| Basic Information | |
|---|---|
| Family ID | F030397 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 185 |
| Average Sequence Length | 42 residues |
| Representative Sequence | AAALAELVAEGAFTEEKALELARLYLHDNAAKLYGEKK |
| Number of Associated Samples | 156 |
| Number of Associated Scaffolds | 185 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 1.63 % |
| % of genes near scaffold ends (potentially truncated) | 95.14 % |
| % of genes from short scaffolds (< 2000 bps) | 88.11 % |
| Associated GOLD sequencing projects | 144 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.56 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (98.378 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (17.838 % of family members) |
| Environment Ontology (ENVO) | Unclassified (29.189 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (54.054 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 46.97% β-sheet: 0.00% Coil/Unstructured: 53.03% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.56 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 185 Family Scaffolds |
|---|---|---|
| PF07883 | Cupin_2 | 83.78 |
| PF01431 | Peptidase_M13 | 2.16 |
| PF04909 | Amidohydro_2 | 1.62 |
| PF13442 | Cytochrome_CBB3 | 1.08 |
| PF00800 | PDT | 1.08 |
| PF07517 | SecA_DEAD | 0.54 |
| PF13798 | PCYCGC | 0.54 |
| PF01098 | FTSW_RODA_SPOVE | 0.54 |
| PF04073 | tRNA_edit | 0.54 |
| PF07690 | MFS_1 | 0.54 |
| PF13505 | OMP_b-brl | 0.54 |
| PF05649 | Peptidase_M13_N | 0.54 |
| PF02518 | HATPase_c | 0.54 |
| PF07589 | PEP-CTERM | 0.54 |
| PF00221 | Lyase_aromatic | 0.54 |
| PF07238 | PilZ | 0.54 |
| PF13620 | CarboxypepD_reg | 0.54 |
| PF12787 | EcsC | 0.54 |
| PF00578 | AhpC-TSA | 0.54 |
| PF00175 | NAD_binding_1 | 0.54 |
| PF13426 | PAS_9 | 0.54 |
| PF05995 | CDO_I | 0.54 |
| PF02952 | Fucose_iso_C | 0.54 |
| COG ID | Name | Functional Category | % Frequency in 185 Family Scaffolds |
|---|---|---|---|
| COG3590 | Predicted metalloendopeptidase | Posttranslational modification, protein turnover, chaperones [O] | 2.70 |
| COG0077 | Prephenate dehydratase | Amino acid transport and metabolism [E] | 1.08 |
| COG0653 | Preprotein translocase subunit SecA (ATPase, RNA helicase) | Intracellular trafficking, secretion, and vesicular transport [U] | 0.54 |
| COG0772 | Peptodoglycan polymerase FtsW/RodA/SpoVE | Cell cycle control, cell division, chromosome partitioning [D] | 0.54 |
| COG2407 | L-fucose isomerase or related protein | Carbohydrate transport and metabolism [G] | 0.54 |
| COG2986 | Histidine ammonia-lyase | Amino acid transport and metabolism [E] | 0.54 |
| COG5553 | Predicted metal-dependent enzyme of the double-stranded beta helix superfamily | General function prediction only [R] | 0.54 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 98.38 % |
| Unclassified | root | N/A | 1.62 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2199352024|deeps_contig77558.46597 | All Organisms → cellular organisms → Bacteria | 512 | Open in IMG/M |
| 3300000364|INPhiseqgaiiFebDRAFT_105349196 | All Organisms → cellular organisms → Bacteria | 1148 | Open in IMG/M |
| 3300000789|JGI1027J11758_12073691 | All Organisms → cellular organisms → Bacteria | 514 | Open in IMG/M |
| 3300000955|JGI1027J12803_104396792 | All Organisms → cellular organisms → Bacteria | 814 | Open in IMG/M |
| 3300001545|JGI12630J15595_10061073 | All Organisms → cellular organisms → Bacteria | 746 | Open in IMG/M |
| 3300001867|JGI12627J18819_10244160 | All Organisms → cellular organisms → Bacteria | 723 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_100893299 | All Organisms → cellular organisms → Bacteria | 770 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_101009468 | All Organisms → cellular organisms → Bacteria | 717 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_101467557 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 577 | Open in IMG/M |
| 3300004080|Ga0062385_10735437 | All Organisms → cellular organisms → Bacteria | 639 | Open in IMG/M |
| 3300004152|Ga0062386_100197534 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1582 | Open in IMG/M |
| 3300004479|Ga0062595_102290162 | All Organisms → cellular organisms → Bacteria | 532 | Open in IMG/M |
| 3300004635|Ga0062388_101221279 | All Organisms → cellular organisms → Bacteria | 745 | Open in IMG/M |
| 3300005175|Ga0066673_10074916 | All Organisms → cellular organisms → Bacteria | 1767 | Open in IMG/M |
| 3300005332|Ga0066388_106097423 | All Organisms → cellular organisms → Bacteria | 609 | Open in IMG/M |
| 3300005338|Ga0068868_100985366 | All Organisms → cellular organisms → Bacteria | 770 | Open in IMG/M |
| 3300005356|Ga0070674_101544800 | All Organisms → cellular organisms → Bacteria | 597 | Open in IMG/M |
| 3300005445|Ga0070708_101440782 | All Organisms → cellular organisms → Bacteria | 642 | Open in IMG/M |
| 3300005468|Ga0070707_102097070 | All Organisms → cellular organisms → Bacteria | 533 | Open in IMG/M |
| 3300005526|Ga0073909_10135156 | All Organisms → cellular organisms → Bacteria | 1013 | Open in IMG/M |
| 3300005526|Ga0073909_10388153 | All Organisms → cellular organisms → Bacteria | 655 | Open in IMG/M |
| 3300005538|Ga0070731_11138573 | All Organisms → cellular organisms → Bacteria | 515 | Open in IMG/M |
| 3300005576|Ga0066708_10073530 | All Organisms → cellular organisms → Bacteria | 1974 | Open in IMG/M |
| 3300005921|Ga0070766_10490233 | All Organisms → cellular organisms → Bacteria | 815 | Open in IMG/M |
| 3300006052|Ga0075029_101240388 | All Organisms → cellular organisms → Bacteria | 522 | Open in IMG/M |
| 3300006086|Ga0075019_10660467 | All Organisms → cellular organisms → Bacteria | 659 | Open in IMG/M |
| 3300006755|Ga0079222_10236938 | All Organisms → cellular organisms → Bacteria | 1134 | Open in IMG/M |
| 3300006755|Ga0079222_10913738 | All Organisms → cellular organisms → Bacteria | 739 | Open in IMG/M |
| 3300006800|Ga0066660_10254794 | All Organisms → cellular organisms → Bacteria | 1375 | Open in IMG/M |
| 3300006804|Ga0079221_11523579 | All Organisms → cellular organisms → Bacteria | 538 | Open in IMG/M |
| 3300006871|Ga0075434_101374916 | All Organisms → cellular organisms → Bacteria | 716 | Open in IMG/M |
| 3300006893|Ga0073928_10399680 | All Organisms → cellular organisms → Bacteria | 1005 | Open in IMG/M |
| 3300006893|Ga0073928_10547524 | All Organisms → cellular organisms → Bacteria | 823 | Open in IMG/M |
| 3300006914|Ga0075436_101011935 | All Organisms → cellular organisms → Bacteria | 624 | Open in IMG/M |
