0134069_1154864 | Not Available | 767 | Open in IMG/M |
| 3300017654|Ga0134069_1264482 | Not Available | 601 | Open in IMG/M |
| 3300017657|Ga0134074_1004846 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4307 | Open in IMG/M |
| 3300017657|Ga0134074_1120824 | Not Available | 907 | Open in IMG/M |
| 3300017927|Ga0187824_10388518 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 507 | Open in IMG/M |
| 3300017997|Ga0184610_1259789 | Not Available | 576 | Open in IMG/M |
| 3300018028|Ga0184608_10439075 | Not Available | 563 | Open in IMG/M |
| 3300018054|Ga0184621_10097239 | All Organisms → cellular organisms → Bacteria | 1038 | Open in IMG/M |
| 3300018056|Ga0184623_10365715 | Not Available | 643 | Open in IMG/M |
| 3300018072|Ga0184635_10109603 | All Organisms → cellular organisms → Bacteria | 1094 | Open in IMG/M |
| 3300018074|Ga0184640_10176475 | All Organisms → cellular organisms → Bacteria | 960 | Open in IMG/M |
| 3300018076|Ga0184609_10160511 | All Organisms → cellular organisms → Bacteria | 1038 | Open in IMG/M |
| 3300018089|Ga0187774_10123276 | All Organisms → cellular organisms → Bacteria | 1317 | Open in IMG/M |
| 3300018431|Ga0066655_10561307 | Not Available | 764 | Open in IMG/M |
| 3300018433|Ga0066667_10647770 | Not Available | 883 | Open in IMG/M |
| 3300019259|Ga0184646_1103478 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis | 1252 | Open in IMG/M |
| 3300019259|Ga0184646_1474096 | All Organisms → cellular organisms → Bacteria | 1393 | Open in IMG/M |
| 3300019866|Ga0193756_1023405 | Not Available | 864 | Open in IMG/M |
| 3300021080|Ga0210382_10555034 | Not Available | 509 | Open in IMG/M |
| 3300024330|Ga0137417_1115568 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae | 1120 | Open in IMG/M |
| 3300025910|Ga0207684_11647578 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 518 | Open in IMG/M |
| 3300025922|Ga0207646_10648910 | Not Available | 946 | Open in IMG/M |
| 3300026023|Ga0207677_11791328 | Not Available | 570 | Open in IMG/M |
| 3300026298|Ga0209236_1284064 | Not Available | 535 | Open in IMG/M |
| 3300026300|Ga0209027_1232155 | Not Available | 591 | Open in IMG/M |
| 3300026310|Ga0209239_1352601 | Not Available | 515 | Open in IMG/M |
| 3300026312|Ga0209153_1294809 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 519 | Open in IMG/M |
| 3300026313|Ga0209761_1012998 | All Organisms → cellular organisms → Bacteria | 5384 | Open in IMG/M |
| 3300026316|Ga0209155_1202340 | Not Available | 625 | Open in IMG/M |
| 3300026322|Ga0209687_1159948 | Not Available | 721 | Open in IMG/M |
| 3300026324|Ga0209470_1180541 | Not Available | 911 | Open in IMG/M |
| 3300026326|Ga0209801_1017510 | All Organisms → cellular organisms → Bacteria | 3568 | Open in IMG/M |
| 3300026326|Ga0209801_1280554 | Not Available | 604 | Open in IMG/M |
| 3300026327|Ga0209266_1237971 | Not Available | 598 | Open in IMG/M |
| 3300026328|Ga0209802_1048049 | All Organisms → cellular organisms → Bacteria | 2128 | Open in IMG/M |
| 3300026329|Ga0209375_1112026 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis | 1210 | Open in IMG/M |
| 3300026329|Ga0209375_1112225 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis | 1209 | Open in IMG/M |
| 3300026330|Ga0209473_1322816 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 515 | Open in IMG/M |
| 3300026333|Ga0209158_1355534 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 510 | Open in IMG/M |
| 3300026335|Ga0209804_1184817 | Not Available | 895 | Open in IMG/M |
| 3300026530|Ga0209807_1188428 | Not Available | 742 | Open in IMG/M |
| 3300026536|Ga0209058_1225312 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 702 | Open in IMG/M |
| 3300026547|Ga0209156_10093201 | All Organisms → cellular organisms → Bacteria | 1508 | Open in IMG/M |
| 3300027573|Ga0208454_1030888 | All Organisms → cellular organisms → Bacteria | 1255 | Open in IMG/M |
| 3300027616|Ga0209106_1052691 | Not Available | 908 | Open in IMG/M |
| 3300027725|Ga0209178_1357219 | Not Available | 548 | Open in IMG/M |
| 3300027748|Ga0209689_1232416 | Not Available | 779 | Open in IMG/M |
| 3300027787|Ga0209074_10106407 | Not Available | 956 | Open in IMG/M |
| 3300027846|Ga0209180_10194660 | All Organisms → cellular organisms → Bacteria | 1169 | Open in IMG/M |
| 3300027846|Ga0209180_10391393 | Not Available | 789 | Open in IMG/M |
| 3300027909|Ga0209382_10188929 | All Organisms → cellular organisms → Bacteria | 2367 | Open in IMG/M |
| 3300027961|Ga0209853_1148332 | Not Available | 569 | Open in IMG/M |
| 3300027991|Ga0247683_1002701 | All Organisms → cellular organisms → Bacteria | 1625 | Open in IMG/M |
| 3300028784|Ga0307282_10000785 | All Organisms → cellular organisms → Bacteria | 10567 | Open in IMG/M |
| 3300028784|Ga0307282_10355231 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 708 | Open in IMG/M |
| 3300028791|Ga0307290_10038962 | All Organisms → cellular organisms → Bacteria | 1700 | Open in IMG/M |
| 3300028811|Ga0307292_10173300 | Not Available | 879 | Open in IMG/M |
