| Basic Information | |
|---|---|
| Family ID | F030273 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 186 |
| Average Sequence Length | 39 residues |
| Representative Sequence | LTDDLKARILSTFLTLMNLRENLDRASMRSSFGRSGHPR |
| Number of Associated Samples | 155 |
| Number of Associated Scaffolds | 186 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 98.92 % |
| % of genes from short scaffolds (< 2000 bps) | 89.78 % |
| Associated GOLD sequencing projects | 143 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.51 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (98.925 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (20.968 % of family members) |
| Environment Ontology (ENVO) | Unclassified (24.194 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (56.989 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 46.27% β-sheet: 0.00% Coil/Unstructured: 53.73% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.51 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 186 Family Scaffolds |
|---|---|---|
| PF00899 | ThiF | 36.56 |
| PF04343 | DUF488 | 6.99 |
| PF07244 | POTRA | 5.91 |
| PF01814 | Hemerythrin | 5.38 |
| PF05237 | Obsolete Pfam Family | 4.84 |
| PF13340 | DUF4096 | 0.54 |
| PF13620 | CarboxypepD_reg | 0.54 |
| PF06325 | PrmA | 0.54 |
| PF01261 | AP_endonuc_2 | 0.54 |
| PF01710 | HTH_Tnp_IS630 | 0.54 |
| PF00266 | Aminotran_5 | 0.54 |
| PF13533 | Biotin_lipoyl_2 | 0.54 |
| PF13358 | DDE_3 | 0.54 |
| COG ID | Name | Functional Category | % Frequency in 186 Family Scaffolds |
|---|---|---|---|
| COG3189 | Uncharacterized conserved protein YeaO, DUF488 family | Function unknown [S] | 6.99 |
| COG2264 | Ribosomal protein L11 methylase PrmA | Translation, ribosomal structure and biogenesis [J] | 0.54 |
| COG2890 | Methylase of polypeptide chain release factors | Translation, ribosomal structure and biogenesis [J] | 0.54 |
| COG3415 | CRISPR-associated protein Csa3, CARF domain | Defense mechanisms [V] | 0.54 |
| COG3897 | Protein N-terminal and lysine N-methylase, NNT1/EFM7 family | Posttranslational modification, protein turnover, chaperones [O] | 0.54 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 98.92 % |
| Unclassified | root | N/A | 1.08 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300002909|JGI25388J43891_1001494 | All Organisms → cellular organisms → Bacteria | 4882 | Open in IMG/M |
| 3300002914|JGI25617J43924_10046956 | All Organisms → cellular organisms → Bacteria | 1567 | Open in IMG/M |
| 3300002914|JGI25617J43924_10286601 | All Organisms → cellular organisms → Bacteria | 564 | Open in IMG/M |
| 3300004052|Ga0055490_10163217 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 660 | Open in IMG/M |
| 3300004080|Ga0062385_11044087 | All Organisms → cellular organisms → Bacteria | 551 | Open in IMG/M |
| 3300004633|Ga0066395_10247538 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 954 | Open in IMG/M |
| 3300005332|Ga0066388_104205626 | All Organisms → cellular organisms → Bacteria | 734 | Open in IMG/M |
| 3300005332|Ga0066388_107264337 | All Organisms → cellular organisms → Bacteria | 557 | Open in IMG/M |
| 3300005538|Ga0070731_10680288 | All Organisms → cellular organisms → Bacteria | 684 | Open in IMG/M |
| 3300005540|Ga0066697_10042523 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2555 | Open in IMG/M |
| 3300005541|Ga0070733_10884860 | All Organisms → cellular organisms → Bacteria | 600 | Open in IMG/M |
| 3300005542|Ga0070732_10957285 | All Organisms → cellular organisms → Bacteria | 523 | Open in IMG/M |
| 3300005545|Ga0070695_101832729 | All Organisms → cellular organisms → Bacteria | 509 | Open in IMG/M |
| 3300005554|Ga0066661_10410927 | All Organisms → cellular organisms → Bacteria | 829 | Open in IMG/M |
| 3300005568|Ga0066703_10223534 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1145 | Open in IMG/M |
| 3300005575|Ga0066702_10439672 | All Organisms → cellular organisms → Bacteria | 799 | Open in IMG/M |
| 3300005586|Ga0066691_10005644 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 5486 | Open in IMG/M |
| 3300005602|Ga0070762_10212416 | All Organisms → cellular organisms → Bacteria | 1188 | Open in IMG/M |
| 3300005921|Ga0070766_10697596 | All Organisms → cellular organisms → Bacteria | 687 | Open in IMG/M |
| 3300006046|Ga0066652_101498832 | All Organisms → cellular organisms → Bacteria | 626 | Open in IMG/M |
| 3300006047|Ga0075024_100809298 | All Organisms → cellular organisms → Bacteria | 525 | Open in IMG/M |
| 3300006050|Ga0075028_100772953 | All Organisms → cellular organisms → Bacteria | 583 | Open in IMG/M |
| 3300006086|Ga0075019_10437405 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 804 | Open in IMG/M |
| 3300006163|Ga0070715_10230688 | All Organisms → cellular organisms → Bacteria | 957 | Open in IMG/M |
| 3300006172|Ga0075018_10017545 | All Organisms → cellular organisms → Bacteria | 2736 | Open in IMG/M |
| 3300006794|Ga0066658_10041458 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1933 | Open in IMG/M |
| 3300006797|Ga0066659_10558604 | All Organisms → cellular organisms → Bacteria | 925 | Open in IMG/M |
| 3300006800|Ga0066660_10676586 | All Organisms → cellular organisms → Bacteria | 852 | Open in IMG/M |
| 3300006806|Ga0079220_10765685 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 723 | Open in IMG/M |
| 3300006806|Ga0079220_11739407 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 547 | Open in IMG/M |
| 3300006854|Ga0075425_103120461 | All Organisms → cellular organisms → Bacteria | 505 | Open in IMG/M |
| 3300006893|Ga0073928_10022748 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 6350 | Open in IMG/M |
| 3300006954|Ga0079219_10406708 | Not Available | 905 | Open in IMG/M |
| 3300006954|Ga0079219_11258306 | All Organisms → cellular organisms → Bacteria | 647 | Open in IMG/M |
| 3300007255|Ga0099791_10286725 | All Organisms → cellular organisms → Bacteria | 784 | Open in IMG/M |
| 3300007788|Ga0099795_10521069 | All Organisms → cellular organisms → Bacteria | 557 | Open in IMG/M |
| 3300009012|Ga0066710_100451277 | All Organisms → cellular organisms → Bacteria | 1928 | Open in IMG/M |
| 3300009038|Ga0099829_10073514 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2599 | Open in IMG/M |
| 3300009038|Ga0099829_10081194 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2483 | Open in IMG/M |