| 3300009038|Ga0099829_10075328 | All Organisms → cellular organisms → Bacteria | 2570 | Open in IMG/M |
| 3300009038|Ga0099829_10198236 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1623 | Open in IMG/M |
| 3300009038|Ga0099829_10252990 | All Organisms → cellular organisms → Bacteria | 1437 | Open in IMG/M |
| 3300009089|Ga0099828_10574232 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1016 | Open in IMG/M |
| 3300009089|Ga0099828_11350787 | All Organisms → cellular organisms → Bacteria | 630 | Open in IMG/M |
| 3300009089|Ga0099828_11557257 | All Organisms → cellular organisms → Bacteria | 582 | Open in IMG/M |
| 3300009137|Ga0066709_100279979 | All Organisms → cellular organisms → Bacteria | 2253 | Open in IMG/M |
| 3300009143|Ga0099792_11071650 | All Organisms → cellular organisms → Bacteria | 541 | Open in IMG/M |
| 3300009551|Ga0105238_11284627 | All Organisms → cellular organisms → Bacteria | 758 | Open in IMG/M |
| 3300010046|Ga0126384_11533893 | All Organisms → cellular organisms → Bacteria | 625 | Open in IMG/M |
| 3300010048|Ga0126373_11613939 | All Organisms → cellular organisms → Bacteria | 713 | Open in IMG/M |
| 3300010159|Ga0099796_10461765 | All Organisms → cellular organisms → Bacteria | 566 | Open in IMG/M |
| 3300010335|Ga0134063_10555392 | All Organisms → cellular organisms → Bacteria | 580 | Open in IMG/M |
| 3300010358|Ga0126370_12392522 | All Organisms → cellular organisms → Bacteria | 524 | Open in IMG/M |
| 3300010360|Ga0126372_12059733 | Not Available | 618 | Open in IMG/M |
| 3300010361|Ga0126378_10499065 | All Organisms → cellular organisms → Bacteria | 1332 | Open in IMG/M |
| 3300010366|Ga0126379_11139282 | All Organisms → cellular organisms → Bacteria | 886 | Open in IMG/M |
| 3300010366|Ga0126379_12236476 | All Organisms → cellular organisms → Bacteria | 648 | Open in IMG/M |
| 3300010366|Ga0126379_13248174 | All Organisms → cellular organisms → Bacteria | 544 | Open in IMG/M |
| 3300010376|Ga0126381_100870353 | All Organisms → cellular organisms → Bacteria | 1296 | Open in IMG/M |
| 3300010376|Ga0126381_101758513 | All Organisms → cellular organisms → Bacteria | 895 | Open in IMG/M |
| 3300010398|Ga0126383_12871765 | All Organisms → cellular organisms → Bacteria | 563 | Open in IMG/M |
| 3300012096|Ga0137389_10797819 | All Organisms → cellular organisms → Bacteria | 811 | Open in IMG/M |
| 3300012096|Ga0137389_11355629 | All Organisms → cellular organisms → Bacteria | 606 | Open in IMG/M |
| 3300012169|Ga0153990_1084104 | All Organisms → cellular organisms → Bacteria | 715 | Open in IMG/M |
| 3300012189|Ga0137388_10167726 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 1958 | Open in IMG/M |
| 3300012201|Ga0137365_10555404 | All Organisms → cellular organisms → Bacteria | 843 | Open in IMG/M |
| 3300012203|Ga0137399_10423199 | All Organisms → cellular organisms → Bacteria | 1112 | Open in IMG/M |
| 3300012203|Ga0137399_10889345 | All Organisms → cellular organisms → Bacteria | 750 | Open in IMG/M |
| 3300012203|Ga0137399_11807315 | All Organisms → cellular organisms → Bacteria | 500 | Open in IMG/M |
| 3300012206|Ga0137380_10411327 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1200 | Open in IMG/M |
| 3300012208|Ga0137376_10355717 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1271 | Open in IMG/M |
| 3300012285|Ga0137370_10159534 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1308 | Open in IMG/M |
| 3300012357|Ga0137384_10907200 | All Organisms → cellular organisms → Bacteria | 710 | Open in IMG/M |
| 3300012582|Ga0137358_10301220 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Cellvibrionales → Halieaceae → unclassified Halieaceae → gamma proteobacterium HIMB55 | 1088 | Open in IMG/M |
| 3300012683|Ga0137398_10009009 | All Organisms → cellular organisms → Bacteria | 4944 | Open in IMG/M |
| 3300012683|Ga0137398_10933205 | All Organisms → cellular organisms → Bacteria | 604 | Open in IMG/M |
| 3300012917|Ga0137395_10822465 | All Organisms → cellular organisms → Bacteria | 673 | Open in IMG/M |
| 3300012918|Ga0137396_10910018 | All Organisms → cellular organisms → Bacteria | 644 | Open in IMG/M |
| 3300012925|Ga0137419_10012502 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 4665 | Open in IMG/M |
| 3300012930|Ga0137407_11007552 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 789 | Open in IMG/M |
| 3300012957|Ga0164303_11296723 | All Organisms → cellular organisms → Bacteria | 539 | Open in IMG/M |
| 3300012958|Ga0164299_11682836 | All Organisms → cellular organisms → Bacteria | 503 | Open in IMG/M |
| 3300012971|Ga0126369_12090604 | All Organisms → cellular organisms → Bacteria | 654 | Open in IMG/M |
| 3300012972|Ga0134077_10084630 | All Organisms → cellular organisms → Bacteria | 1211 | Open in IMG/M |
| 3300012975|Ga0134110_10001206 | All Organisms → cellular organisms → Bacteria | 9245 | Open in IMG/M |
| 3300012977|Ga0134087_10025595 | All Organisms → cellular organisms → Bacteria | 2194 | Open in IMG/M |
| 3300012977|Ga0134087_10239960 | All Organisms → cellular organisms → Bacteria | 827 | Open in IMG/M |
| 3300012984|Ga0164309_11204676 | All Organisms → cellular organisms → Bacteria | 635 | Open in IMG/M |
| 3300013308|Ga0157375_10180732 | All Organisms → cellular organisms → Bacteria | 2261 | Open in IMG/M |
| 3300015051|Ga0137414_1193481 | All Organisms → cellular organisms → Bacteria | 991 | Open in IMG/M |
| 3300015054|Ga0137420_1486852 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1376 | Open in IMG/M |
| 3300015241|Ga0137418_10504624 | All Organisms → cellular organisms → Bacteria | 967 | Open in IMG/M |
| 3300016270|Ga0182036_11936676 | All Organisms → cellular organisms → Bacteria | 500 | Open in IMG/M |
| 3300017933|Ga0187801_10083928 | All Organisms → cellular organisms → Bacteria | 1194 | Open in IMG/M |
| 3300017959|Ga0187779_11304234 | All Organisms → cellular organisms → Bacteria | 514 | Open in IMG/M |
| 3300017966|Ga0187776_10674436 | All Organisms → cellular organisms → Bacteria | 729 | Open in IMG/M |
| 3300018006|Ga0187804_10011027 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3102 | Open in IMG/M |
| 3300018006|Ga0187804_10286655 | All Organisms → cellular organisms → Bacteria | 716 | Open in IMG/M |
| 3300018034|Ga0187863_10879427 | All Organisms → cellular organisms → Bacteria | 509 | Open in IMG/M |
| 3300018482|Ga0066669_10560067 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 997 | Open in IMG/M |