| 3300028884|Ga0307308_10559393 | Not Available | 548 | Open in IMG/M |
| 3300031152|Ga0307501_10273193 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 511 | Open in IMG/M |
| 3300031677|Ga0307480_1021545 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 523 | Open in IMG/M |
| 3300031820|Ga0307473_10099849 | All Organisms → cellular organisms → Bacteria | 1542 | Open in IMG/M |
| 3300031965|Ga0326597_11316742 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 705 | Open in IMG/M |
| 3300032421|Ga0310812_10333408 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 678 | Open in IMG/M |
| 3300032770|Ga0335085_10033498 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae | 7126 | Open in IMG/M |
| 3300032782|Ga0335082_10114785 | All Organisms → cellular organisms → Bacteria | 2651 | Open in IMG/M |
| 3300032897|Ga0335071_11345846 | Not Available | 659 | Open in IMG/M |
| 3300032954|Ga0335083_10506952 | All Organisms → cellular organisms → Bacteria | 1009 | Open in IMG/M |
| 3300033805|Ga0314864_0123341 | Not Available | 646 | Open in IMG/M |
| 3300034176|Ga0364931_0212926 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 631 | Open in IMG/M |
| 3300034177|Ga0364932_0332157 | Not Available | 574 | Open in IMG/M |
| 3300034178|Ga0364934_0104222 | All Organisms → cellular organisms → Bacteria | 1067 | Open in IMG/M |
| 3300034773|Ga0364936_100391 | Not Available | 568 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 21.08% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 20.00% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 18.92% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 4.86% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 4.32% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 3.78% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 3.24% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.70% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 2.70% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 2.16% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 2.16% |
| Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 2.16% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 1.62% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 1.62% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 1.08% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.08% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 1.08% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.54% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 0.54% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 0.54% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.54% |
| Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland | 0.54% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.54% |
| Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 0.54% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.54% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 0.54% |
| Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 0.54% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001356 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 | Environmental | Open in IMG/M |
| 3300001661 | Mediterranean Blodgett CA OM1_O3 (Mediterranean Blodgett coassembly) | Environmental | Open in IMG/M |
| 3300002907 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_40cm | Environmental | Open in IMG/M |
| 3300004058 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_ThreeSqB_D1 | Environmental | Open in IMG/M |
| 3300005167 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 | Environmental | Open in IMG/M |
| 3300005171 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126 | Environmental | Open in IMG/M |
| 3300005172 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 | Environmental | Open in IMG/M |
| 3300005175 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 | Environmental | Open in IMG/M |
| 3300005177 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 | Environmental | Open in IMG/M |
| 3300005178 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 | Environmental | Open in IMG/M |
| 3300005179 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 | Environmental | Open in IMG/M |
| 3300005186 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 | Environmental | Open in IMG/M |
| 3300005187 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 | Environmental | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005446 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 | Environmental | Open in IMG/M |
| 3300005447 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 | Environmental | Open in IMG/M |
| 3300005450 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131 | Environmental | Open in IMG/M |
| 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
| 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
| 3300005540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 | Environmental | Open in IMG/M |