| 3300009089|Ga0099828_11343808 | All Organisms → cellular organisms → Bacteria | 632 | Open in IMG/M |
| 3300009089|Ga0099828_11989915 | All Organisms → cellular organisms → Bacteria | 508 | Open in IMG/M |
| 3300009143|Ga0099792_10294642 | All Organisms → cellular organisms → Bacteria | 961 | Open in IMG/M |
| 3300009525|Ga0116220_10343010 | All Organisms → cellular organisms → Bacteria | 662 | Open in IMG/M |
| 3300009672|Ga0116215_1306211 | All Organisms → cellular organisms → Bacteria | 690 | Open in IMG/M |
| 3300009683|Ga0116224_10331674 | All Organisms → cellular organisms → Bacteria | 723 | Open in IMG/M |
| 3300010343|Ga0074044_10802707 | All Organisms → cellular organisms → Bacteria | 615 | Open in IMG/M |
| 3300010358|Ga0126370_10490572 | All Organisms → cellular organisms → Bacteria | 1035 | Open in IMG/M |
| 3300010358|Ga0126370_12419083 | All Organisms → cellular organisms → Bacteria | 522 | Open in IMG/M |
| 3300010359|Ga0126376_10218615 | All Organisms → cellular organisms → Bacteria | 1595 | Open in IMG/M |
| 3300010360|Ga0126372_11405362 | All Organisms → cellular organisms → Bacteria | 730 | Open in IMG/M |
| 3300010376|Ga0126381_102041836 | All Organisms → cellular organisms → Bacteria | 826 | Open in IMG/M |
| 3300010379|Ga0136449_100845756 | All Organisms → cellular organisms → Bacteria | 1502 | Open in IMG/M |
| 3300010379|Ga0136449_102073196 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 836 | Open in IMG/M |
| 3300011120|Ga0150983_14576375 | All Organisms → cellular organisms → Bacteria | 511 | Open in IMG/M |
| 3300011269|Ga0137392_10163856 | All Organisms → cellular organisms → Bacteria | 1802 | Open in IMG/M |
| 3300011269|Ga0137392_10165044 | All Organisms → cellular organisms → Bacteria | 1795 | Open in IMG/M |
| 3300011269|Ga0137392_11323748 | All Organisms → cellular organisms → Bacteria | 579 | Open in IMG/M |
| 3300011270|Ga0137391_10121154 | All Organisms → cellular organisms → Bacteria | 2271 | Open in IMG/M |
| 3300012038|Ga0137431_1229991 | All Organisms → cellular organisms → Bacteria | 520 | Open in IMG/M |
| 3300012096|Ga0137389_10335181 | All Organisms → cellular organisms → Bacteria | 1285 | Open in IMG/M |
| 3300012189|Ga0137388_11801972 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 544 | Open in IMG/M |
| 3300012205|Ga0137362_10323258 | All Organisms → cellular organisms → Bacteria | 1336 | Open in IMG/M |
| 3300012211|Ga0137377_10197814 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1930 | Open in IMG/M |
| 3300012362|Ga0137361_10051498 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3398 | Open in IMG/M |
| 3300012582|Ga0137358_10329656 | All Organisms → cellular organisms → Bacteria | 1035 | Open in IMG/M |
| 3300012917|Ga0137395_10869217 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 653 | Open in IMG/M |
| 3300012918|Ga0137396_10231484 | All Organisms → cellular organisms → Bacteria | 1361 | Open in IMG/M |
| 3300012925|Ga0137419_10382593 | All Organisms → cellular organisms → Bacteria | 1096 | Open in IMG/M |
| 3300012925|Ga0137419_11987078 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 500 | Open in IMG/M |
| 3300012930|Ga0137407_10544805 | All Organisms → cellular organisms → Bacteria | 1086 | Open in IMG/M |
| 3300012944|Ga0137410_10529666 | All Organisms → cellular organisms → Bacteria | 966 | Open in IMG/M |
| 3300014156|Ga0181518_10264505 | All Organisms → cellular organisms → Bacteria | 868 | Open in IMG/M |
| 3300014157|Ga0134078_10399551 | All Organisms → cellular organisms → Bacteria | 616 | Open in IMG/M |
| 3300014162|Ga0181538_10556587 | All Organisms → cellular organisms → Bacteria | 601 | Open in IMG/M |
| 3300014165|Ga0181523_10207464 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1132 | Open in IMG/M |
| 3300014201|Ga0181537_11155636 | All Organisms → cellular organisms → Bacteria | 523 | Open in IMG/M |
| 3300015241|Ga0137418_10558683 | All Organisms → cellular organisms → Bacteria | 905 | Open in IMG/M |
| 3300015241|Ga0137418_11131002 | All Organisms → cellular organisms → Bacteria | 555 | Open in IMG/M |
| 3300016294|Ga0182041_12057481 | All Organisms → cellular organisms → Bacteria | 532 | Open in IMG/M |
| 3300016371|Ga0182034_11783646 | All Organisms → cellular organisms → Bacteria | 542 | Open in IMG/M |
| 3300016445|Ga0182038_11716252 | All Organisms → cellular organisms → Bacteria | 566 | Open in IMG/M |
| 3300017943|Ga0187819_10591563 | All Organisms → cellular organisms → Bacteria | 629 | Open in IMG/M |
| 3300017944|Ga0187786_10408184 | All Organisms → cellular organisms → Bacteria | 591 | Open in IMG/M |
| 3300017946|Ga0187879_10764614 | All Organisms → cellular organisms → Bacteria | 539 | Open in IMG/M |
| 3300017970|Ga0187783_11107851 | All Organisms → cellular organisms → Bacteria | 570 | Open in IMG/M |
| 3300017973|Ga0187780_10947422 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 626 | Open in IMG/M |
| 3300017974|Ga0187777_11216951 | All Organisms → cellular organisms → Bacteria | 551 | Open in IMG/M |
| 3300018085|Ga0187772_10266378 | All Organisms → cellular organisms → Bacteria | 1167 | Open in IMG/M |
| 3300018088|Ga0187771_10730767 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 840 | Open in IMG/M |
| 3300018090|Ga0187770_11673152 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 520 | Open in IMG/M |
| 3300018431|Ga0066655_10252016 | All Organisms → cellular organisms → Bacteria | 1127 | Open in IMG/M |
| 3300020170|Ga0179594_10354769 | All Organisms → cellular organisms → Bacteria | 556 | Open in IMG/M |
| 3300020199|Ga0179592_10183080 | All Organisms → cellular organisms → Bacteria | 953 | Open in IMG/M |
| 3300020199|Ga0179592_10215866 | All Organisms → cellular organisms → Bacteria | 867 | Open in IMG/M |
| 3300020199|Ga0179592_10243196 | All Organisms → cellular organisms → Bacteria | 809 | Open in IMG/M |
| 3300020579|Ga0210407_10901723 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 678 | Open in IMG/M |
| 3300020580|Ga0210403_10096806 | All Organisms → cellular organisms → Bacteria | 2390 | Open in IMG/M |
| 3300020580|Ga0210403_10716331 | All Organisms → cellular organisms → Bacteria | 801 | Open in IMG/M |
| 3300020580|Ga0210403_10882074 | All Organisms → cellular organisms → Bacteria | 706 | Open in IMG/M |
| 3300020581|Ga0210399_10851530 | All Organisms → cellular organisms → Bacteria | 742 | Open in IMG/M |
