| Basic Information | |
|---|---|
| Family ID | F030217 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 186 |
| Average Sequence Length | 44 residues |
| Representative Sequence | MVGYLGMESVIAASARPLGADEPALRERWKEAAVDLVVAGVAAR |
| Number of Associated Samples | 147 |
| Number of Associated Scaffolds | 186 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 3.76 % |
| % of genes near scaffold ends (potentially truncated) | 95.70 % |
| % of genes from short scaffolds (< 2000 bps) | 88.71 % |
| Associated GOLD sequencing projects | 135 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.49 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (97.312 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (28.495 % of family members) |
| Environment Ontology (ENVO) | Unclassified (44.086 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (45.699 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 51.39% β-sheet: 0.00% Coil/Unstructured: 48.61% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.49 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 186 Family Scaffolds |
|---|---|---|
| PF05362 | Lon_C | 59.68 |
| PF06452 | CBM9_1 | 2.15 |
| PF00069 | Pkinase | 1.08 |
| PF14685 | Tricorn_PDZ | 0.54 |
| PF08811 | DUF1800 | 0.54 |
| PF08240 | ADH_N | 0.54 |
| PF00593 | TonB_dep_Rec | 0.54 |
| PF00440 | TetR_N | 0.54 |
| COG ID | Name | Functional Category | % Frequency in 186 Family Scaffolds |
|---|---|---|---|
| COG0466 | ATP-dependent Lon protease, bacterial type | Posttranslational modification, protein turnover, chaperones [O] | 59.68 |
| COG1067 | Predicted ATP-dependent protease | Posttranslational modification, protein turnover, chaperones [O] | 59.68 |
| COG1750 | Predicted archaeal serine protease, S18 family | General function prediction only [R] | 59.68 |
| COG3480 | Predicted secreted protein YlbL, contains PDZ domain | Signal transduction mechanisms [T] | 59.68 |
| COG0515 | Serine/threonine protein kinase | Signal transduction mechanisms [T] | 4.30 |
| COG5267 | Uncharacterized conserved protein, DUF1800 family | Function unknown [S] | 0.54 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 97.31 % |
| Unclassified | root | N/A | 2.69 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300002557|JGI25381J37097_1004122 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 2509 | Open in IMG/M |
| 3300002908|JGI25382J43887_10424631 | All Organisms → cellular organisms → Bacteria | 562 | Open in IMG/M |
| 3300002911|JGI25390J43892_10020556 | All Organisms → cellular organisms → Bacteria | 1587 | Open in IMG/M |
| 3300002911|JGI25390J43892_10122453 | All Organisms → cellular organisms → Bacteria | 595 | Open in IMG/M |
| 3300002914|JGI25617J43924_10226083 | All Organisms → cellular organisms → Bacteria | 626 | Open in IMG/M |
| 3300004022|Ga0055432_10135950 | All Organisms → cellular organisms → Bacteria | 673 | Open in IMG/M |
| 3300004139|Ga0058897_10927736 | Not Available | 536 | Open in IMG/M |
| 3300005178|Ga0066688_10677807 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 657 | Open in IMG/M |
| 3300005180|Ga0066685_10865043 | All Organisms → cellular organisms → Bacteria | 607 | Open in IMG/M |
| 3300005181|Ga0066678_10614473 | Not Available | 723 | Open in IMG/M |
| 3300005444|Ga0070694_101356072 | All Organisms → cellular organisms → Bacteria | 599 | Open in IMG/M |
| 3300005445|Ga0070708_100324233 | All Organisms → cellular organisms → Bacteria | 1451 | Open in IMG/M |
| 3300005447|Ga0066689_10392025 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 868 | Open in IMG/M |
| 3300005447|Ga0066689_10821998 | All Organisms → cellular organisms → Bacteria | 577 | Open in IMG/M |
| 3300005450|Ga0066682_10045212 | All Organisms → cellular organisms → Bacteria | 2655 | Open in IMG/M |
| 3300005467|Ga0070706_101839344 | All Organisms → cellular organisms → Bacteria | 550 | Open in IMG/M |
| 3300005471|Ga0070698_102215463 | All Organisms → cellular organisms → Bacteria | 503 | Open in IMG/M |
| 3300005518|Ga0070699_100164116 | Not Available | 1967 | Open in IMG/M |
| 3300005518|Ga0070699_101073923 | All Organisms → cellular organisms → Bacteria | 738 | Open in IMG/M |
| 3300005536|Ga0070697_101222032 | All Organisms → cellular organisms → Bacteria | 670 | Open in IMG/M |
| 3300005547|Ga0070693_100902577 | All Organisms → cellular organisms → Bacteria | 662 | Open in IMG/M |
| 3300005549|Ga0070704_100966054 | All Organisms → cellular organisms → Bacteria | 769 | Open in IMG/M |
| 3300005552|Ga0066701_10275383 | All Organisms → cellular organisms → Bacteria | 1042 | Open in IMG/M |
| 3300005555|Ga0066692_10531734 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 746 | Open in IMG/M |
| 3300005555|Ga0066692_10786624 | All Organisms → cellular organisms → Bacteria | 586 | Open in IMG/M |
| 3300005556|Ga0066707_10084749 | All Organisms → cellular organisms → Bacteria | 1919 | Open in IMG/M |
| 3300005558|Ga0066698_10443394 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 887 | Open in IMG/M |
| 3300005568|Ga0066703_10886329 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 509 | Open in IMG/M |