| 3300005552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 | Environmental | Open in IMG/M |
| 3300005558 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 | Environmental | Open in IMG/M |
| 3300005568 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 | Environmental | Open in IMG/M |
| 3300005587 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103 | Environmental | Open in IMG/M |
| 3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
| 3300006034 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105 | Environmental | Open in IMG/M |
| 3300006049 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 | Host-Associated | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006791 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102 | Environmental | Open in IMG/M |
| 3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
| 3300007004 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost | Environmental | Open in IMG/M |
| 3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300010107 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_40_5_8_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010114 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_40_5_16_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010117 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_40_2_4_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010132 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_40_5_16_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010133 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_40_5_8_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010134 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_40_2_8_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010136 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_40_2_24_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010142 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_40_2_4_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010301 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09082015 | Environmental | Open in IMG/M |
| 3300010304 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09182015 | Environmental | Open in IMG/M |
| 3300010322 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010323 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010325 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_0_1 metaG | Environmental | Open in IMG/M |
| 3300010335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09082015 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010856 | Boreal forest soil eukaryotic communities from Alaska, USA - W4-2 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010905 | Grasslands soil microbial communities from Angelo Coastal Reserve, California, USA - 15_R_Wat_40_2_8_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300012035 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT338_2 | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012204 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012285 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
| 3300012354 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012355 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaG | Environmental | Open in IMG/M |
| 3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012373 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_2_0_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012376 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_5_0_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012379 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_5_4_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012387 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_2_16_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012388 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_2_24_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012389 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_5_16_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012395 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_2_8_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012396 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_5_0_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012400 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_2_4_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012402 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_5_8_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
| 3300012532 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
| 3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300012975 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_11112015 | Environmental | Open in IMG/M |
| 3300012977 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300014154 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09212015 | Environmental | Open in IMG/M |
| 3300015257 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT231_16_10D | Environmental | Open in IMG/M |