| 3300020021|Ga0193726_1215183 | All Organisms → cellular organisms → Bacteria | 800 | Open in IMG/M |
| 3300020199|Ga0179592_10248191 | All Organisms → cellular organisms → Bacteria | 799 | Open in IMG/M |
| 3300020579|Ga0210407_10458915 | All Organisms → cellular organisms → Bacteria | 996 | Open in IMG/M |
| 3300020580|Ga0210403_10005468 | All Organisms → cellular organisms → Bacteria | 10773 | Open in IMG/M |
| 3300020581|Ga0210399_10360351 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1214 | Open in IMG/M |
| 3300021046|Ga0215015_10257849 | All Organisms → cellular organisms → Bacteria | 858 | Open in IMG/M |
| 3300021180|Ga0210396_10551770 | All Organisms → cellular organisms → Bacteria | 1005 | Open in IMG/M |
| 3300021405|Ga0210387_10446052 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1149 | Open in IMG/M |
| 3300021407|Ga0210383_11506381 | All Organisms → cellular organisms → Bacteria | 556 | Open in IMG/M |
| 3300021420|Ga0210394_11111467 | All Organisms → cellular organisms → Bacteria | 681 | Open in IMG/M |
| 3300021475|Ga0210392_10581273 | All Organisms → cellular organisms → Bacteria | 830 | Open in IMG/M |
| 3300021476|Ga0187846_10376022 | All Organisms → cellular organisms → Bacteria | 585 | Open in IMG/M |
| 3300021477|Ga0210398_11570992 | All Organisms → cellular organisms → Bacteria | 510 | Open in IMG/M |
| 3300021478|Ga0210402_10121481 | All Organisms → cellular organisms → Bacteria | 2361 | Open in IMG/M |
| 3300021478|Ga0210402_11038553 | All Organisms → cellular organisms → Bacteria | 746 | Open in IMG/M |
| 3300021478|Ga0210402_11793272 | All Organisms → cellular organisms → Bacteria | 540 | Open in IMG/M |
| 3300021479|Ga0210410_10088727 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Hymenobacteraceae | 2723 | Open in IMG/M |
| 3300021479|Ga0210410_10603208 | All Organisms → cellular organisms → Bacteria | 975 | Open in IMG/M |
| 3300021479|Ga0210410_11422150 | All Organisms → cellular organisms → Bacteria | 586 | Open in IMG/M |
| 3300022533|Ga0242662_10261021 | All Organisms → cellular organisms → Bacteria | 566 | Open in IMG/M |
| 3300022714|Ga0242671_1067336 | All Organisms → cellular organisms → Bacteria | 627 | Open in IMG/M |
| 3300024225|Ga0224572_1060691 | All Organisms → cellular organisms → Bacteria | 700 | Open in IMG/M |
| 3300024286|Ga0247687_1002532 | All Organisms → cellular organisms → Bacteria | 2214 | Open in IMG/M |
| 3300024288|Ga0179589_10287208 | All Organisms → cellular organisms → Bacteria | 737 | Open in IMG/M |
| 3300025625|Ga0208219_1097768 | All Organisms → cellular organisms → Bacteria | 670 | Open in IMG/M |
| 3300025898|Ga0207692_10359581 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 899 | Open in IMG/M |
| 3300025910|Ga0207684_10106672 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2396 | Open in IMG/M |
| 3300025914|Ga0207671_11127740 | All Organisms → cellular organisms → Bacteria | 615 | Open in IMG/M |
| 3300025916|Ga0207663_10106341 | All Organisms → cellular organisms → Bacteria | 1896 | Open in IMG/M |
| 3300025916|Ga0207663_11061557 | All Organisms → cellular organisms → Bacteria | 651 | Open in IMG/M |
| 3300025938|Ga0207704_11588471 | All Organisms → cellular organisms → Bacteria | 562 | Open in IMG/M |
| 3300025986|Ga0207658_10466765 | All Organisms → cellular organisms → Bacteria | 1120 | Open in IMG/M |
| 3300026301|Ga0209238_1026460 | All Organisms → cellular organisms → Bacteria | 2176 | Open in IMG/M |
| 3300026316|Ga0209155_1074071 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1282 | Open in IMG/M |
| 3300026320|Ga0209131_1213964 | All Organisms → cellular organisms → Bacteria | 865 | Open in IMG/M |
| 3300026335|Ga0209804_1216689 | All Organisms → cellular organisms → Bacteria | 772 | Open in IMG/M |
| 3300026342|Ga0209057_1059855 | All Organisms → cellular organisms → Bacteria | 1729 | Open in IMG/M |
| 3300026354|Ga0257180_1059668 | All Organisms → cellular organisms → Bacteria | 549 | Open in IMG/M |
| 3300026490|Ga0257153_1108468 | All Organisms → cellular organisms → Bacteria | 548 | Open in IMG/M |
| 3300026523|Ga0209808_1103846 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1195 | Open in IMG/M |
| 3300026548|Ga0209161_10043194 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3005 | Open in IMG/M |
| 3300027063|Ga0207762_1012208 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 1515 | Open in IMG/M |
| 3300027635|Ga0209625_1004227 | All Organisms → cellular organisms → Bacteria | 3111 | Open in IMG/M |
| 3300027645|Ga0209117_1100354 | All Organisms → cellular organisms → Bacteria | 792 | Open in IMG/M |
| 3300027680|Ga0207826_1070836 | All Organisms → cellular organisms → Bacteria | 961 | Open in IMG/M |
| 3300027681|Ga0208991_1060612 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1142 | Open in IMG/M |
| 3300027681|Ga0208991_1148713 | All Organisms → cellular organisms → Bacteria | 692 | Open in IMG/M |
| 3300027729|Ga0209248_10155915 | All Organisms → cellular organisms → Bacteria | 680 | Open in IMG/M |
| 3300027768|Ga0209772_10273802 | All Organisms → cellular organisms → Bacteria | 535 | Open in IMG/M |
| 3300027783|Ga0209448_10145533 | All Organisms → cellular organisms → Bacteria | 792 | Open in IMG/M |
| 3300027842|Ga0209580_10256316 | All Organisms → cellular organisms → Bacteria | 870 | Open in IMG/M |
| 3300027846|Ga0209180_10018479 | All Organisms → cellular organisms → Bacteria | 3673 | Open in IMG/M |
| 3300027853|Ga0209274_10409943 | All Organisms → cellular organisms → Bacteria | 700 | Open in IMG/M |
| 3300027855|Ga0209693_10018017 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3378 | Open in IMG/M |
| 3300027889|Ga0209380_10833869 | All Organisms → cellular organisms → Bacteria | 521 | Open in IMG/M |
| 3300027894|Ga0209068_10455581 | All Organisms → cellular organisms → Bacteria | 734 | Open in IMG/M |
| 3300028047|Ga0209526_10475672 | All Organisms → cellular organisms → Bacteria | 818 | Open in IMG/M |
| 3300028381|Ga0268264_10134232 | All Organisms → cellular organisms → Bacteria | 2198 | Open in IMG/M |
| 3300028536|Ga0137415_10880880 | All Organisms → cellular organisms → Bacteria | 705 | Open in IMG/M |
| 3300028746|Ga0302233_10144959 | All Organisms → cellular organisms → Bacteria | 920 | Open in IMG/M |
| 3300028808|Ga0302228_10330644 | All Organisms → cellular organisms → Bacteria | 680 | Open in IMG/M |
| 3300030906|Ga0302314_11756196 | All Organisms → cellular organisms → Bacteria | 545 | Open in IMG/M |