| 3300020583|Ga0210401_10435323 | All Organisms → cellular organisms → Bacteria | 1174 | Open in IMG/M |
| 3300021046|Ga0215015_10606618 | All Organisms → cellular organisms → Bacteria | 506 | Open in IMG/M |
| 3300021168|Ga0210406_10930634 | All Organisms → cellular organisms → Bacteria | 652 | Open in IMG/M |
| 3300021178|Ga0210408_10650645 | All Organisms → cellular organisms → Bacteria | 832 | Open in IMG/M |
| 3300021181|Ga0210388_11414847 | All Organisms → cellular organisms → Bacteria | 583 | Open in IMG/M |
| 3300021405|Ga0210387_11521609 | All Organisms → cellular organisms → Bacteria | 572 | Open in IMG/M |
| 3300021406|Ga0210386_10978888 | All Organisms → cellular organisms → Bacteria | 722 | Open in IMG/M |
| 3300021420|Ga0210394_10105917 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 2433 | Open in IMG/M |
| 3300021420|Ga0210394_10182831 | All Organisms → cellular organisms → Bacteria | 1826 | Open in IMG/M |
| 3300021420|Ga0210394_10733058 | All Organisms → cellular organisms → Bacteria | 865 | Open in IMG/M |
| 3300021432|Ga0210384_11047231 | All Organisms → cellular organisms → Bacteria | 718 | Open in IMG/M |
| 3300021477|Ga0210398_10900723 | All Organisms → cellular organisms → Bacteria | 709 | Open in IMG/M |
| 3300021478|Ga0210402_10869239 | All Organisms → cellular organisms → Bacteria | 828 | Open in IMG/M |
| 3300021478|Ga0210402_11120277 | All Organisms → cellular organisms → Bacteria | 714 | Open in IMG/M |
| 3300021479|Ga0210410_11247848 | All Organisms → cellular organisms → Bacteria | 635 | Open in IMG/M |
| 3300021479|Ga0210410_11480434 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 572 | Open in IMG/M |
| 3300022557|Ga0212123_10033683 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 5168 | Open in IMG/M |
| 3300024227|Ga0228598_1039373 | All Organisms → cellular organisms → Bacteria | 933 | Open in IMG/M |
| 3300024232|Ga0247664_1180694 | All Organisms → cellular organisms → Bacteria | 500 | Open in IMG/M |
| 3300024251|Ga0247679_1025780 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 993 | Open in IMG/M |
| 3300024288|Ga0179589_10600663 | All Organisms → cellular organisms → Bacteria | 515 | Open in IMG/M |
| 3300025498|Ga0208819_1082655 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 696 | Open in IMG/M |
| 3300025906|Ga0207699_10642935 | All Organisms → cellular organisms → Bacteria | 774 | Open in IMG/M |
| 3300025971|Ga0210102_1095835 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 640 | Open in IMG/M |
| 3300026297|Ga0209237_1157920 | All Organisms → cellular organisms → Bacteria | 857 | Open in IMG/M |
| 3300026310|Ga0209239_1056985 | All Organisms → cellular organisms → Bacteria | 1742 | Open in IMG/M |
| 3300026320|Ga0209131_1069057 | All Organisms → cellular organisms → Bacteria | 1936 | Open in IMG/M |
| 3300026334|Ga0209377_1026348 | All Organisms → cellular organisms → Bacteria | 2855 | Open in IMG/M |
| 3300026515|Ga0257158_1108511 | All Organisms → cellular organisms → Bacteria | 552 | Open in IMG/M |
| 3300026532|Ga0209160_1039537 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 2859 | Open in IMG/M |
| 3300026557|Ga0179587_10397011 | All Organisms → cellular organisms → Bacteria | 898 | Open in IMG/M |
| 3300027172|Ga0208098_1015649 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → unclassified Beijerinckiaceae → Beijerinckiaceae bacterium | 727 | Open in IMG/M |
| 3300027576|Ga0209003_1112074 | Not Available | 518 | Open in IMG/M |
| 3300027587|Ga0209220_1083179 | All Organisms → cellular organisms → Bacteria | 845 | Open in IMG/M |
| 3300027619|Ga0209330_1126253 | All Organisms → cellular organisms → Bacteria | 580 | Open in IMG/M |
| 3300027645|Ga0209117_1135147 | All Organisms → cellular organisms → Bacteria | 652 | Open in IMG/M |
| 3300027648|Ga0209420_1062106 | All Organisms → cellular organisms → Bacteria | 1102 | Open in IMG/M |
| 3300027655|Ga0209388_1173930 | All Organisms → cellular organisms → Bacteria | 603 | Open in IMG/M |
| 3300027660|Ga0209736_1022384 | All Organisms → cellular organisms → Bacteria | 1928 | Open in IMG/M |
| 3300027660|Ga0209736_1132784 | All Organisms → cellular organisms → Bacteria | 666 | Open in IMG/M |
| 3300027667|Ga0209009_1021013 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1588 | Open in IMG/M |
| 3300027812|Ga0209656_10001979 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 13362 | Open in IMG/M |
| 3300027812|Ga0209656_10334122 | All Organisms → cellular organisms → Bacteria | 693 | Open in IMG/M |
| 3300027829|Ga0209773_10426664 | All Organisms → cellular organisms → Bacteria | 549 | Open in IMG/M |
| 3300027842|Ga0209580_10631549 | All Organisms → cellular organisms → Bacteria | 530 | Open in IMG/M |
| 3300027846|Ga0209180_10538213 | All Organisms → cellular organisms → Bacteria | 651 | Open in IMG/M |
| 3300027862|Ga0209701_10071707 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2192 | Open in IMG/M |
| 3300027862|Ga0209701_10173728 | All Organisms → cellular organisms → Bacteria | 1301 | Open in IMG/M |
| 3300027867|Ga0209167_10732262 | All Organisms → cellular organisms → Bacteria | 540 | Open in IMG/M |
| 3300027874|Ga0209465_10528061 | All Organisms → cellular organisms → Bacteria | 588 | Open in IMG/M |
| 3300027882|Ga0209590_10491700 | All Organisms → cellular organisms → Bacteria | 793 | Open in IMG/M |
| 3300027884|Ga0209275_10597952 | All Organisms → cellular organisms → Bacteria | 633 | Open in IMG/M |
| 3300027894|Ga0209068_10135558 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1323 | Open in IMG/M |
| 3300027903|Ga0209488_10428984 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 976 | Open in IMG/M |
| 3300027903|Ga0209488_10840566 | All Organisms → cellular organisms → Bacteria | 648 | Open in IMG/M |
| 3300027905|Ga0209415_10368254 | All Organisms → cellular organisms → Bacteria | 1184 | Open in IMG/M |
| 3300027911|Ga0209698_11322446 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 527 | Open in IMG/M |
| 3300027915|Ga0209069_10721905 | All Organisms → cellular organisms → Bacteria | 587 | Open in IMG/M |
| 3300028536|Ga0137415_10790238 | All Organisms → cellular organisms → Bacteria | 759 | Open in IMG/M |
| 3300030707|Ga0310038_10270931 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 777 | Open in IMG/M |