| 3300015358 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300015359 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09182015 | Environmental | Open in IMG/M |
| 3300017654 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300017657 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09212015 | Environmental | Open in IMG/M |
| 3300017927 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_4 | Environmental | Open in IMG/M |
| 3300017997 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_coex | Environmental | Open in IMG/M |
| 3300018028 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_coex | Environmental | Open in IMG/M |
| 3300018054 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_b1 | Environmental | Open in IMG/M |
| 3300018056 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_b1 | Environmental | Open in IMG/M |
| 3300018072 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b2 | Environmental | Open in IMG/M |
| 3300018074 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b2 | Environmental | Open in IMG/M |
| 3300018076 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_coex | Environmental | Open in IMG/M |
| 3300018089 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_20_MG | Environmental | Open in IMG/M |
| 3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300019259 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019866 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H1m1 | Environmental | Open in IMG/M |
| 3300021080 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_coex redo | Environmental | Open in IMG/M |
| 3300024330 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026298 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026300 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026310 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_2_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026312 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120 (SPAdes) | Environmental | Open in IMG/M |
| 3300026313 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026316 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 (SPAdes) | Environmental | Open in IMG/M |
| 3300026322 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136 (SPAdes) | Environmental | Open in IMG/M |
| 3300026324 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 (SPAdes) | Environmental | Open in IMG/M |
| 3300026326 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 (SPAdes) | Environmental | Open in IMG/M |
| 3300026327 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 (SPAdes) | Environmental | Open in IMG/M |
| 3300026328 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 (SPAdes) | Environmental | Open in IMG/M |
| 3300026329 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131 (SPAdes) | Environmental | Open in IMG/M |
| 3300026330 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 (SPAdes) | Environmental | Open in IMG/M |
| 3300026333 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 (SPAdes) | Environmental | Open in IMG/M |
| 3300026335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 (SPAdes) | Environmental | Open in IMG/M |
| 3300026530 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 (SPAdes) | Environmental | Open in IMG/M |
| 3300026536 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 (SPAdes) | Environmental | Open in IMG/M |
| 3300026547 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 (SPAdes) | Environmental | Open in IMG/M |
| 3300027573 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT100 (SPAdes) | Environmental | Open in IMG/M |
| 3300027616 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM1_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027725 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 (SPAdes) | Environmental | Open in IMG/M |
| 3300027748 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 (SPAdes) | Environmental | Open in IMG/M |
| 3300027787 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter (SPAdes) | Environmental | Open in IMG/M |
| 3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027909 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027961 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_30_40 (SPAdes) | Environmental | Open in IMG/M |
| 3300027991 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK24 | Environmental | Open in IMG/M |
| 3300028784 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_121 | Environmental | Open in IMG/M |
| 3300028791 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_144 | Environmental | Open in IMG/M |
| 3300028811 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_149 | Environmental | Open in IMG/M |
| 3300028884 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_195 | Environmental | Open in IMG/M |
| 3300031152 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 15_S | Environmental | Open in IMG/M |
| 3300031677 | Metatranscriptome of hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