| 3300030991|Ga0073994_11956060 | All Organisms → cellular organisms → Bacteria | 607 | Open in IMG/M |
| 3300031446|Ga0170820_13768632 | All Organisms → cellular organisms → Bacteria | 651 | Open in IMG/M |
| 3300031564|Ga0318573_10583608 | All Organisms → cellular organisms → Bacteria | 602 | Open in IMG/M |
| 3300031708|Ga0310686_112578684 | All Organisms → cellular organisms → Bacteria | 709 | Open in IMG/M |
| 3300031718|Ga0307474_10249583 | All Organisms → cellular organisms → Bacteria | 1359 | Open in IMG/M |
| 3300031719|Ga0306917_10286809 | All Organisms → cellular organisms → Bacteria | 1269 | Open in IMG/M |
| 3300031736|Ga0318501_10391152 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 750 | Open in IMG/M |
| 3300031736|Ga0318501_10789172 | All Organisms → cellular organisms → Bacteria | 525 | Open in IMG/M |
| 3300031753|Ga0307477_10043481 | All Organisms → cellular organisms → Bacteria | 3085 | Open in IMG/M |
| 3300031754|Ga0307475_11229085 | All Organisms → cellular organisms → Bacteria | 582 | Open in IMG/M |
| 3300031942|Ga0310916_10326957 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1301 | Open in IMG/M |
| 3300031942|Ga0310916_11560357 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 537 | Open in IMG/M |
| 3300031945|Ga0310913_11220945 | All Organisms → cellular organisms → Bacteria | 523 | Open in IMG/M |
| 3300031954|Ga0306926_10940328 | All Organisms → cellular organisms → Bacteria | 1032 | Open in IMG/M |
| 3300031996|Ga0308176_10343105 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1471 | Open in IMG/M |
| 3300032042|Ga0318545_10229962 | All Organisms → cellular organisms → Bacteria | 665 | Open in IMG/M |
| 3300032076|Ga0306924_10175189 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2460 | Open in IMG/M |
| 3300032076|Ga0306924_11274304 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 791 | Open in IMG/M |
| 3300032174|Ga0307470_11041677 | All Organisms → cellular organisms → Bacteria | 654 | Open in IMG/M |
| 3300032180|Ga0307471_101054391 | All Organisms → cellular organisms → Bacteria | 979 | Open in IMG/M |
| 3300032180|Ga0307471_101299084 | All Organisms → cellular organisms → Bacteria | 890 | Open in IMG/M |
| 3300032180|Ga0307471_101939978 | All Organisms → cellular organisms → Bacteria | 737 | Open in IMG/M |
| 3300032892|Ga0335081_11047626 | All Organisms → cellular organisms → Bacteria | 945 | Open in IMG/M |
| 3300033158|Ga0335077_10773625 | All Organisms → cellular organisms → Bacteria | 980 | Open in IMG/M |
| 3300033405|Ga0326727_11068369 | Not Available | 579 | Open in IMG/M |
| 3300033829|Ga0334854_073002 | All Organisms → cellular organisms → Bacteria | 818 | Open in IMG/M |
| 3300034819|Ga0373958_0219528 | All Organisms → cellular organisms → Bacteria | 505 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 17.84% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 15.14% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 6.49% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 5.41% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 4.86% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 3.78% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 3.24% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.24% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.24% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 2.70% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.70% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 2.16% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 2.16% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 2.16% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 1.62% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 1.62% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.62% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.62% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 1.62% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 1.08% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.08% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.08% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 1.08% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 1.08% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 1.08% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.08% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.08% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 0.54% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.54% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.54% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 0.54% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.54% |
| Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 0.54% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.54% |
| Biofilm | Environmental → Terrestrial → Cave → Unclassified → Unclassified → Biofilm | 0.54% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.54% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.54% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.54% |
| Rhizosphere Soil | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere Soil | 0.54% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.54% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.54% |
| Attine Ant Fungus Gardens | Host-Associated → Fungi → Mycelium → Unclassified → Unclassified → Attine Ant Fungus Gardens | 0.54% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2199352024 | Bare-fallow DEEP SOIL | Environmental | Open in IMG/M |
| 3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000789 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300001545 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 | Environmental | Open in IMG/M |
| 3300001867 | Texas A ecozone_OM1H0_M2 (Combined assembly for Texas A ecozone Site metagenome samples, ASSEMBLY_DATE=20130705) | Environmental | Open in IMG/M |
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300004080 | Coassembly of ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
| 3300004152 | Coassembly of ECP12_OM1, ECP12_OM2, ECP12_OM3 | Environmental | Open in IMG/M |
| 3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
| 3300004635 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
| 3300005175 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Host-Associated | Open in IMG/M |
| 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