| 3300030991|Ga0073994_10061860 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 719 | Open in IMG/M |
| 3300031474|Ga0170818_105085240 | All Organisms → cellular organisms → Bacteria | 748 | Open in IMG/M |
| 3300031545|Ga0318541_10041993 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 2318 | Open in IMG/M |
| 3300031708|Ga0310686_112413557 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Peptococcaceae → Desulfofundulus → Desulfofundulus kuznetsovii | 1188 | Open in IMG/M |
| 3300031708|Ga0310686_118846189 | All Organisms → cellular organisms → Bacteria | 1337 | Open in IMG/M |
| 3300031708|Ga0310686_119828501 | All Organisms → cellular organisms → Bacteria | 544 | Open in IMG/M |
| 3300031719|Ga0306917_10812693 | All Organisms → cellular organisms → Bacteria | 733 | Open in IMG/M |
| 3300031719|Ga0306917_11226229 | All Organisms → cellular organisms → Bacteria | 582 | Open in IMG/M |
| 3300031753|Ga0307477_10363206 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 994 | Open in IMG/M |
| 3300031754|Ga0307475_10107558 | All Organisms → cellular organisms → Bacteria | 2184 | Open in IMG/M |
| 3300031754|Ga0307475_10359336 | All Organisms → cellular organisms → Bacteria | 1170 | Open in IMG/M |
| 3300031764|Ga0318535_10430330 | All Organisms → cellular organisms → Bacteria | 588 | Open in IMG/M |
| 3300031833|Ga0310917_10192878 | All Organisms → cellular organisms → Bacteria | 1360 | Open in IMG/M |
| 3300031880|Ga0318544_10428800 | All Organisms → cellular organisms → Bacteria | 514 | Open in IMG/M |
| 3300031896|Ga0318551_10531166 | All Organisms → cellular organisms → Bacteria | 676 | Open in IMG/M |
| 3300031910|Ga0306923_10070544 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 3897 | Open in IMG/M |
| 3300031962|Ga0307479_10686195 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1004 | Open in IMG/M |
| 3300032059|Ga0318533_10377950 | All Organisms → cellular organisms → Bacteria | 1033 | Open in IMG/M |
| 3300032059|Ga0318533_10540785 | All Organisms → cellular organisms → Bacteria | 854 | Open in IMG/M |
| 3300032076|Ga0306924_10340117 | All Organisms → cellular organisms → Bacteria | 1721 | Open in IMG/M |
| 3300032076|Ga0306924_12372210 | All Organisms → cellular organisms → Bacteria | 536 | Open in IMG/M |
| 3300032180|Ga0307471_100243467 | All Organisms → cellular organisms → Bacteria | 1844 | Open in IMG/M |
| 3300032180|Ga0307471_103945689 | All Organisms → cellular organisms → Bacteria | 524 | Open in IMG/M |
| 3300032828|Ga0335080_12343335 | All Organisms → cellular organisms → Bacteria | 510 | Open in IMG/M |
| 3300033290|Ga0318519_11082755 | All Organisms → cellular organisms → Bacteria | 500 | Open in IMG/M |
| 3300033982|Ga0371487_0276076 | All Organisms → cellular organisms → Bacteria | 766 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 20.97% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 17.20% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 5.38% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 5.91% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 4.30% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 4.30% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 3.76% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 3.76% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 3.76% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 3.23% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 2.69% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 2.69% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 2.15% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 2.15% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.15% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 2.15% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 2.15% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 1.61% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.61% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 1.08% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 1.08% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 0.54% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 0.54% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.54% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 0.54% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.54% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.54% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.54% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.54% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.54% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.54% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.54% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300002909 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_2_20cm | Environmental | Open in IMG/M |
| 3300002914 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm | Environmental | Open in IMG/M |
| 3300004052 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushOxbow_ThreeSqC_D2 | Environmental | Open in IMG/M |
| 3300004080 | Coassembly of ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
| 3300004633 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005538 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 | Environmental | Open in IMG/M |
| 3300005540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 | Environmental | Open in IMG/M |
| 3300005541 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 | Environmental | Open in IMG/M |
| 3300005542 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 | Environmental | Open in IMG/M |
| 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Environmental | Open in IMG/M |
| 3300005554 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 | Environmental | Open in IMG/M |
| 3300005568 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 | Environmental | Open in IMG/M |
| 3300005575 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 | Environmental | Open in IMG/M |
| 3300005586 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 | Environmental | Open in IMG/M |
| 3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
| 3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
| 3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
| 3300006047 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 | Environmental | Open in IMG/M |