| 3300031965 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT100D185 | Environmental | Open in IMG/M |
| 3300032421 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NN3 | Environmental | Open in IMG/M |
| 3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
| 3300032782 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1 | Environmental | Open in IMG/M |
| 3300032897 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.5 | Environmental | Open in IMG/M |
| 3300032954 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2 | Environmental | Open in IMG/M |
| 3300033805 | Tropical peat soil microbial communities from peatlands in Loreto, Peru - MAQ_50_10 | Environmental | Open in IMG/M |
| 3300034176 | Sediment microbial communities from East River floodplain, Colorado, United States - 21_j17 | Environmental | Open in IMG/M |
| 3300034177 | Sediment microbial communities from East River floodplain, Colorado, United States - 17_j17 | Environmental | Open in IMG/M |
| 3300034178 | Sediment microbial communities from East River floodplain, Colorado, United States - 27_j17 | Environmental | Open in IMG/M |
| 3300034773 | Sediment microbial communities from East River floodplain, Colorado, United States - 4_s17 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI12269J14319_1001132911 | 3300001356 | Peatlands Soil | VVAGPLLVARRRSYHRTWLLGFVGVSSRAAVEGWRDHLVAVEEPDAHD* |
| JGI12053J15887_106480622 | 3300001661 | Forest Soil | LVVTRRRAYHREWLLGFEGVTSRAAVEGWRDQLVAVDE* |
| JGI25613J43889_101447062 | 3300002907 | Grasslands Soil | EARAVLAGPLVVTRRRSYHREWLLGFEGVTSRAAVEGWRDQFVAVDE* |
| Ga0055498_100782852 | 3300004058 | Natural And Restored Wetlands | REVLAGPLVVARRRAYHREWLLGFEGISSRAAVESWRDQLVAVDE* |
| Ga0066672_105983302 | 3300005167 | Soil | PLIVARRRAYHREWLLGFVGVTSRAVVESWRDHFVAVEEADADD* |
| Ga0066677_106255961 | 3300005171 | Soil | LNEDRAVIAGPLVVARRRAYHREWLLGFEGVTSRAAVESWRDQLVAVDE* |
| Ga0066683_101658771 | 3300005172 | Soil | GPLVVARRRAYHREWLLSFVGVKSRADVEPWREQFVAVEETDADD* |
| Ga0066673_105409492 | 3300005175 | Soil | GPLVVTRRRAYHREWLLGFEGVTSRAAVEGWRDQLVAVDE* |
| Ga0066673_106443761 | 3300005175 | Soil | GPLVVARRRAYHREWLLGFEGVTSRAAVESWRDQLVAVDE* |
| Ga0066690_103595893 | 3300005177 | Soil | GPLVVARRRAYHREWLLGFEGVTSRAAVEAWRDHLVAVEEADATD* |
| Ga0066688_102404053 | 3300005178 | Soil | PLIVARRRAYHREWLLGFVGVTSRAVVESWRDHFVAVEEADADG* |
| Ga0066684_102261211 | 3300005179 | Soil | ERQVVAGPLIVARRRAYHREWLLGFVGVTSRAVVESWRDHFVAVEEADADD* |
| Ga0066684_107617172 | 3300005179 | Soil | LLVVNEDREVIAGPLIVARRRAYHREWLLSFVGVTSRAVVEQWRDQLVTVEEADADD* |
| Ga0066676_102316191 | 3300005186 | Soil | PLVVTRRRAYHREWLLGFEGVTSRAAVEGWRDQLVAVDE* |
| Ga0066675_102254301 | 3300005187 | Soil | ARRRAYHREWLLGFVGVTSRAVVESWRDHLVAVEETDAAD* |
| Ga0070708_1000101548 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | LAGPLIVARRRAYHREWLIGFAGVTSRDAVEGWRDQLLAVQESDARA* |
| Ga0066686_104567161 | 3300005446 | Soil | RVLAGPLVVARRRAYHREWLIGFEGVQARETVESWRNQLVAVEDGDADD* |
| Ga0066689_103117071 | 3300005447 | Soil | AGPLVVARRRAYHREWLLSFVGVKSRAVVEPWRDHFVAVAETDADD* |
| Ga0066689_109747381 | 3300005447 | Soil | AGPLVVARRRAYHREWLLSFVGVKSRAVVEPWRDHFVAVEETDADD* |
| Ga0066682_101474361 | 3300005450 | Soil | ARRRAYHREWLLGFEGVSGRAVVEAWRDHYVATDEPDAHD* |
| Ga0070707_1006454001 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | VLVVNEEREVVAGPLIVARRRSYHREFLLSFVGVTSRAVVEPWRDHFVAVDDADADD* |
| Ga0070697_1009677702 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | GPLIVTRRRAYHREWLLGFQGVTSRAVVEAWRDQFLAIVDDDAQD* |
| Ga0066697_101916703 | 3300005540 | Soil | AYHREWLLSFVGVKSRAVVEPWRDQFVAVEETDADD* |
| Ga0066701_107969401 | 3300005552 | Soil | RRRAYHREWLLGFEGVSGRAVVEAWRDHYVATDEPDAHD* |
| Ga0066698_108952342 | 3300005558 | Soil | YHREWLLSFVGVNSRAVVEPWRDHFVAVEETDADN* |
| Ga0066703_107194012 | 3300005568 | Soil | VARRRAYHREWLLGFVGVTSRAVVESWRDHFVAVEEADADD* |
| Ga0066703_108129911 | 3300005568 | Soil | VVDDEHRVLAGPLVVARRRAYHREWLIGFEGVQARETVESWRNQLVAVEDGDADD* |
| Ga0066654_100454625 | 3300005587 | Soil | AYHRAWLLGFVGVTTRAVVESWRDHLVAVEETDAAD* |
| Ga0066706_114181122 | 3300005598 | Soil | EERTVLAGPLVVARRRSYHREWLLGFEGVTSRAAVESWRDQLVAVDE* |
| Ga0066656_100920721 | 3300006034 | Soil | PLIVARRRAYHREWLLGFVGVTSRAVVEPWRDHFVAVEEADADA* |
| Ga0075417_103209612 | 3300006049 | Populus Rhizosphere | VLAGPLVVARRRSYHREWLLGFEGVTSRAAVESWRDQLVAVDA* |
| Ga0079222_100966361 | 3300006755 | Agricultural Soil | LVVTRRRAYHREWLLGFEGVTSRAAVEGWRDQFIAVDE* |
| Ga0079222_115177451 | 3300006755 | Agricultural Soil | LTVARRRAYHREWLLSFVGVTSRAVVEQWRDQLVTVEEADADD* |
| Ga0066653_102828781 | 3300006791 | Soil | HREWLIGFEGVQAREAVEPWRNQLVAVRDGDADD* |
| Ga0066665_100785325 | 3300006796 | Soil | AYHREWLLGFVGVTSRAVVESWRDHFVAVEEADADD* |
| Ga0066659_100368925 | 3300006797 | Soil | AYHREWLLGFVGVTSRAVVESWRDHLVAVEETDAAD* |
| Ga0075434_1009459331 | 3300006871 | Populus Rhizosphere | NAEREVVAGPLIVARRRAYHREWLLSFVGVTSRAVVEPWRDHFVAVDDADADD* |
| Ga0079219_100628631 | 3300006954 | Agricultural Soil | DEARRVLAGPLFVARRRAYHREWLIGFAGVTSRDAVEGWRDQLLAVPDRDAGA* |