| 3300005526 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 | Environmental | Open in IMG/M |
| 3300005538 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 | Environmental | Open in IMG/M |
| 3300005576 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 | Environmental | Open in IMG/M |
| 3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
| 3300006052 | Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013 | Environmental | Open in IMG/M |
| 3300006086 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 | Environmental | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
| 3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300006893 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG | Environmental | Open in IMG/M |
| 3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
| 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Host-Associated | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Environmental | Open in IMG/M |
| 3300010335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09082015 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012169 | Attine ant fungus gardens microbial communities from North Carolina, USA - TSNC074 MetaG | Host-Associated | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012285 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
| 3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
| 3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
| 3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
| 3300012958 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MG | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300012972 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300012975 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_11112015 | Environmental | Open in IMG/M |
| 3300012977 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300012984 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MG | Environmental | Open in IMG/M |
| 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
| 3300015051 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015054 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015241 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
| 3300017933 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_1 | Environmental | Open in IMG/M |
| 3300017959 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MG | Environmental | Open in IMG/M |
| 3300017966 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MG | Environmental | Open in IMG/M |
| 3300018006 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_4 | Environmental | Open in IMG/M |
| 3300018034 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_10 | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300020021 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2c1 | Environmental | Open in IMG/M |
| 3300020199 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300021046 | Soil microbial communities from Shale Hills CZO, Pennsylvania, United States - 90cm depth | Environmental | Open in IMG/M |
| 3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
| 3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
| 3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021475 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-O | Environmental | Open in IMG/M |
| 3300021476 | Biofilm microbial communities from the roof of an iron ore cave, State of Minas Gerais, Brazil - TC_06 Biofilm (v2) | Environmental | Open in IMG/M |
| 3300021477 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
| 3300022533 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-7-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022714 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300024225 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic ? CZU5 | Host-Associated | Open in IMG/M |
| 3300024286 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK28 | Environmental | Open in IMG/M |
| 3300024288 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300025625 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 53-2 shallow-072012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026301 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026316 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 (SPAdes) | Environmental | Open in IMG/M |
| 3300026320 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 (SPAdes) | Environmental | Open in IMG/M |
| 3300026342 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 (SPAdes) | Environmental | Open in IMG/M |
| 3300026354 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NR-04-B | Environmental | Open in IMG/M |
| 3300026490 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-10-A | Environmental | Open in IMG/M |
| 3300026523 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 (SPAdes) | Environmental | Open in IMG/M |
| 3300026548 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 (SPAdes) | Environmental | Open in IMG/M |
| 3300027063 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 37 (SPAdes) | Environmental | Open in IMG/M |
| 3300027635 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027645 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027680 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 80 (SPAdes) | Environmental | Open in IMG/M |
| 3300027681 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM3_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027729 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027768 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027783 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027842 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027853 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027855 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027889 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes) | Environmental | Open in IMG/M |
| 3300027894 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300028047 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300028746 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N3_1 | Environmental | Open in IMG/M |
| 3300028808 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N1_2 | Environmental | Open in IMG/M |
| 3300030906 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N2_3 | Environmental | Open in IMG/M |
| 3300030991 | Metatranscriptome of forest soil microbial communities from Montana, USA - Site 5 -Soil GP-1A (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031446 | Fir Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031474 | Fir Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031564 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21 | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