| 3300006050 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014 | Environmental | Open in IMG/M |
| 3300006086 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 | Environmental | Open in IMG/M |
| 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Environmental | Open in IMG/M |
| 3300006172 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2014 | Environmental | Open in IMG/M |
| 3300006794 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 | Environmental | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
| 3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006893 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG | Environmental | Open in IMG/M |
| 3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
| 3300007255 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 | Environmental | Open in IMG/M |
| 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
| 3300009525 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_7_NC metaG | Environmental | Open in IMG/M |
| 3300009672 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_2_FS metaG | Environmental | Open in IMG/M |
| 3300009683 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_b_LC metaG | Environmental | Open in IMG/M |
| 3300010343 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300012038 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT800_2 | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
| 3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
| 3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300014156 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin01_60_metaG | Environmental | Open in IMG/M |
| 3300014157 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300014162 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_30_metaG | Environmental | Open in IMG/M |
| 3300014165 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_30_metaG | Environmental | Open in IMG/M |
| 3300014201 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_10_metaG | Environmental | Open in IMG/M |
| 3300015241 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
| 3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
| 3300017943 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4 | Environmental | Open in IMG/M |
| 3300017944 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_10_20_MG | Environmental | Open in IMG/M |
| 3300017946 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_10 | Environmental | Open in IMG/M |
| 3300017970 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300017973 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MG | Environmental | Open in IMG/M |
| 3300017974 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MG | Environmental | Open in IMG/M |
| 3300018085 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018088 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_10_MG | Environmental | Open in IMG/M |
| 3300018090 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
| 3300020170 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300020199 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021046 | Soil microbial communities from Shale Hills CZO, Pennsylvania, United States - 90cm depth | Environmental | Open in IMG/M |
| 3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
| 3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
| 3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021477 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
| 3300022557 | Paint Pots_combined assembly | Environmental | Open in IMG/M |
| 3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Host-Associated | Open in IMG/M |
| 3300024232 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK05 | Environmental | Open in IMG/M |
| 3300024251 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK20 | Environmental | Open in IMG/M |
| 3300024288 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300025498 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_150 (SPAdes) | Environmental | Open in IMG/M |
| 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025971 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushOxbow_ThreeSqC_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300026297 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026310 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_2_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026320 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026334 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 (SPAdes) | Environmental | Open in IMG/M |
| 3300026515 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NL-03-A | Environmental | Open in IMG/M |
| 3300026532 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 (SPAdes) | Environmental | Open in IMG/M |
| 3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300027172 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF038 (SPAdes) | Environmental | Open in IMG/M |
| 3300027576 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM3H0_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027587 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM3_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027619 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027645 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027648 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027655 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027660 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027667 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM3_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027812 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027829 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027842 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027862 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027867 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027874 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes) | Environmental | Open in IMG/M |
| 3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027884 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027894 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027905 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 (SPAdes) | Environmental | Open in IMG/M |
| 3300027911 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300027915 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 (SPAdes) | Environmental | Open in IMG/M |