| Ga0079218_138108382 | 3300007004 | Agricultural Soil | LAGPLVIARRRSYHREWLLGFEGITSRAAVESWRDQLVAVDE* |
| Ga0099793_100332535 | 3300007258 | Vadose Zone Soil | VSRRRGYHREMLLAFEGITSRAAVEAWRDQLVAVEE* |
| Ga0099827_100460091 | 3300009090 | Vadose Zone Soil | RAVIAGPLVVARRRAYHREWLLGFEGVTSRAAVESWRDQLVAVDE* |
| Ga0099827_116466631 | 3300009090 | Vadose Zone Soil | DEHRVVAGPLVVARRRAYHREWLIGFEGVQAREAVEPWRNQLVAVRDGDADD* |
| Ga0075418_106317201 | 3300009100 | Populus Rhizosphere | VTRRRAYHHEWLLGFSGVTSRDAVEPWRDQLVAVLETDARD* |
| Ga0066709_1011002461 | 3300009137 | Grasslands Soil | VAGPLVVARRRAYHREWLLSFVGVKSRAVVEPWRDHFVAVEETDADD* |
| Ga0075423_104271031 | 3300009162 | Populus Rhizosphere | VVTRRRAYHREWLLGFEGVTSRAAVEGWRDQFIAVDE* |
| Ga0127494_10807434 | 3300010107 | Grasslands Soil | AERQVVAGPLVVARRRAYHREWLLGFLGVTSRAVVEPWRDHFVAVEEADADD* |
| Ga0127460_10510041 | 3300010114 | Grasslands Soil | DEDRKVLAGPLVVTRRRAYHREWLLGFEGVTSREAVESWRDQLVAVDE* |
| Ga0127449_11182793 | 3300010117 | Grasslands Soil | LVIARRRSYHREWLLGFEGVTSREAVEAWRDQLVAVDE* |
| Ga0127455_11436442 | 3300010132 | Grasslands Soil | LAGPLVVTRRRAYHREWLLGFEGVTSRAAVEGWRDQLVAVDE* |
| Ga0127459_11374671 | 3300010133 | Grasslands Soil | LNEERTVLAGPLVVARRRSYHREWLLGFEGVTSRAAVESWRDQLVAVDE* |
| Ga0127484_11232252 | 3300010134 | Grasslands Soil | ARRRAYHRGWLLGFEGVTSRTAVEGWRDQLVAVDE* |
| Ga0127447_11770652 | 3300010136 | Grasslands Soil | LAGPLVVTRRRSYHRGWLLGFEGVTSRAAVERWRDQLVAVDE* |
| Ga0127483_11766941 | 3300010142 | Grasslands Soil | EERQVVAGPLIVARRRAYHREWLLGFVGVTSRAVVESWRDHFVAVEEADADD* |
| Ga0127483_12599822 | 3300010142 | Grasslands Soil | EVLAGPLVVTRRRAYHREWLLGFEGVTSRAAVEGWRYQLVAVDE* |
| Ga0134070_103466791 | 3300010301 | Grasslands Soil | RRRSYHREWLLGFEGVTSRAAVEGWRDQFIAVDE* |
| Ga0134088_100397265 | 3300010304 | Grasslands Soil | AYHREWLLGFLGVTSRAVVEPWRDHFVAVEEADADD* |
| Ga0134088_104137472 | 3300010304 | Grasslands Soil | GPLVVARRRAYHREWLLSFVGVKARADVEPWREHFVAVGETDADD* |
| Ga0134084_100099961 | 3300010322 | Grasslands Soil | IVARRRAYHREWLLGFVGVTSRAVVEPWRDHFVAVEEADADA* |
| Ga0134086_102074391 | 3300010323 | Grasslands Soil | VVAGPLIIARRRAYHREWLLGFEGVSGRAVVEAWRDHYVATDEPDAHD* |
| Ga0134064_101577971 | 3300010325 | Grasslands Soil | NEERHVVAGPLVVARRRAYHREWLLSFVGVNSRAVVEPWRDHFVAVEETDADD* |
| Ga0134063_103606362 | 3300010335 | Grasslands Soil | RRAYHREWLLSFVGVKSRAVVEPWRDHFVAVEEPDADD* |
| Ga0126376_111933102 | 3300010359 | Tropical Forest Soil | RRRAYHREWLIGFAGVTSRETVESWRDQLLAVPENDAGA* |
| Ga0126358_11522632 | 3300010856 | Boreal Forest Soil | LIVARRRAYHREWLLAFVGVTSRAVVEPWRDHYVAVDEPDADG* |
| Ga0138112_10988772 | 3300010905 | Grasslands Soil | AGPLVVARRRAYHREWLLSFVGVNSRAVVEPWRDHFVAVEETDADN* |
| Ga0137392_100482026 | 3300011269 | Vadose Zone Soil | VVARRRAYHRGWLLGFEGITSRAVVEAWRDRLVAVAEADVDD* |
| Ga0137393_100662095 | 3300011271 | Vadose Zone Soil | QVLAGPLVVARRRAYHRAWLLGFEGITSRAVVEAWRDRLVAVAEADVDD* |
| Ga0137393_108937891 | 3300011271 | Vadose Zone Soil | LLVVNEERQVVAGPLIVARRRAYHREWLLSFVGVRSRAVVEQWRDHFVAVEQADADD* |
| Ga0137445_11131022 | 3300012035 | Soil | LAGPLVLARRRAYHREWLLGFEGITSRAAVEGWRDQLVAIADDADG* |
| Ga0137389_101106545 | 3300012096 | Vadose Zone Soil | LAGPLVVARRRSYHREWLLGFEGVTSRAAVEGWRDQLVAVDE* |
| Ga0137389_107588952 | 3300012096 | Vadose Zone Soil | IVARRRAYHREWLIGFAGVTSRDAVEGWRDQLLAVQESDAGA* |
| Ga0137388_106235023 | 3300012189 | Vadose Zone Soil | LLVVNEERQVVAGPLIVARRRAYHREWLLSFVGVRSRAVVELWRDHFVAVEEADADD* |
| Ga0137382_107382181 | 3300012200 | Vadose Zone Soil | LAGPLVLARRRSYHREWLLGFEGVTSRDAVEGWRDQLVAVDE* |
| Ga0137399_112160102 | 3300012203 | Vadose Zone Soil | AGPLVVSRRRGYHREMLLAFEGITSRAAVEAWRDQLVAVEE* |
| Ga0137374_103648243 | 3300012204 | Vadose Zone Soil | DEERRVVAGPLVVARRRAYHREWLIGFEGVQAREAVEPWRNQLVAVRDGDADD* |
| Ga0137376_103458063 | 3300012208 | Vadose Zone Soil | NEARVVLAGPLVVTRRRSYHREWLLGFEGVTSRAAVEGWRDQFIAVDE* |
| Ga0137376_114908121 | 3300012208 | Vadose Zone Soil | YHREWLIAFEGVQAREAVESWRNQLVAVEDGDADD* |
| Ga0137379_104894683 | 3300012209 | Vadose Zone Soil | LNEARAVLAGPLVVTRRRSYHREWLLGFEGVTSRAAVEGWRDQFVAVDE* |
| Ga0137378_111502612 | 3300012210 | Vadose Zone Soil | LVVARRRAYHRGWLLGFEGVTSRAAVERWRDQLVAVDE* |
| Ga0137377_117872151 | 3300012211 | Vadose Zone Soil | YHREWLLSFVGVKSRAVVEPWRDHFVAVEETDAGD* |
| Ga0137370_105134832 | 3300012285 | Vadose Zone Soil | LAGPLVVARRRAYHREWLIAFEGVQARETVESWRNQLVAVEDGDADD* |
| Ga0137387_106643061 | 3300012349 | Vadose Zone Soil | RRRSYHREWLLGFEGVTSRAAVEGWRDQFVAVDE* |
| Ga0137387_113366552 | 3300012349 | Vadose Zone Soil | VLARRRAYHREWLLGFEGVTARVVVEAWRDRFLAVEDDDAHD* |
| Ga0137366_104820312 | 3300012354 | Vadose Zone Soil | GPLIVARRRGYHREWLLSFVGVTSRAVVEPWRDHFVAVDGGDADD* |
| Ga0137369_106164311 | 3300012355 | Vadose Zone Soil | RRRAYHREWLLGFEGVTSRAAVESWRDQLVAVDE* |
| Ga0137371_108324441 | 3300012356 | Vadose Zone Soil | TRRRAYHREWLLGFEGVTSRAAVEGWRDQLVAVDE* |
| Ga0137385_116283692 | 3300012359 | Vadose Zone Soil | VVAGPLVVARRRAYHREWLLSFVGVKSRAVVEPWRDHFVAVEETDADD* |