| 3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
| 3300031736 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f21 | Environmental | Open in IMG/M |
| 3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
| 3300031945 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082 | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300031996 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R2 | Environmental | Open in IMG/M |
| 3300032042 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f26 | Environmental | Open in IMG/M |
| 3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
| 3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
| 3300033405 | Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB29MY | Environmental | Open in IMG/M |
| 3300033829 | Peat soil microbial communities from Stordalen Mire, Sweden - 715 P2 1-5 | Environmental | Open in IMG/M |
| 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Host-Associated | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| deeps_00564000 | 2199352024 | Soil | TAVAQALAELVAENAITEAKALELARMYLHDNAAQLYGDKK |
| INPhiseqgaiiFebDRAFT_1053491961 | 3300000364 | Soil | LAELVEEGAITEPKALEMARNYLHDTAARLYGDMK* |
| JGI1027J11758_120736911 | 3300000789 | Soil | LAGALAELVSERAITEDKALALAHLYLHDNAAKLYGGAK* |
| JGI1027J12803_1043967922 | 3300000955 | Soil | TALAGALAELVSERAITEDKALALAHLYLHDNAAKLYGGAK* |
| JGI12630J15595_100610731 | 3300001545 | Forest Soil | AVRSARTAVAEALAELVAENAITESKALELAHMYLHGNAAKIYGDKK* |
| JGI12627J18819_102441603 | 3300001867 | Forest Soil | ALAELVSEGAFTESKAMELAHMYLHDNAAKLYGGSK* |
| JGIcombinedJ26739_1008932993 | 3300002245 | Forest Soil | TRSARTALAAALAELVSEGACSEDKALELAHMYLHDNAAKLYGGTK* |
| JGIcombinedJ26739_1010094681 | 3300002245 | Forest Soil | VRSARTAVAEALAELVAENAISESKALGLAHMYLHDNAAKIYGDKK* |
| JGIcombinedJ26739_1014675571 | 3300002245 | Forest Soil | RTAVAAALSELVAEGAFTEEKALELARMYLHDNAAHLYGGTK* |
| Ga0062385_107354372 | 3300004080 | Bog Forest Soil | AIAAALAELVSEGAFNEEKALELARMYLHDNAAKLYGAKP* |
| Ga0062386_1001975341 | 3300004152 | Bog Forest Soil | RSARTAVAAALAELVSEGAFTEEKALQLAHMYLHDNAAKLYGGKP* |
| Ga0062595_1022901621 | 3300004479 | Soil | AALAELVGERAITQNKALELARLYLHDNAAKLYSSGNAGGTK* |
| Ga0062388_1012212791 | 3300004635 | Bog Forest Soil | GLAAALAELVDEGAITESKALELARNYLHDNAARLYGDLKK* |
| Ga0066673_100749161 | 3300005175 | Soil | AARSARTAVAAALAELVAEGAFTEEKALELARLYLHDNAAKLYGDMK* |
| Ga0066388_1060974232 | 3300005332 | Tropical Forest Soil | TRTGLAAALAELVEEGALSEAKALELARNYLHDNAAHLYGEKKP* |
| Ga0068868_1009853661 | 3300005338 | Miscanthus Rhizosphere | AIAAALAELVSEGAFGETRAVELARMYLHDNAAKLYGASQ* |
| Ga0070674_1015448002 | 3300005356 | Miscanthus Rhizosphere | FWLAAHTTRTALAAALAELVGERAITQNKALELARLYLHDNAAKLYSSGNAGGTK* |
| Ga0070708_1014407822 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | ALAAALAELVEEGAITEPKALEMARNYLHDTAARLYGDMK* |
| Ga0070707_1020970702 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | TRSSLSAALAELVAEGAISEDKAMELARLYLHDTAAKLYGDKK* |
| Ga0073909_101351563 | 3300005526 | Surface Soil | AAALAELVGERAITQDKALELARLYLHDNAAKLYSSGNAGGTK* |
| Ga0073909_103881531 | 3300005526 | Surface Soil | TTRTALAGALAELVSEHAVSEDKALELARLYLHDNAAKLYGGAK* |
| Ga0070731_111385732 | 3300005538 | Surface Soil | ARTAIAAALAELVSEGAFSEEKALELAHMYLHDNAAKLYGGKP* |
| Ga0066708_100735301 | 3300005576 | Soil | ARSARTAVAAALAELIAEGAFTEARALELARMYLHDNAAKLYGDGQ* |
| Ga0070766_104902333 | 3300005921 | Soil | SRTAVAAALAELVSEGAFNEQKALELAHLYLHDNAAKLYGGTK* |
| Ga0075029_1012403881 | 3300006052 | Watersheds | AELVEEGAFSEAKALELARNYLHDNAARLYGDMKR* |
| Ga0075019_106604671 | 3300006086 | Watersheds | LAAALAELVDEGAFSETKALELARNYLHDNAARLYGEKKP* |
| Ga0079222_102369383 | 3300006755 | Agricultural Soil | AARSARTAVAAALAELVAEGAFNEEKALELARMYLHDNAAHLYGETK* |
| Ga0079222_109137381 | 3300006755 | Agricultural Soil | AELVAEGAFTEIRALELARMYLHDNAAKLYGDRK* |
| Ga0066660_102547944 | 3300006800 | Soil | AAESARTALGAALAELVAEGAFGEAKALELARMYLHDNAAKLYGDQK* |
| Ga0079221_115235791 | 3300006804 | Agricultural Soil | LAELVAEGAFSEEKALELARMYLHDNAAHLYGETK* |
| Ga0075434_1013749163 | 3300006871 | Populus Rhizosphere | WLAARTSRTALAAALAELVEEGAITEPKALEMARNYLHDTAARLYGDMK* |
| Ga0073928_103996801 | 3300006893 | Iron-Sulfur Acid Spring | SSRTAVAAALAELVSEGAFNEQKALELAHMYLHDNAAKLYGGTK* |
| Ga0073928_105475243 | 3300006893 | Iron-Sulfur Acid Spring | VAEALAELVAENAFSETKALELAHMYLHDNAAKIYGDKK* |
| Ga0075436_1010119351 | 3300006914 | Populus Rhizosphere | ALARALAELVGERAIKRDKALELARLYLHDNAAKLYGSSTGGAK* |
| Ga0099829_100753281 | 3300009038 | Vadose Zone Soil | SARTAVAAALAELVAEGAFTEEKALELARLYLHDNAAKLYGEKK* |
| Ga0099829_101982364 | 3300009038 | Vadose Zone Soil | AAALAELVAEGAFSEEKALELARLYLHDNAAKLYGEKK* |
| Ga0099829_102529901 | 3300009038 | Vadose Zone Soil | ARTAVAEALAELVAEGALSEVKALELARLYLHDNAAKLYGGNS* |
| Ga0099828_105742323 | 3300009089 | Vadose Zone Soil | ARTAVAAALAELVAEGAFNEEKALELARLYLHDNAAKLYGEKK* |
| Ga0099828_113507871 | 3300009089 | Vadose Zone Soil | AAALAELVAEGAFTEAKALELARMYLHDNAAKLYGEMK* |
| Ga0099828_115572571 | 3300009089 | Vadose Zone Soil | RTSRTGLAAALAELVEEGAISEAKALELAKNYLHDNAARLYGDLKS* |
| Ga0066709_1002799791 | 3300009137 | Grasslands Soil | AAHTTRTALAAALAELVSERAITQDKAFELARLYLHDNAAKLYGSSMGGAK* |
| Ga0099792_110716501 | 3300009143 | Vadose Zone Soil | RTAVAAALAELVAEGAFTEEKALELARMYLHDNAAHLYGEMK* |
| Ga0105238_112846272 | 3300009551 | Corn Rhizosphere | TALAAALAELVSEGAFTEPKAMELAHMYLHDNAAKLYGGTK* |
| Ga0126384_115338932 | 3300010046 | Tropical Forest Soil | ARTTRSALSAALAELVAEGAISEDKALELARLYLHDTAAKLYGEKK* |
| Ga0126373_116139391 | 3300010048 | Tropical Forest Soil | ARTTRTGVAAALAELVEEGALSEAKAMELARNYLHDNAARLYGDKKP* |
| Ga0099796_104617651 | 3300010159 | Vadose Zone Soil | AVAAALAELVAEGAFTEEKALELARLYLHDNAARLYGEMK* |
| Ga0134063_105553921 | 3300010335 | Grasslands Soil | ARSARTAVAAALAELVAEGAFSEEKAVELARLDLHDNAVKLYGEKT* |
| Ga0126370_123925221 | 3300010358 | Tropical Forest Soil | LAELVEEGAFNETKALELARNYLHDNAARLYGEKKP* |
| Ga0126372_120597331 | 3300010360 | Tropical Forest Soil | TTRNALAAALAELVGERAISEEMALELARLYLRDNARKLYGSASTGGAK* |
| Ga0126378_104990651 | 3300010361 | Tropical Forest Soil | AELVEEGAVSEPKALELARNYLHDNAARLYGEQK* |
| Ga0126379_111392823 | 3300010366 | Tropical Forest Soil | ARSARTAIAAALAELVSEGAFSEQSALELARLYLHDNAARLYGEMK* |