| 3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300030707 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG (v2) | Environmental | Open in IMG/M |
| 3300030991 | Metatranscriptome of forest soil microbial communities from Montana, USA - Site 5 -Soil GP-1A (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031474 | Fir Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031545 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26 | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
| 3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031764 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f27 | Environmental | Open in IMG/M |
| 3300031833 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178 | Environmental | Open in IMG/M |
| 3300031880 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f25 | Environmental | Open in IMG/M |
| 3300031896 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f19 | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032059 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27 | Environmental | Open in IMG/M |
| 3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
| 3300033290 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15 | Environmental | Open in IMG/M |
| 3300033982 | Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB22AY SIP fraction | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI25388J43891_10014944 | 3300002909 | Grasslands Soil | GLHLTDDLKARILSTFLTLMNLRENLDRSNMRSSFGRSGHLPR* |
| JGI25617J43924_100469561 | 3300002914 | Grasslands Soil | TDDLKARILSTFLTLMNLRENLDRSNMRSSFGRSGHLPR* |
| JGI25617J43924_102866012 | 3300002914 | Grasslands Soil | VATSGLHLAXEMKARVLSTFLTLMNLRENLDRSTLRHPPGRTGAVR* |
| Ga0055490_101632172 | 3300004052 | Natural And Restored Wetlands | HLPDELKARVLNTFLTLMNLRENLDRAALRQPIGRTGGP* |
| Ga0062385_110440871 | 3300004080 | Bog Forest Soil | MTDDLKARVLSTFLTLMNLRENLDRAALRTPVGRGGVVR* |
| Ga0066395_102475382 | 3300004633 | Tropical Forest Soil | GLHLTDDLKARILSTFLTLMNLRENIDRANMRSSFGRSGQLR* |
| Ga0066388_1042056262 | 3300005332 | Tropical Forest Soil | LTDDLKARILSTFLTLMNLRENIDRASMRSSYERVPTPR* |
| Ga0066388_1072643372 | 3300005332 | Tropical Forest Soil | LHLTDDLKARVLSTFLTLMNLRENLDRASMRTPAGRSGIFR* |
| Ga0070731_106802882 | 3300005538 | Surface Soil | LTDDLKARILSTFLTLMNLRENIDRASMRSSYGRLPVPR* |
| Ga0066697_100425231 | 3300005540 | Soil | DDLKARILSTFLTLMNLRENLDRSNMRSSFGRSGHPR* |
| Ga0070733_108848601 | 3300005541 | Surface Soil | SGMHMADELKARVLSTFLTLMNLRESLDRAALRMPAGRTVLHQG* |
| Ga0070732_109572851 | 3300005542 | Surface Soil | LHLTDDLKARILSTFLTLMNLRENLDRANMRSSFGRSGQHR* |
| Ga0070695_1018327291 | 3300005545 | Corn, Switchgrass And Miscanthus Rhizosphere | LPDEMKARVLNTFLTLMNLRENLDRAALRQPIGRSGVLK* |
| Ga0066661_104109273 | 3300005554 | Soil | DEMKARILNTFLTLMNLRENLDRAALRHPIGRTEGR* |
| Ga0066703_102235342 | 3300005568 | Soil | HLPDEVKARVLTTFLTLMNLRETLDRAARRQPIGRGVSR* |
| Ga0066702_104396721 | 3300005575 | Soil | GLHLPDELKARILNTFLTLMNLRENLDRAALRHPIGRGEGR* |
| Ga0066691_100056441 | 3300005586 | Soil | SGLHLTDDLKARILSTFLTLMNLRENLDRSNMRSSFGRSGHIR* |
| Ga0070762_102124163 | 3300005602 | Soil | EMKARILNTFLTLMNLRENLDRAALRQPIGRSSG* |
| Ga0070766_106975962 | 3300005921 | Soil | LPLTDDLKARILSTFLTLMNLRENMDRASMRSSYGRLPVPR* |
| Ga0066652_1014988322 | 3300006046 | Soil | LTDDLKARILSTFLTLMNLRENLDRSNMRSSFGRSGHIR* |
| Ga0075024_1008092982 | 3300006047 | Watersheds | TDDLKARILSTFLTLMNLRENLDRANMRSSFGRSGQHRST* |
| Ga0075028_1007729531 | 3300006050 | Watersheds | LVVEAGEVKARILNTFLTLINLRENLDRAGLRQPIDRTGS* |
| Ga0075019_104374051 | 3300006086 | Watersheds | GLHLADEMKARILNTFLTLMNLRENLDRAALRQPIGRTGS* |
| Ga0070715_102306881 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | GMQLTDDLKARILSTFLTLMNLRENLDRANMRSSPGRTGAFR* |
| Ga0075018_100175456 | 3300006172 | Watersheds | ADEMKARILNTFLTLMNLRENLDRAALRQPIGRTG* |
| Ga0066658_100414581 | 3300006794 | Soil | TDDLKARILSTFLTLMNLRENLDRSNMRSSFGRSGHIR* |
| Ga0066659_105586042 | 3300006797 | Soil | KARILSTFLTLMNLRENLDRSNMRSSFGRSGHLLR* |
| Ga0066660_106765862 | 3300006800 | Soil | DLKARIRGTFLTLMNLRENLDRASMRSSFGRSNHPR* |
| Ga0079220_107656853 | 3300006806 | Agricultural Soil | TDDLKARILSTFLTLMNLRENLDRSSMRSSFGRSGHPQAPR* |
| Ga0079220_117394071 | 3300006806 | Agricultural Soil | LADEMKARVLNTFLTLMNLRENLDRAALRQPIGRTGA* |
| Ga0075425_1031204612 | 3300006854 | Populus Rhizosphere | DLKARILSTFLTLMNLRENLDRASMRTPPGRSGVFR* |
| Ga0073928_100227485 | 3300006893 | Iron-Sulfur Acid Spring | HLTDEMKARILNTFLTLMNFRENFDRAASRQATARIVR* |
| Ga0079219_104067082 | 3300006954 | Agricultural Soil | LHLTDDLKARILSTFLTLMNLRENLDRSSMRSSFGRSGHPGQPR* |
| Ga0079219_112583061 | 3300006954 | Agricultural Soil | TSTSGLHLPDELKARILNTFLTLMNLRENLDRAALRHPIGRSEGR* |
| Ga0099791_102867251 | 3300007255 | Vadose Zone Soil | LHLTDDLKARILSTFLTLMNLRENLDRSNMRGSFGRSGHIR* |
| Ga0099795_105210691 | 3300007788 | Vadose Zone Soil | SGLLLTDDLKARILSTFLTLMNLRENLDRASMRSSYGRHPVSR* |
| Ga0066710_1004512771 | 3300009012 | Grasslands Soil | SGLHLTDDLKARILSTFLTLMNLRENLDRSNMRSSFGRSGHIR |
| Ga0099829_100735141 | 3300009038 | Vadose Zone Soil | ARILSTFLTLMNLRENLDRSNMRSSFGRSGHLPR* |
| Ga0099829_100811941 | 3300009038 | Vadose Zone Soil | LHLADEMKARILNTFLTLMNLRENLDRAALRQSPGRGVAR* |
| Ga0099828_113438082 | 3300009089 | Vadose Zone Soil | DEMKARVLSTFLTLMNLRENLDRSTLRHPPGRTGAVR* |
| Ga0099828_119899151 | 3300009089 | Vadose Zone Soil | RILSTFLTLMNLRENLDRANMRSSFGRSGQHRSN* |
| Ga0099792_102946421 | 3300009143 | Vadose Zone Soil | DEMKARVLNTFLTLMNLRENLDRAALRHPIGRTGA* |
| Ga0116220_103430102 | 3300009525 | Peatlands Soil | SDELKARALSTFLTLINLRENLDRAALRAPVGRTAGR* |
| Ga0116215_13062112 | 3300009672 | Peatlands Soil | RVSTSGLHLADELKSRVLSTFLTLMNLRESLDRAALRAVPHRTVVR* |
| Ga0116224_103316741 | 3300009683 | Peatlands Soil | DEMKARILNTFLTLMNLRENLDRAALRQPIGRSG* |
| Ga0074044_108027071 | 3300010343 | Bog Forest Soil | SGLHLTDDLKARVLSTFLTLMNLRENLDRAALRSPIGRGGIIR* |
| Ga0126370_104905721 | 3300010358 | Tropical Forest Soil | LKARILSTFLTLMNLRENLDRSNMRSSFGRSGHPR* |
| Ga0126370_124190831 | 3300010358 | Tropical Forest Soil | HLTDDLKARILSTFLTLMNLRENIDRSNMRSSFGRSGNLR* |
| Ga0126376_102186153 | 3300010359 | Tropical Forest Soil | GLHLTDDLKARVLSTFLTLMNLRENLDRTSMRTPAGRSGIFR* |
| Ga0126372_114053622 | 3300010360 | Tropical Forest Soil | TDDLKARVLSTFLTLMNLRENLDRASMRTPAGRGGIFR* |