| Ga0134042_11657412 | 3300012373 | Grasslands Soil | VAGPLVVARRRAYHREWLLSFVGVKSRAVVEPWRDHFVAVDETDADD* |
| Ga0134032_11719151 | 3300012376 | Grasslands Soil | LLVVTEERRVVAGPLVVARRRAYHREWLLGFVGVTSRAVVESWRDHLVAVEETDAAD* |
| Ga0134058_12621442 | 3300012379 | Grasslands Soil | LDEARAVLAGPLVVTRRRSYHREWLLGFEGVTSRAAVESWRDQLVAVDE* |
| Ga0134030_11451042 | 3300012387 | Grasslands Soil | VNEARQVVAGPLIVARRRAYHREWLLGFVGVTSRAVVEPWRDHFVAVAEADADA* |
| Ga0134031_10350652 | 3300012388 | Grasslands Soil | EERRVVAGPLVVARRRAYHREWLLGFVGVTSRAVVESWRDHLVAVEETDAAD* |
| Ga0134040_13117661 | 3300012389 | Grasslands Soil | RRVVAGPLVVARRRAYHREWLLGFVGVTSRAVVESWRDHLVAVEETDAAD* |
| Ga0134044_12404441 | 3300012395 | Grasslands Soil | VAGPLVVSRRRGYHREWLLAFEGITSRAAVESWRDKLVAVDE* |
| Ga0134057_10139262 | 3300012396 | Grasslands Soil | IARRRSYHREWLLGFEGVTSREAVEAWRDQLVAVDE* |
| Ga0134048_11080063 | 3300012400 | Grasslands Soil | VVAGPLVVARRRAYHREWLIGFEGVQAREAVEPWRNQLVAVRDGDADD* |
| Ga0134059_14071882 | 3300012402 | Grasslands Soil | LPLAGPLVVARRRSYHREWLLGFEGVTSRAAVESWRDQLVAVDE* |
| Ga0150984_1219292881 | 3300012469 | Avena Fatua Rhizosphere | EDRAVLAGPLVVARRRAYHREWLLGFEGVTSRAAVEGWRDQLVAVDE* |
| Ga0137373_100793945 | 3300012532 | Vadose Zone Soil | NEERQVVAGPLVVARRRAYHREWLLGFDGVTSRAAVAPWRDHFIAVEEADADP* |
| Ga0137396_111084842 | 3300012918 | Vadose Zone Soil | ARRRAYHREWLLGFEGVTSRAAVESWRDQLVAVDE* |
| Ga0137394_101648134 | 3300012922 | Vadose Zone Soil | RRAYHREWLIGFEGVQARETVESWRNQLVAVEDGDADD* |
| Ga0137419_110334162 | 3300012925 | Vadose Zone Soil | EDRKVLAGPLVLARRRAYHREWLLGFEGITSRAAVEGWRDQLVAIADDADG* |
| Ga0137416_114033262 | 3300012927 | Vadose Zone Soil | VLAGPLVVTRRRAYHREWLLGFEGVTSREAVESWRDQLVAVDE* |
| Ga0137404_103106133 | 3300012929 | Vadose Zone Soil | VNEERHVVAGPLVVARRRAYHREWLLSFVGVRSRAVVEQWRDHFVAVEQADADD* |
| Ga0137404_114544402 | 3300012929 | Vadose Zone Soil | VLAGPLVVTRRRAYHREWLLGFEGVTSRAAVEGWRDQFVAVDE* |
| Ga0137410_100833945 | 3300012944 | Vadose Zone Soil | EREVLAGPLVVSRRRGYHREMLLAFEGITSRAAVEAWRDQLVAVEE* |
| Ga0126369_102165091 | 3300012971 | Tropical Forest Soil | YVVDEARRVLAGPLFFAWRRAYHREWLIGFAGVTSRETVESWRDQLLAVPESDAGP* |
| Ga0134110_104550532 | 3300012975 | Grasslands Soil | VVAGPLVVARRRAYHRGWLLGFVGVTSRAVVESWRDHLVAVEETDAAD* |
| Ga0134087_100539831 | 3300012977 | Grasslands Soil | RRRAYHREWLLSFVGVNSRAVVESWRDHLVAVEETDAAD* |
| Ga0134075_102719332 | 3300014154 | Grasslands Soil | VLAGPLVVARRRAYHREWLIGFEGVQARETVESWRNQLVAVEDGDADD* |
| Ga0180067_10691842 | 3300015257 | Soil | RAYHREYLLGFVGVTGRAAVEGWRDHYVATDGPDTDDADD* |
| Ga0134089_103661362 | 3300015358 | Grasslands Soil | AGPLVVARRRAYHRAWLLGFEGITSRAAVEGWRDRFVAVAEADADD* |
| Ga0134085_100769624 | 3300015359 | Grasslands Soil | VVDEEHRVIAGPLVVARRRAYHREWLIGFAGVLAREAVEPWRNQLVAVRDGDADD* |
| Ga0134085_103506392 | 3300015359 | Grasslands Soil | KVLAGPLVVTRRRAYHREWLLGFEGVTSRAAVEGWRDQLVAVDE* |
| Ga0134069_11548641 | 3300017654 | Grasslands Soil | LVVTRRRAYHREWLLGFEGVTSRAAVEGWRDQLVAVDE |
| Ga0134069_12644821 | 3300017654 | Grasslands Soil | NEARQVVAGPLIVARRRAYHREWLLGFVGVTSRAVVEPWRDHFVAVEEADADA |
| Ga0134074_10048461 | 3300017657 | Grasslands Soil | RQVVAGPLIVARRRAYHREWLLGFVGVTSRAVVEPWRDHFVAVEEADADA |
| Ga0134074_11208243 | 3300017657 | Grasslands Soil | RRAYHREWLLGFVGVTSRAAVEPWRHHFIALEDADADD |
| Ga0187824_103885181 | 3300017927 | Freshwater Sediment | PLLVARRRAYHRAWLLGFVGVTSRAAVEAWRDHFVAVEEPDAHD |
| Ga0184610_12597891 | 3300017997 | Groundwater Sediment | GPLVLTRRRAYHREWLLGFEGITSRAAVEEWRDQLVAVDE |
| Ga0184608_104390752 | 3300018028 | Groundwater Sediment | VLARRRAYHREWLLGFEGITSRAAVEGWRDQLVAVADDADG |
| Ga0184621_100972393 | 3300018054 | Groundwater Sediment | YVLDEDRKVVAGPLVIARRRSYHREWLLGFGGVTSREAVEAWRDQLVAVDE |
| Ga0184623_103657152 | 3300018056 | Groundwater Sediment | RRVIAGPLVVARRRAYHREWLLGFVGVTDRAAGGGWRDHYVATDEPDADD |
| Ga0184635_101096033 | 3300018072 | Groundwater Sediment | LARRRAYHREWLLGFEGITSRAAVEGWRDQLVAVADDADG |
| Ga0184640_101764753 | 3300018074 | Groundwater Sediment | AYHREWLLGFEGITSRAAVEGWRDQLVAVAEDADADA |
| Ga0184609_101605111 | 3300018076 | Groundwater Sediment | LVLARRRAYHREWLLGFEGITSRAAVEGWRDQLVAIDDERDDADG |
| Ga0187774_101232764 | 3300018089 | Tropical Peatland | RSYHRQWLLGFAGVTSREVVEQWRDQFVAIEETDADG |
| Ga0066655_105613072 | 3300018431 | Grasslands Soil | AGPLVVARRRAYHREWLIGFEGVQAREAVEPWRNQLVAVRDGDADD |
| Ga0066667_106477701 | 3300018433 | Grasslands Soil | PLIVARRRAYHREWLLGFVGVTSRAVVEPWRDHFVAVEEADADA |
| Ga0184646_11034781 | 3300019259 | Groundwater Sediment | REVLAGPLVVTRRRAYHREWLLGFEGITSRAAVESWRDQLVAVDV |
| Ga0184646_14740961 | 3300019259 | Groundwater Sediment | AVLAGPLVLTRRRAYHREWLLGFEGISSRAAVEEWRDQLVAVED |
| Ga0193756_10234051 | 3300019866 | Soil | LVLARRRAYHREWLLGFEGITSRAAVEGWRDQLVAIADDADG |
| Ga0210382_105550342 | 3300021080 | Groundwater Sediment | EDRKVVAGPLVIARRRSYHREWLLGFEGVTSREAVEAWRDQLVAVDE |
| Ga0137417_11155683 | 3300024330 | Vadose Zone Soil | RKVLAGPLVVTRRRAYHREWLLGFEGVTSREAVEAWRDQLVAVDE |
| Ga0207684_116475781 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | EDRKVLAGPLVVTRRRAYHREWLLGFEGVTSRAAVESWRDQLVAVDE |