| Ga0126379_122364761 | 3300010366 | Tropical Forest Soil | RTTRSALSAALAELVAEGAISEDKALELARLYLHDTAAKLYGDKK* |
| Ga0126379_132481741 | 3300010366 | Tropical Forest Soil | TALAAALAELVSEGAFTEPKAMELAHMYLHDNAAKLYGGSK* |
| Ga0126381_1008703533 | 3300010376 | Tropical Forest Soil | RTALAAALAELVSERAVTQDKALELARLYLHDNAAKLYRSVSTGGTK* |
| Ga0126381_1017585133 | 3300010376 | Tropical Forest Soil | ELVEEGAFSEAKALELARNYLHDNAARLYGEKKP* |
| Ga0126383_128717652 | 3300010398 | Tropical Forest Soil | LAAHTSRTALAAALAELVSERAISQPKALELAHQYLHDNAGKLYGASK* |
| Ga0137389_107978192 | 3300012096 | Vadose Zone Soil | RTAVAAALAELVAEGAFTEEKALDLGRLYLHDNAAKLYGEKK* |
| Ga0137389_113556291 | 3300012096 | Vadose Zone Soil | LAVRSARTAVTAALAELVAEGAVSEEKALELARMYLHDNAAKLYGGKQ* |
| Ga0153990_10841041 | 3300012169 | Attine Ant Fungus Gardens | RTAISAALAKLVAEGAFTEEKALELARMYLHDNAARLYGEMK* |
| Ga0137388_101677264 | 3300012189 | Vadose Zone Soil | LAARTSRTGLAAALAELVEEGAISEAKALELAKNYLHDNAARLYGDLKS* |
| Ga0137365_105554043 | 3300012201 | Vadose Zone Soil | LAELVSERAISEDKALELARLYLHDNAAKLYGGAK* |
| Ga0137399_104231991 | 3300012203 | Vadose Zone Soil | AHTSRTALAGALAELVSERAISEDKALELAHLYLHDNAAKLYGGTK* |
| Ga0137399_108893453 | 3300012203 | Vadose Zone Soil | AVAAALAELVAEGAFTEEKALELARMYLHDNAARLYGGTQ* |
| Ga0137399_118073152 | 3300012203 | Vadose Zone Soil | LAARTTRTGLAAALAELVEEGAFSETKAFELARNYLHDNAAHLYGDLKR* |
| Ga0137380_104113273 | 3300012206 | Vadose Zone Soil | VAAALAELVAEGAFSEGKALELARLYLHDNAAKLYGEKK* |
| Ga0137376_103557171 | 3300012208 | Vadose Zone Soil | AHTTRTALAGALAELVSERAITEDKAMELARLYLHDNAAKLYGGAK* |
| Ga0137370_101595343 | 3300012285 | Vadose Zone Soil | AVAAALAELVAEGAFTEEKALEMAHLYLHDNAAKLYGDMK* |
| Ga0137384_109072003 | 3300012357 | Vadose Zone Soil | AELVSEHAISEDKAMELARLYLHDNAAKLYGGAK* |
| Ga0137358_103012204 | 3300012582 | Vadose Zone Soil | ARSARTAVAAALAELVAEGAVTEEKALELARMYLHDNAAHLYGEMK* |
| Ga0137398_100090096 | 3300012683 | Vadose Zone Soil | ALAGALAELVSERAISEDKALELAHLYLHDNAAKLYGGTK* |
| Ga0137398_109332051 | 3300012683 | Vadose Zone Soil | AELVAEGAFTEEKALELARMYLHDNAARLYGEMK* |
| Ga0137395_108224651 | 3300012917 | Vadose Zone Soil | GAEETFWLAVHSARTAVAEALAELVAENAISETKALELAHMYLHDNAAKIYGDKK* |
| Ga0137396_109100181 | 3300012918 | Vadose Zone Soil | VAAALAELAAEGAFTEKKAVELARLYLHDNAAKLYGEKK* |
| Ga0137419_100125021 | 3300012925 | Vadose Zone Soil | ISAALAELVAEGAFTEEKALELARMYLHDNAAHLYGEIK* |
| Ga0137407_110075521 | 3300012930 | Vadose Zone Soil | AELVDEGAFNETKALEMARNYLHDNAVRLYGDLKR* |
| Ga0164303_112967232 | 3300012957 | Soil | AALAELVSERAITGEKALELAHLYLHDNAAKLYGGAK* |
| Ga0164299_116828361 | 3300012958 | Soil | TSIAGALAELVSEGAFSETTALELARMYLHDNAAKLYGASK* |
| Ga0126369_120906042 | 3300012971 | Tropical Forest Soil | SAALAELVAEGAISEDKAMELARLYLHDTAAKLYGDKK* |
| Ga0134077_100846303 | 3300012972 | Grasslands Soil | VAARSARTAVAAALAELVAEGAFTEEKALELARLYLHDNAAKLYGDMK* |
| Ga0134110_1000120612 | 3300012975 | Grasslands Soil | AALAELVAEGAFTEARALELARMYLHDNAAKLYGDGQ* |
| Ga0134087_100255951 | 3300012977 | Grasslands Soil | RSARTAVAAALAELVAEGAFTEEKALEMAHLYLHDNAAKLYGDMK* |
| Ga0134087_102399601 | 3300012977 | Grasslands Soil | LAELVAEGACSEEKALELARLYLHDNAARLYGEKK* |
| Ga0164309_112046761 | 3300012984 | Soil | AELVSEGAITEEKALELARLYLHDNAAKLYGDLK* |
| Ga0157375_101807324 | 3300013308 | Miscanthus Rhizosphere | LAELVSEGAFGETRAVELARMYLHDNAAKLYGASQ* |
| Ga0137414_11934811 | 3300015051 | Vadose Zone Soil | VAAALAELVAEGAFSEEKALELARLYLHDNAAKLYGEKK* |
| Ga0137420_14868522 | 3300015054 | Vadose Zone Soil | VAAALAELVAEGAFTEEKALELARLYLHDNAAKLYGEKK* |
| Ga0137418_105046243 | 3300015241 | Vadose Zone Soil | ALAELVAEGAFTEEKALELARMYLHDNAARLYGEAK* |
| Ga0182036_119366761 | 3300016270 | Soil | TSRTALAAALAELVQEGAITEPKALEMARNYLHDTAARLYGDMK |
| Ga0187801_100839283 | 3300017933 | Freshwater Sediment | LAARTTRTGLAAALAELVEEGAITESKALELARNYLHDNAARLYGDSKK |
| Ga0187779_113042341 | 3300017959 | Tropical Peatland | NALAELMAEGAVTEAKAWELARNNLRDNAARLYGEKK |
| Ga0187776_106744362 | 3300017966 | Tropical Peatland | VAAALAELVSEGAFDEAKALQVARIYLHDNAAKLYGEMK |
| Ga0187804_100110271 | 3300018006 | Freshwater Sediment | TGLAAALAELVEEGAITESKALELARNYLHDNAARLYGDLKK |
| Ga0187804_102866553 | 3300018006 | Freshwater Sediment | ALAELVEEGAISEAKAMELARGYLHDNAAHLYGDLKK |
| Ga0187863_108794272 | 3300018034 | Peatland | GALAELVEEGAISETKALVLARNYLHDNAARLYGDLKP |
| Ga0066669_105600673 | 3300018482 | Grasslands Soil | AALAELVAEGAFTEEKALELARLYLHDNAAKLYGEKK |
| Ga0193726_12151831 | 3300020021 | Soil | LAGALAELVSERAISEDKAIELAHLYLHDNAAKLYGGTK |
| Ga0179592_102481912 | 3300020199 | Vadose Zone Soil | ACSARTAVAAALAELVAEGAFTEEKALELARLYLHDNAAKLYGEKK |
| Ga0210407_104589151 | 3300020579 | Soil | TYWLAVRSARTAVAAALAELVAEGAFSEEQALALAHFYLHDNAARLYGDMK |
| Ga0210403_1000546813 | 3300020580 | Soil | RTGLAAALAELVDEGAFSETKALELARNYLHDNAARLYGDLKR |
| Ga0210399_103603513 | 3300020581 | Soil | AAALAELVAEGAFTEEKALELAHLYLHDNAARLYGEMK |
| Ga0215015_102578492 | 3300021046 | Soil | VPCKRRSNSARTVVAAALAELVAEGAVREEKALELARMYLHDNAAKLYGGKQ |
| Ga0210396_105517703 | 3300021180 | Soil | ARSARTAIAAALAELVSEGAFSEEKALELAHMYLHDNAAKLYGAKP |
| Ga0210387_104460521 | 3300021405 | Soil | TAVAAALAELVSEGAFSEEKALELAHMYLHDNAAKLYGAKP |
| Ga0210383_115063812 | 3300021407 | Soil | TAIAAALAELVSEGAFNEEKALELARMYLHDNAAKLYGGK |
| Ga0210394_111114672 | 3300021420 | Soil | AALAELVSEGAFSEEKALELARMYLHDNAAKLYGGKP |
| Ga0210392_105812733 | 3300021475 | Soil | AAALAELVSEGAFSEEKALELAQMYLHDNAARLYGGLQ |
| Ga0187846_103760221 | 3300021476 | Biofilm | LAELVSEGAFNEAKALELARMYLHDNAAKLYGARP |
| Ga0210398_115709922 | 3300021477 | Soil | SARTAVAAALAELVSEGALSEEKALELAHMYLHDNAAKLYGAKP |
| Ga0210402_101214814 | 3300021478 | Soil | RTAVAAALAELVSEGAFSEEKALELARMYLHDNAAKLYGAKP |
| Ga0210402_110385533 | 3300021478 | Soil | SARTAVAAALAELVSEGAFSEEKALELARMYLHDNAAKLYGGKP |
| Ga0210402_117932722 | 3300021478 | Soil | AARSARTAIAAALAELVAEGAFTEDKALELARMYLHDNAAHLYGETK |
| Ga0210410_100887273 | 3300021479 | Soil | ESMGLAARTTRTGLAAALAELVDEGAISETKALELARNYLHDNAARLYGDLKP |
| Ga0210410_106032081 | 3300021479 | Soil | RTAVAAALAELVAEGAFTEEKAVELARLYLHDNAAKLYGEKK |
| Ga0210410_114221501 | 3300021479 | Soil | AAALAELVSEGAFTEEKALELARMYLHDNAARLYGGTK |
| Ga0242662_102610212 | 3300022533 | Soil | RTNRTALAAALAELVDEGAFNETKALELARNYLHDNAARLYGDLKR |
| Ga0242671_10673361 | 3300022714 | Soil | ARSARTAVAAALAELVSEDAFSEEKALELARMYLHDNAAKLYGAKP |
| Ga0224572_10606912 | 3300024225 | Rhizosphere | SARTAIAAALAELVSEGAFSEEKALELAHMYLHDNAAKLYGAKP |
| Ga0247687_10025324 | 3300024286 | Soil | RSARTATAAALAELVSEGAFNEEKALELARRYLHDNAAMLYGDKR |