| Ga0126381_1020418362 | 3300010376 | Tropical Forest Soil | GLHLTDDLKARILSTFLTLMNLRENLDRASMRGSFGRSGHPR* |
| Ga0136449_1008457563 | 3300010379 | Peatlands Soil | LKARVLSTFLTLINLRENLDRAAMRTPTGRGGFSR* |
| Ga0136449_1020731962 | 3300010379 | Peatlands Soil | ADEMKARILNTFLTLMNLRENLDRAALRQPIGRTGG* |
| Ga0150983_145763751 | 3300011120 | Forest Soil | TSGLHLTDDLKARILSTFLTLMNLRENLDRSNMRSSFGRSGHLPR* |
| Ga0137392_101638561 | 3300011269 | Vadose Zone Soil | PDDVKARVLNTFLTLMNLRENLDRAALRQPIGRGVSR* |
| Ga0137392_101650443 | 3300011269 | Vadose Zone Soil | GLHLTDDLKARILSTFLTLMNLRESLDRSNMRSSFGRSGHLPR* |
| Ga0137392_113237482 | 3300011269 | Vadose Zone Soil | HLSDDLKARVLSTFLTLMNLRENLDRAALRTPLGRGGNYR* |
| Ga0137391_101211543 | 3300011270 | Vadose Zone Soil | TDDLKARILSTFLTLMNLRENLDRSSMRSSFGRSGHPR* |
| Ga0137431_12299911 | 3300012038 | Soil | LHLADEMKARLLNTFLTLINLRENLDRSILRQPVGRTGGR* |
| Ga0137389_103351811 | 3300012096 | Vadose Zone Soil | KARILSTFLTLMNLRENLDRSNMRSSFGRSGHLPR* |
| Ga0137388_118019721 | 3300012189 | Vadose Zone Soil | DEMKARILSTFLTLMNLRENLDRAALRQPSGRGVR* |
| Ga0137362_103232581 | 3300012205 | Vadose Zone Soil | HLTDDLKARILSTFLTLMNLRENLDRANMRSSFGRSGHLPR* |
| Ga0137377_101978143 | 3300012211 | Vadose Zone Soil | DDLKARILSTFLTLMNLRENLDRSNMRSSFGRSGHTR* |
| Ga0137361_100514981 | 3300012362 | Vadose Zone Soil | GLHLTDDLKARILSTFLTLMNLRENLDRANMRSSFGRSGHPR* |
| Ga0137358_103296563 | 3300012582 | Vadose Zone Soil | ASTSGLHLADEMKARVLNTFLTLMNLRANLDRAALRHPIGRTGA* |
| Ga0137395_108692172 | 3300012917 | Vadose Zone Soil | LKARILSTFLTLMNLRENLDRSNMRSSFGRTSQLLR* |
| Ga0137396_102314841 | 3300012918 | Vadose Zone Soil | SGLHLTDDLKARILSTFLTLMNLRENLDRSNMRSSFGRSSHPLR* |
| Ga0137419_103825932 | 3300012925 | Vadose Zone Soil | DLKARILSTFLTLMNLRENLDRSNMRSSFGRSGHLPR* |
| Ga0137419_119870781 | 3300012925 | Vadose Zone Soil | DDLKARILSTFLTLMNLRENLDRSNMRSSFGRSGHVR* |
| Ga0137407_105448052 | 3300012930 | Vadose Zone Soil | LHLTDDLKARILSTFLTLMNLRENLDRSNMRSSFGRSGHLPR* |
| Ga0137410_105296661 | 3300012944 | Vadose Zone Soil | LTDDLKARILSTFLTLMNLRENLDRSNMRSSFGRSSHPLR* |
| Ga0181518_102645051 | 3300014156 | Bog | HLADEMKARILNTFLTLMNLRENLDRAALRQPIGRSG* |
| Ga0134078_103995511 | 3300014157 | Grasslands Soil | TSGLHLTDDLKARILSTFLTLMNLRENLDRSNMRSSFGRSGHPR* |
| Ga0181538_105565871 | 3300014162 | Bog | ELKARALNTFLTLINLRENLDRAALRAPVGRSGGN* |
| Ga0181523_102074643 | 3300014165 | Bog | SGLHLTDDLKARVLSTFLTLMNLRENLDRAAMRTPTGRGGFSR* |
| Ga0181537_111556362 | 3300014201 | Bog | DDLKARILSTFLTLMNLRENLDRANMRSSFGRVSHPR* |
| Ga0137418_105586831 | 3300015241 | Vadose Zone Soil | GMPLTDDLKARILSTFLTLMNLRENLERANMRSSPGRSGPFR* |
| Ga0137418_111310022 | 3300015241 | Vadose Zone Soil | KARILSTFLTLMNLRENLDRASMRGSVGRSGVFR* |
| Ga0182041_120574811 | 3300016294 | Soil | DDLKARVLSTFLTLMNLRENLDRAAMRLPPGRSGILR |
| Ga0182034_117836461 | 3300016371 | Soil | LTDDLKARILSTFLTLMNLRENLDRASLRTPPGRSGVLR |
| Ga0182038_117162521 | 3300016445 | Soil | DLKARILSTFLTLMNLRENLDRASLRTPPGRSGVLR |
| Ga0187819_105915631 | 3300017943 | Freshwater Sediment | LKARVLSTFLTLMNLRENLDRAALRMPMGRTGILR |
| Ga0187786_104081842 | 3300017944 | Tropical Peatland | GLHLTDDLKARVLSTFLTLMNLRENLDRASMRTPAGRGGIFR |
| Ga0187879_107646141 | 3300017946 | Peatland | TDELKARALNTFLTLINLRENLDRAALRAPVGRTGGN |
| Ga0187783_111078512 | 3300017970 | Tropical Peatland | GLHLTDDLKARILSTFLTLMNLRENLDRANMRSSFGRTGQLR |
| Ga0187780_109474221 | 3300017973 | Tropical Peatland | LHLADEMKARILNTFLTLMNLRENLDRAALRQPIGRTGG |
| Ga0187777_112169511 | 3300017974 | Tropical Peatland | DDLKARVLSTFLTLMNLRENLDRAALRTPPGRTGILR |
| Ga0187772_102663781 | 3300018085 | Tropical Peatland | TDDLKARVLSTFLTLMNLRENLDRAALRMPMGRTGILR |
| Ga0187771_107307671 | 3300018088 | Tropical Peatland | GLPLMDDMKARILSTFLTLMNLRENLDRAVLRQPLGRSSAPR |
| Ga0187770_116731521 | 3300018090 | Tropical Peatland | TDDLKARVLSTFLTLMNLRENLDRAAMRTPTGRGGFSR |
| Ga0066655_102520161 | 3300018431 | Grasslands Soil | TSGLHLTDDLKARILSTFLTLMNLRENLDRSNMRSSFGRSGHIR |
| Ga0179594_103547691 | 3300020170 | Vadose Zone Soil | GLHLTDDLKARILSTFLTLMNLRENLDRSNMRSSFGRSGHLPR |
| Ga0179592_101830802 | 3300020199 | Vadose Zone Soil | GMQLTDDLKARILSTFLTLMNLRENLDRANMRSSPGRTGAFR |
| Ga0179592_102158661 | 3300020199 | Vadose Zone Soil | LKARVLSTFLTLMNLRESLDRAALRVPAGRTGLRQI |
| Ga0179592_102431963 | 3300020199 | Vadose Zone Soil | LKARVLSTFLTLMNLRENLDRASMRTPAGRSGIFR |
| Ga0210407_109017232 | 3300020579 | Soil | RASTSGLPLADEMKARILNTFLTLMNLRENLDRAALRHPIGRSG |
| Ga0210403_100968063 | 3300020580 | Soil | DDLKARILSTFLTLMNLRENIDRASMRSSYGRLPIPR |
| Ga0210403_107163311 | 3300020580 | Soil | DDLKARVLSTFLTLMNLRENLDRAALRTPVGRGGLLR |
| Ga0210403_108820741 | 3300020580 | Soil | SGLHLTDDLKARILSTFLTLMNLRENLDRSNMRSSFGRSGHVR |
| Ga0210399_108515302 | 3300020581 | Soil | LPLTDDLKARILSTFLTLMNLRENIDRASMRSSYGRLPVPH |
| Ga0210401_104353231 | 3300020583 | Soil | HLTDDLKARILSTFLTLMNLRENLDRANMRSSFGRTGQHR |
| Ga0215015_106066182 | 3300021046 | Soil | HMADEMKARILNTFLTLMNLRENLDRAALRQPIGRSG |
| Ga0210406_109306342 | 3300021168 | Soil | TSGLHLTDDLKARILSTFLTLMNLRENLDRSNMRSSFGRSGHVLR |
| Ga0210408_106506452 | 3300021178 | Soil | SGLHLTDDLKARILSTFLTLMNLRENLDRSNMRSSFGRSGHLPR |
| Ga0210388_114148472 | 3300021181 | Soil | GMPLTDDLKARILSTFLTLMNLRENLDRANMRSSPGRTGAFR |
| Ga0210387_115216091 | 3300021405 | Soil | SGLPLTDDLKARILSTFLTLMNLRENMDRASMRSSYGRLPVPR |
| Ga0210386_109788881 | 3300021406 | Soil | LKARILSTFLTLMNLRENMDRASMRSSYGRLPVPR |
| Ga0210394_101059171 | 3300021420 | Soil | LHLPDELKARILNTFLTLMNLRENLDRAALRHPIGRGEGR |
| Ga0210394_101828314 | 3300021420 | Soil | GLHLADEMKARILNTFLTLMNLRENLDRAALRQPIGRSG |
| Ga0210394_107330582 | 3300021420 | Soil | GLHLTDDLKARILSTFLTLMNLRENLDRSNMRSSFGRSGHIR |
| Ga0210384_110472311 | 3300021432 | Soil | MKARVLNTFLTLMNLRENLDRASLRQPVGRSGSAK |
| Ga0210398_109007232 | 3300021477 | Soil | SGMHMADELKARVLSTFLTLMNLRESLDRAALRVPAGRTASRLA |
| Ga0210402_108692392 | 3300021478 | Soil | LTDDLKARVLSTFLTLMNLRENLDRAAMRTPMGRGGVLR |
| Ga0210402_111202771 | 3300021478 | Soil | LKARILSTFLTLMNLRENLDRASMRSSVGRGGGAYRGGL |
| Ga0210410_112478482 | 3300021479 | Soil | TDDLKARILSTFLTLMNLRENIDRASMRSSYGRLPVPH |
| Ga0210410_114804342 | 3300021479 | Soil | HLADEMKARILNTFLTLMNLRENLDRAALRQPIGRSS |
| Ga0212123_100336835 | 3300022557 | Iron-Sulfur Acid Spring | HLTDEMKARILNTFLTLMNFRENFDRAASRQATARIVR |
| Ga0228598_10393732 | 3300024227 | Rhizosphere | DDLKARILSTFLTLMNLRENLDRANMRSSFGRTGQTR |