| Ga0207646_106489101 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | RVLVVNEEREVVAGPLIVARRRSYHREFLLSFVGVTSRAVVEPWRDHFVAVDDADADD |
| Ga0207677_117913281 | 3300026023 | Miscanthus Rhizosphere | FVLNESREVLAGPLAIARRRSYHREWLIGFEGITSRAAVEAWRDQLVAVEE |
| Ga0209236_12840642 | 3300026298 | Grasslands Soil | LVVARRRAYHREWLLSFVGVNSRAVVEPWRDHFVAVEETDADD |
| Ga0209027_12321551 | 3300026300 | Grasslands Soil | RLYVVDDEHRVLAGPLVVARRRAYHREWLIGFEGVQARETVESWRNQLVAVEDGDADD |
| Ga0209239_13526012 | 3300026310 | Grasslands Soil | GPLVVARRRAYHREWLIGFEGVQARETVESWRNQLVAVEDGDADD |
| Ga0209153_12948091 | 3300026312 | Soil | PLVVTRRRAYHREWLLGFEGVTSRSAVEEWRDQLVAVDE |
| Ga0209761_10129981 | 3300026313 | Grasslands Soil | GPLVVARRRSYHREWLLGFEGVTSRAAVERWRDQLVAVDE |
| Ga0209155_12023401 | 3300026316 | Soil | GPLVVARRRAYHREWLLGFEGVTSRAAVESWRDQLVAVDE |
| Ga0209687_11599481 | 3300026322 | Soil | VVNEDRRVVAGPLVVARRRAYHREWLLGFVGVTSRAVVESWRDHLVAVEETDAAD |
| Ga0209470_11805411 | 3300026324 | Soil | AGPLVVTRRRAYHREWLLGFEGVTSRAAVEGWRDQLVAVDE |
| Ga0209801_10175101 | 3300026326 | Soil | LIVARRRAYHREWLLGFVGVTSRAVVESWRDHFVAVEEADADD |
| Ga0209801_12805542 | 3300026326 | Soil | DRKVLAGPLVVTRRRAYHREWLLGFEGVTSRDAVEGWRDQLVAVDE |
| Ga0209266_12379712 | 3300026327 | Soil | RRAYHREWLLSFVGVKSRADVEPWREHFVAVEETDADD |
| Ga0209802_10480495 | 3300026328 | Soil | VVAGPRIVARRRAYHREWLLGFVGVTSRAVVESWRDHFVAVEEADADD |
| Ga0209375_11120263 | 3300026329 | Soil | YHREWLLGFEGVSGRAVVEAWRDHYVATDEPDAHD |
| Ga0209375_11122251 | 3300026329 | Soil | ARDVLAGPLVVTRRRSYHRGWLLGFEGVTSRAAVERWRDQLVAVDE |
| Ga0209473_13228162 | 3300026330 | Soil | DRAVLAGPLVVTRRRAYHREWLLGFEGVTSRSAVEEWRDQLVAVDE |
| Ga0209158_13555342 | 3300026333 | Soil | RLYVVNEERQVVAGPLIVARRRAYHREWLLGFVGVTSRAVVESWRDHFVAVEEADADD |
| Ga0209804_11848172 | 3300026335 | Soil | VVAGPLIVARRRAYHREWLLGFVGVTSRAVVESWRDHFVAVEEADADD |
| Ga0209807_11884281 | 3300026530 | Soil | PLIVARRRAYHREWLLGFVGVTSRAVVESWRDHFVAVEEADADD |
| Ga0209058_12253122 | 3300026536 | Soil | VLNEERRVLAGPLVVARRRSYHREWLLGFEGVSSRAAVEGWRDQLVAVDE |
| Ga0209156_100932011 | 3300026547 | Soil | VVNEERRVVAGPLVVARRRAYHREWLLGFEGVTSRAAVEVWRDHLVAVEEADATD |
| Ga0208454_10308883 | 3300027573 | Soil | RQVLAGPLVIARRRAYHRGWLLGFEGITSRGAVESWRDQLVAVDG |
| Ga0209106_10526911 | 3300027616 | Forest Soil | YHREWLLSFVGVKSRAVVEPWRDHFVAVEETDADD |
| Ga0209178_13572191 | 3300027725 | Agricultural Soil | VARRRAYHREWLLSFVGVTSRAVVEPWRDHFVAVDDADADD |
| Ga0209689_12324162 | 3300027748 | Soil | VVNEERQVVAGPLIVARRRAYHREWLLGFVGVTSRAVVESWRDHFVAVEEADADD |
| Ga0209074_101064073 | 3300027787 | Agricultural Soil | EEREVVAGPLIVARRRAYHRGWLLSFVGVTSRAVVEPWRDHFVAVDDADADD |
| Ga0209180_101946602 | 3300027846 | Vadose Zone Soil | VYVLNEEREVLAGPLVLSRRRAYHREWLLGFEGITSRAAVEAWRDQLVAVDE |
| Ga0209180_103913932 | 3300027846 | Vadose Zone Soil | IAGPLVVARRRAYHREWLLGFEGVTSRAAVESWRDQLVAVDE |
| Ga0209382_101889295 | 3300027909 | Populus Rhizosphere | RRAYHREWLLGFEGITSRAAVEGWRDQLVAIDDERDDADG |
| Ga0209853_11483321 | 3300027961 | Groundwater Sand | YVVNEDRQVVAGPLVVARRRAYHREWLLGFVGVTSRAVVEQWRDHFVAVDEADADD |
| Ga0247683_10027011 | 3300027991 | Soil | VDEARRVLAGPLFVARRRAYHREWLIGFAGVTSREAVEGWRDQLLAVPDSDAGA |
| Ga0307282_1000078513 | 3300028784 | Soil | ARRRAYHREWLLGFEGITSRAAVEGWRDQLVAVADDADG |
| Ga0307282_103552312 | 3300028784 | Soil | GPLVLARRRAYHREWLLGFEGITSRAAVEGWRDQLVAIADDADG |
| Ga0307290_100389621 | 3300028791 | Soil | MDEDRKILAGPLVLARRRAYHREWLLAFEGITSRAAVEGWRDQLVAIGDDADG |
| Ga0307292_101733001 | 3300028811 | Soil | LNEEREVLAGPLVVARRRSYHREWLLGFEGVTSRAAVESWRDQLVAVDA |
| Ga0307308_105593931 | 3300028884 | Soil | EVLAGPLVVARRRSYHREWLLGFEGVTSRAAVESWRDQLVAVDT |
| Ga0307501_102731932 | 3300031152 | Soil | ARRRAYHREWLLSFIGVKSRAVVEPWRDHFVAVEEADAGD |
| Ga0307480_10215452 | 3300031677 | Hardwood Forest Soil | LAGPLVVTRRRAYHREWLLGFEGVTSRAAVESWRDQFVAVDE |
| Ga0307473_100998491 | 3300031820 | Hardwood Forest Soil | ARRRAYHREWLLSFIGVRSRAVVEPWRDHFVAVEEADADD |
| Ga0326597_113167421 | 3300031965 | Soil | RVIAGPLVLARRRAYHREWLVGFAGVTSREAVEGWRDRFLAVLEPDARD |
| Ga0310812_103334082 | 3300032421 | Soil | YHREWLIGFAGVTSRDAVEGWRDQLLAVQESDAGA |
| Ga0335085_100334986 | 3300032770 | Soil | VVDDTRKVLAGPLILGRRRAYHREWLLGFEGVRSRAVVEEWRDQYLAVEDEG |
| Ga0335082_101147851 | 3300032782 | Soil | GRRRAYHREWLLGFEGVSSRAAVEEWRGQYLALEDEG |
| Ga0335071_113458461 | 3300032897 | Soil | KQVLAGPLIIARRRAYHREWLLGFVGVTSRDVVEPWRDQFVATDEPDVDD |
| Ga0335083_105069523 | 3300032954 | Soil | YHRQWLLGFAGITSRTVVEPWRDQFVAIEEPDADG |
| Ga0314864_0123341_1_132 | 3300033805 | Peatland | LFVARRRAYHREWLIGFAGVTSRDAVEAWRDQLLAVREPDAGA |
| Ga0364931_0212926_388_549 | 3300034176 | Sediment | MDEDRKILAGPLVLARRRAYHREWLLGFEGITSRAAVEGWRDQLVAIADDADG |
| Ga0364932_0332157_445_573 | 3300034177 | Sediment | LVLARRRAYHREWLLGFEGITSRAAVEGWRNQLVAIADDADG |
| Ga0364934_0104222_943_1065 | 3300034178 | Sediment | LARRRAYHREWLLGFEGITSRAAVEGWRNQLVAIADDADG |
| Ga0364936_100391_11_142 | 3300034773 | Sediment | LVLARRRAYHREWLLGFSGVTSREAVEGWRDQFLAVLEPDARD |
| ⦗Top⦘ |