| Ga0179589_102872083 | 3300024288 | Vadose Zone Soil | AALAELVDEGAFSETKALELARNYLHDNAARLYGELKR |
| Ga0208219_10977683 | 3300025625 | Arctic Peat Soil | RSARTAVAEALAELVAENAITEPKALQLARMYLHDNAANLYGAKK |
| Ga0207692_103595811 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | TAVTAALAELVAEGAFTEGKALELARMYLHDNAARLYGEMK |
| Ga0207684_101066724 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | LAELVSEHAISEDKAMELARLYLHDNAAKLYGGAK |
| Ga0207671_111277401 | 3300025914 | Corn Rhizosphere | LVSERAITQDKALELARLYLHDNAAQLYGSSSTGGAK |
| Ga0207663_101063411 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | AALAELVEEGAITEPKALEMARNYLHDTAARLYGDMK |
| Ga0207663_110615572 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | AALAELVSEGAFTEPKAMELAHMYLHDNAAKLYGGTK |
| Ga0207704_115884712 | 3300025938 | Miscanthus Rhizosphere | ALAELVSERAITQEKAVELARLYLHDNAKKLYGNTGGAK |
| Ga0207658_104667653 | 3300025986 | Switchgrass Rhizosphere | AGALAELVSERAITQEKAVELARLYLHDNAKKLYGNTGGAK |
| Ga0209238_10264601 | 3300026301 | Grasslands Soil | AARTTRSSLSAALAELVAEGAMSEDKAMELARLYLHDTAAKLYGDKK |
| Ga0209155_10740713 | 3300026316 | Soil | VTDERLVEGALAELVAEGAFTEEKALELARLYLHDNAAKLYGDMK |
| Ga0209131_12139643 | 3300026320 | Grasslands Soil | LAELVAEGAFTEEKALELARMYLHDNAARLYGEMK |
| Ga0209804_12166891 | 3300026335 | Soil | AALAELVAEGAFTEARALELARMYLHDNAARLYGDAK |
| Ga0209057_10598554 | 3300026342 | Soil | AAVAAALAELVAEGAFTEARALELARMYLHDNAAKLYGDGQ |
| Ga0257180_10596681 | 3300026354 | Soil | ALAGALAELVSERAISEDKALELAHLYLHDNAAKLYGGTK |
| Ga0257153_11084682 | 3300026490 | Soil | TRTGLAAALAELVDEGAFSETKAFELARNYLHDNAAHLYGDLKR |
| Ga0209808_11038461 | 3300026523 | Soil | AAALAELVAEGAFTEARALELARMYLHDNAAKLYGDGQ |
| Ga0209161_100431941 | 3300026548 | Soil | ALAELVAEGACSEEKALELARLYLHDNAAKLYGEKK |
| Ga0207762_10122081 | 3300027063 | Tropical Forest Soil | AAALAELVDEGAISETRALELARNYLHDNAARLYGDKK |
| Ga0209625_10042271 | 3300027635 | Forest Soil | LSELVEEGAFNETKALELARNYLHDNAARLYGGLKQ |
| Ga0209117_11003541 | 3300027645 | Forest Soil | AVRSARSALAAALAELVAEGAFTENKALDLAHMYLHDNAARLYGELK |
| Ga0207826_10708361 | 3300027680 | Tropical Forest Soil | GLAAALAELVEEGALTEPKALELARNYLHDNAARLYGDLK |
| Ga0208991_10606123 | 3300027681 | Forest Soil | AAALAELVAEGAFTEEKALELARLYLHDNAAKLYGEKK |
| Ga0208991_11487132 | 3300027681 | Forest Soil | VAAALSELVAEGAFTEEKALELARMYLHDNAARLYGGTK |
| Ga0209248_101559151 | 3300027729 | Bog Forest Soil | AARTTRTALAAALAELVDEGAITETKAMELARNYLHDNAARLYGDLKK |
| Ga0209772_102738022 | 3300027768 | Bog Forest Soil | ASRSARTAVAAALAELVSEGAFSEEKALELAHMYLHDNAAKLYGAKQ |
| Ga0209448_101455333 | 3300027783 | Bog Forest Soil | LAELVSEGAFSEEKAIELAHMYLHDNAAKLYGAKP |
| Ga0209580_102563162 | 3300027842 | Surface Soil | LAELVTEGAVSEEKALELAKMYLHDNAAKLYGDKTYGEKK |
| Ga0209180_100184797 | 3300027846 | Vadose Zone Soil | ARSAVSAALAELVSEGAFTEEKALELARMYLHDNAAKLYGGKP |
| Ga0209274_104099431 | 3300027853 | Soil | RTAVAAALAELVSEGAFNEQKALELAHLYLHDNAAKLYGGTK |
| Ga0209693_100180171 | 3300027855 | Soil | LAELVSEGAYTEPKAMELAHMYLHDNAVKLYGGLK |
| Ga0209380_108338691 | 3300027889 | Soil | RTSRTALAAALAELVDEGAINESKALELAHGYLHDNAAKLYGDLKK |
| Ga0209068_104555811 | 3300027894 | Watersheds | MWLAARTSRTGLAAALAELVDEGAISEAKALELAHGYLHDNAVKLYGDLKK |
| Ga0209526_104756723 | 3300028047 | Forest Soil | VRSARTALAAALAELVAEGAFTEDKALELAHLYLHDNAAKLYGDMK |
| Ga0268264_101342321 | 3300028381 | Switchgrass Rhizosphere | AAALAELVSEGAFGETRAVELARMYLHDNAAKLYGASQ |
| Ga0137415_108808803 | 3300028536 | Vadose Zone Soil | AAALAEFVAEGAFTEEKAVELARLYLHDNAARLYGEKK |
| Ga0302233_101449591 | 3300028746 | Palsa | ALAELVSEGAFSEEKALALAHLYLHDNAAKLYGEKK |
| Ga0302228_103306441 | 3300028808 | Palsa | AAALAEMVAEGEVTEARALELAHGYLHDNAAKLYPPLK |
| Ga0302314_117561961 | 3300030906 | Palsa | FWLAARSARTAVAAALAELVSEGAFSEAKALQLARLYLHDNAAQLYRGSK |
| Ga0073994_119560601 | 3300030991 | Soil | VGAEETFWLAVRSARTAVAEALAELVAENAITESKALELAHMYLHGNAAKIYGDKK |
| Ga0170820_137686322 | 3300031446 | Forest Soil | RTALAAALAELVSEGAFTEARALELAHMYLHDNAAKLYGGTK |
| Ga0170818_1001788213 | 3300031474 | Forest Soil | FWLAARTSRTALAAALAELVEEGAITEPKALAMARNYLHDTAARLYGDMK |
| Ga0318573_105836081 | 3300031564 | Soil | AALAELVEEGAVTEAKAFELARNYLHDNAARLYGELK |
| Ga0310686_1125786841 | 3300031708 | Soil | SFWIATYTSRTALAAALAELVSEDAFSEEKALEIAHLYLHDNAAKLYGAKK |
| Ga0307474_102495831 | 3300031718 | Hardwood Forest Soil | AIAAALAELVAEDAFTEEKALELARMYLHDNAAHLYGETK |
| Ga0306917_102868091 | 3300031719 | Soil | LAELTEEGALSEAKALELARNYLHDNAARLYGELK |
| Ga0318501_103911523 | 3300031736 | Soil | GLAAALAELVEEGAVTEPKALELARNYLHDNAVRLYGGSK |
| Ga0318501_107891721 | 3300031736 | Soil | TRTGLAAALAELVEEGAVSEPKALELARNYLHDNAARLYGEQK |
| Ga0307477_100434814 | 3300031753 | Hardwood Forest Soil | AARSARTAVAAALAELVSEGAFTEEMALELARLYLHDNAARLYGEMK |
| Ga0307475_112290852 | 3300031754 | Hardwood Forest Soil | AVAAALAELVAEGAFDEQKALELAHMYLHDNAARLYGEMK |
| Ga0310916_103269571 | 3300031942 | Soil | TSLAAALAELVGERAISTDKALELAHMYLHDNAAKLYGSLREARGEGASK |
| Ga0310916_115603571 | 3300031942 | Soil | FWMAVHSARQALAAALAELVAEKAFTREQALKIAHGYLHDNAQALYAGRLRH |
| Ga0310913_112209452 | 3300031945 | Soil | LAELVEEGAVTEAKAFELARNYLHDNAARLYGELK |
| Ga0306926_109403283 | 3300031954 | Soil | LAAALAELVEEGAVSEPKALELARNYLHDNAARLYGEQK |
| Ga0308176_103431051 | 3300031996 | Soil | SREALAAALAELVSEHAFSREQAMKVAHGYLHDNAARLYQ |
| Ga0318545_102299623 | 3300032042 | Soil | TGLAAALAELTEEGALSEAKALELARNYLHDNAARLYGELK |
| Ga0306924_101751894 | 3300032076 | Soil | TSRMSLAAALAELVGERAISTDKALELAHMYLHDNAAKLYGSLREARGEGASK |
| Ga0306924_112743043 | 3300032076 | Soil | AGLAELVEEGAVTEPKALELARNYLHDNAVRLYGGSK |
| Ga0307470_110416772 | 3300032174 | Hardwood Forest Soil | LAELVGERAISQAKALELAHLYLHDNAAKLYGGTK |
| Ga0307471_1010543913 | 3300032180 | Hardwood Forest Soil | TSRTALAGALAELVSEHAISEDKALELAHLYLHDTAAKLYGGTK |
| Ga0307471_1012990843 | 3300032180 | Hardwood Forest Soil | ARTAVGAALAELVAESAFTEEKALELARMYLHDNAARLYGEMK |
| Ga0307471_1019399781 | 3300032180 | Hardwood Forest Soil | ALAELVSEHAISEDKALELAHLYLHDTAAKLYGGTK |
| Ga0335081_110476261 | 3300032892 | Soil | ALAELVAEGAFNEDKALELAHMYLHDNAARLYGGMK |
| Ga0335077_107736251 | 3300033158 | Soil | AVHSARTALAAALAELVAEGAFNEDKALELAHMYLHDNAARLYGEMK |
| Ga0326727_110683692 | 3300033405 | Peat Soil | AAALAEFVEEGAFSEDKALELARNYLHDNAARLYGNLKIAPINKQ |
| Ga0334854_073002_703_816 | 3300033829 | Soil | AALAELVSEGAFTEDKAMEIAHLYLHDNAAKLYGEKK |
| Ga0373958_0219528_371_505 | 3300034819 | Rhizosphere Soil | TALAGALAELVSERAITQEKAVELARLYLHDNAKKLYGNTGGAK |
| ⦗Top⦘ |