| Ga0247664_11806941 | 3300024232 | Soil | DEMKARILNTFLTLMNLRENLDRAALRQPIGRTNG |
| Ga0247679_10257802 | 3300024251 | Soil | LTDDLKARVLSTFLTLMNLRENLDRASMRTPAGRSGIFR |
| Ga0179589_106006632 | 3300024288 | Vadose Zone Soil | LTDDLKARILSTFLTLMNLRENLDRSNMRSSFGRSGHIR |
| Ga0208819_10826552 | 3300025498 | Peatland | DDLKARVLSTFLTLMNLRENLDRAAMRTPTGRGGFSR |
| Ga0207699_106429352 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | LTDDLKARILSTFLTLMNLRENIDRASMRSSYGRVPTPR |
| Ga0210102_10958352 | 3300025971 | Natural And Restored Wetlands | DELKARVLNTFLTLMNLRENLDRAALRQPIGRTGGP |
| Ga0209237_11579202 | 3300026297 | Grasslands Soil | TSGLPLTDDLKARVLSTFLTLMNLRENLDRASMRSPFGRSGVLR |
| Ga0209239_10569853 | 3300026310 | Grasslands Soil | LHLTDDLKARILSTFLTLMNLRENLDRSNMRSSFGRSGHTR |
| Ga0209131_10690571 | 3300026320 | Grasslands Soil | LHLTDDLKARILSTFLTLMNLRENLDRSNMRSSFGRSGHPLR |
| Ga0209377_10263485 | 3300026334 | Soil | SGLHLPDEVKARVLNTFLTLMNLRENLDRAALRQPIGRGVSR |
| Ga0257158_11085112 | 3300026515 | Soil | SGMPLTDDLKARILSTFLTLMNLRENLDRANMRSSPGRTGAFR |
| Ga0209160_10395373 | 3300026532 | Soil | TSGLPLTDDLKARVLSTFLTLMNLRENLDRASMRSPFGRSGVMR |
| Ga0179587_103970111 | 3300026557 | Vadose Zone Soil | KARILSTFLTLMNLRESLDRSNMRSSFGRSGHLPR |
| Ga0208098_10156491 | 3300027172 | Forest Soil | LHLTDDLKARILSTFLTLMNLRENLDRANMRSSFGRSGQHRST |
| Ga0209003_11120742 | 3300027576 | Forest Soil | LHLTDDLKARVLSTFLTLMNLRENLDRAAMRNPMGRSGIFR |
| Ga0209220_10831791 | 3300027587 | Forest Soil | ELHLTDDLKARILSTFLTLMNLRENLDRSNMRSSFGRSGHVR |
| Ga0209330_11262532 | 3300027619 | Forest Soil | DLKARILSTFLTLMNLRENMDRASMRSSYGRLPVPR |
| Ga0209117_11351471 | 3300027645 | Forest Soil | RASTCGLHLADEMKARILNTFLTLMNLRENLDRAALRQPIGRTGG |
| Ga0209420_10621062 | 3300027648 | Forest Soil | PLTDDLKARILSTFLTLMNLRENMDRASMRSSYGRLPVPR |
| Ga0209388_11739302 | 3300027655 | Vadose Zone Soil | LKARILSTFLTLMNLRENLDRSNMRGSFGRSGHIR |
| Ga0209736_10223843 | 3300027660 | Forest Soil | HLTDDLKARVLSTFLTLMNLRENLDRASMRTPAGRSGIFR |
| Ga0209736_11327841 | 3300027660 | Forest Soil | GLPLTDDLKARILSTFLTLMNLRENIDRASMRSSYGRLPLPR |
| Ga0209009_10210131 | 3300027667 | Forest Soil | SGLRLPDEIKARILTGFLSLMNLRENLDRALMRSTGRKTGI |
| Ga0209656_100019791 | 3300027812 | Bog Forest Soil | SGLVLTDDLKARILSTFLTLMNLRENLDRANMRSSFGRVSHPR |
| Ga0209656_103341221 | 3300027812 | Bog Forest Soil | LTDDLKARVLSTFLTLMNLRENLDRAAMRTPPGRSGILR |
| Ga0209773_104266642 | 3300027829 | Bog Forest Soil | CGLHLTDDLKARILSTFLTLMNLRENLDRANMRSSFGRISHPR |
| Ga0209580_106315491 | 3300027842 | Surface Soil | GLHLTDDLKARILSTFLTLMNLRENLDRANMRSSFGRSGQHR |
| Ga0209180_105382132 | 3300027846 | Vadose Zone Soil | TDDLKARILSTFLTLMNLRENLDRSNMRSSFGRSGHLPR |
| Ga0209701_100717071 | 3300027862 | Vadose Zone Soil | DLKARILSTFLTLMNLRENLDRANMRSSFGRSGHIR |
| Ga0209701_101737282 | 3300027862 | Vadose Zone Soil | LKARILSTFLTLMNLRENLDRANMRSSFGRSGQHHST |
| Ga0209167_107322621 | 3300027867 | Surface Soil | MHMADELKARVLSTFLTLMNLRESLDRAALRMPAGRTVLHQG |
| Ga0209465_105280612 | 3300027874 | Tropical Forest Soil | GLHLTDDLKARILSTFLTLMNLRENIDRANMRSSFGRSGQLR |
| Ga0209590_104917002 | 3300027882 | Vadose Zone Soil | TDDLKARILSTFLTLMNLRENLDRANMRSSFGRSGHPR |
| Ga0209275_105979522 | 3300027884 | Soil | LADEMKARILNTFLTLMNLRENLDRAALRQPIGRSSG |
| Ga0209068_101355582 | 3300027894 | Watersheds | LVVEAGEVKARILNTFLTLINLRENLDRAGLRQPIDRTGS |
| Ga0209488_104289841 | 3300027903 | Vadose Zone Soil | DLKARILSTFLTLMNLRENLDRASMRSSYGRHPVSR |
| Ga0209488_108405661 | 3300027903 | Vadose Zone Soil | SGLHLTDDLKARILSTFLTLMNLRENLDRANMRSSFGRSGHIR |
| Ga0209415_103682543 | 3300027905 | Peatlands Soil | SGMHLSDELKARILNTFLTLMNLRENLDRSALRQPVGRSGNR |
| Ga0209698_113224461 | 3300027911 | Watersheds | LHLADEMKARILNTFLTLMNLRENLDRAALRQPIGRTGA |
| Ga0209069_107219051 | 3300027915 | Watersheds | KARILSTFLTLMNLRENLDRANMRSSFGRSGQHRST |
| Ga0137415_107902382 | 3300028536 | Vadose Zone Soil | TDDLKARILSTFLTLMNLRENLDRSNMRSSFGRSGHIR |
| Ga0310038_102709311 | 3300030707 | Peatlands Soil | LKARVLSTFLTLMNLRENLDRASMRTPTGRGGFSR |
| Ga0073994_100618603 | 3300030991 | Soil | TDDLKARILSTFLTLMNLRENLDRSNMRSSFGRSGHVR |
| Ga0170818_1050852402 | 3300031474 | Forest Soil | DDLKARVLSTFLTLMNLRENLDRASMRTPAGRSGIFR |
| Ga0318541_100419933 | 3300031545 | Soil | MALTDDLKARILSTFLTLMNLRENLDRASMRTPPGRSGALR |
| Ga0310686_1124135573 | 3300031708 | Soil | LADEMKARILNTFLTLMNLRENLDRAALRQPIGRSG |
| Ga0310686_1188461892 | 3300031708 | Soil | GMHMADELKARVLSTFLTLMNLRESLDRAALRVPAGRTASRLA |
| Ga0310686_1198285011 | 3300031708 | Soil | TDDLKARILSTFLTLMNLRENLDRASMRSSYGRLPMPR |
| Ga0306917_108126931 | 3300031719 | Soil | LKARVLSTFLTLMNLRENLDRAALRTPTGRGGFAR |
| Ga0306917_112262292 | 3300031719 | Soil | LHLSDDLKARVLSTFLTLMNLRENLDRAALRTPTGRSGIPR |
| Ga0307477_103632063 | 3300031753 | Hardwood Forest Soil | DEMKARILNTFLTLINLRENLDRAALRQPIGRTKG |
| Ga0307475_101075583 | 3300031754 | Hardwood Forest Soil | DLKARILSTFLTLMNLRENLDRAKMRGSFGRSGHVR |
| Ga0307475_103593362 | 3300031754 | Hardwood Forest Soil | DLKARILSTFLTLMNLRENLDRANMRSSFGRSGQHHST |
| Ga0318535_104303301 | 3300031764 | Soil | DDLKARVLSTFLTLMNLRENLDRAAMRTPSGRSGIHR |
| Ga0310917_101928782 | 3300031833 | Soil | GLHLTDDLKARVLSTFLTLMNLRENLDRAALRMPTGRSGMLR |
| Ga0318544_104288002 | 3300031880 | Soil | SGLHLTDDLKARVLSTFLTLMNLRENLDRAALRMPTGRSGMLR |
| Ga0318551_105311661 | 3300031896 | Soil | HLSDDLKARVLSTFLTLMNLRENLDRAALRTPTGRSGIPR |
| Ga0306923_100705443 | 3300031910 | Soil | DLKARVLSTFLTLMNLRENLDRAAMRTPSGRSGIHR |
| Ga0307479_106861952 | 3300031962 | Hardwood Forest Soil | SGLHLTDDLKARVLSTFLTLMNLRENLDRASMRTPAGRSGIFR |
| Ga0318533_103779501 | 3300032059 | Soil | LTDDLKARILSTFLTLMNLRENLDRASMRSSFGRSGHPR |
| Ga0318533_105407851 | 3300032059 | Soil | LHLTDDLKARVLSTFLTLMNLRENLDRASMRTPAGRGGIFR |
| Ga0306924_103401171 | 3300032076 | Soil | SGLHLTDDLKARVLSTFLTLMNLRENLDRAALRTPTGRGGFAR |
| Ga0306924_123722102 | 3300032076 | Soil | PLTDDLKARILSTFLTLMNLRENLDRANMRSSPGRSGAFR |
| Ga0307471_1002434671 | 3300032180 | Hardwood Forest Soil | DDLKARILSTFLTLMNLRENIDRSNMRSSFGRSGNFR |
| Ga0307471_1039456892 | 3300032180 | Hardwood Forest Soil | ADEMKARVLNTFLTLMNLRENLDRAALRHPIGRTGA |
| Ga0335080_123433352 | 3300032828 | Soil | TDDLKARILSTFLTLMNLRENIDRANMRSSFGRSGNIR |
| Ga0318519_110827552 | 3300033290 | Soil | LKARVLSTFLTLMNLRENLDRASMRTPTGRGGVWR |
| Ga0371487_0276076_632_766 | 3300033982 | Peat Soil | TTSGVHLSDELKARALSTFLTLINLRENLDRAALRAPIGRTGSR |
| ⦗Top⦘ |