| 3300005719|Ga0068861_102062778 | All Organisms → cellular organisms → Bacteria | 570 | Open in IMG/M |
| 3300006031|Ga0066651_10305797 | All Organisms → cellular organisms → Bacteria | 851 | Open in IMG/M |
| 3300006034|Ga0066656_10054112 | All Organisms → cellular organisms → Bacteria | 2324 | Open in IMG/M |
| 3300006034|Ga0066656_10980224 | All Organisms → cellular organisms → Bacteria | 542 | Open in IMG/M |
| 3300006173|Ga0070716_100436839 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 950 | Open in IMG/M |
| 3300006791|Ga0066653_10692753 | All Organisms → cellular organisms → Bacteria | 526 | Open in IMG/M |
| 3300006796|Ga0066665_10277957 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1336 | Open in IMG/M |
| 3300006797|Ga0066659_10201516 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1457 | Open in IMG/M |
| 3300006797|Ga0066659_10882674 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 746 | Open in IMG/M |
| 3300006845|Ga0075421_100974381 | All Organisms → cellular organisms → Bacteria | 962 | Open in IMG/M |
| 3300006846|Ga0075430_101224383 | All Organisms → cellular organisms → Bacteria | 618 | Open in IMG/M |
| 3300006847|Ga0075431_100968314 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 819 | Open in IMG/M |
| 3300006854|Ga0075425_101016677 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 945 | Open in IMG/M |
| 3300006903|Ga0075426_10150639 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1679 | Open in IMG/M |
| 3300006904|Ga0075424_101902648 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 628 | Open in IMG/M |
| 3300007265|Ga0099794_10697510 | All Organisms → cellular organisms → Bacteria | 540 | Open in IMG/M |
| 3300009012|Ga0066710_102152197 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 817 | Open in IMG/M |
| 3300009012|Ga0066710_103872086 | All Organisms → cellular organisms → Bacteria | 561 | Open in IMG/M |
| 3300009038|Ga0099829_10028743 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 3935 | Open in IMG/M |
| 3300009038|Ga0099829_10028914 | All Organisms → cellular organisms → Bacteria | 3927 | Open in IMG/M |
| 3300009088|Ga0099830_10212092 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1519 | Open in IMG/M |
| 3300009088|Ga0099830_11682413 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 529 | Open in IMG/M |
| 3300009090|Ga0099827_10262681 | All Organisms → cellular organisms → Bacteria | 1453 | Open in IMG/M |
| 3300009090|Ga0099827_11912008 | All Organisms → cellular organisms → Bacteria | 517 | Open in IMG/M |
| 3300009094|Ga0111539_10961518 | All Organisms → cellular organisms → Bacteria | 993 | Open in IMG/M |
| 3300009137|Ga0066709_101774190 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 868 | Open in IMG/M |
| 3300009147|Ga0114129_11033465 | All Organisms → cellular organisms → Bacteria | 1033 | Open in IMG/M |
| 3300009162|Ga0075423_12188019 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 601 | Open in IMG/M |
| 3300009700|Ga0116217_10751541 | All Organisms → cellular organisms → Bacteria | 602 | Open in IMG/M |
| 3300010099|Ga0127450_1077385 | All Organisms → cellular organisms → Bacteria | 591 | Open in IMG/M |
| 3300010124|Ga0127498_1043559 | All Organisms → cellular organisms → Bacteria | 587 | Open in IMG/M |
| 3300010126|Ga0127482_1064149 | All Organisms → cellular organisms → Bacteria | 1156 | Open in IMG/M |
| 3300010127|Ga0127489_1120110 | All Organisms → cellular organisms → Bacteria | 915 | Open in IMG/M |
| 3300010133|Ga0127459_1141376 | All Organisms → cellular organisms → Bacteria | 602 | Open in IMG/M |
| 3300010133|Ga0127459_1178714 | All Organisms → cellular organisms → Bacteria | 543 | Open in IMG/M |
| 3300010142|Ga0127483_1062669 | All Organisms → cellular organisms → Bacteria | 1018 | Open in IMG/M |
| 3300010329|Ga0134111_10212335 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 785 | Open in IMG/M |
| 3300010337|Ga0134062_10542269 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 591 | Open in IMG/M |
| 3300011269|Ga0137392_10778743 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 790 | Open in IMG/M |
| 3300011271|Ga0137393_10038956 | All Organisms → cellular organisms → Bacteria | 3654 | Open in IMG/M |
| 3300011413|Ga0137333_1003928 | All Organisms → cellular organisms → Bacteria | 3351 | Open in IMG/M |
| 3300011429|Ga0137455_1143267 | All Organisms → cellular organisms → Bacteria | 711 | Open in IMG/M |
| 3300012175|Ga0137321_1085616 | All Organisms → cellular organisms → Bacteria | 705 | Open in IMG/M |
| 3300012198|Ga0137364_11357175 | All Organisms → cellular organisms → Bacteria | 528 | Open in IMG/M |
| 3300012199|Ga0137383_10078603 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 2383 | Open in IMG/M |
| 3300012199|Ga0137383_10870531 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 658 | Open in IMG/M |
| 3300012199|Ga0137383_11154668 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 558 | Open in IMG/M |
| 3300012200|Ga0137382_10080101 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 2116 | Open in IMG/M |
| 3300012203|Ga0137399_11633813 | All Organisms → cellular organisms → Bacteria | 533 | Open in IMG/M |
| 3300012206|Ga0137380_10622858 | All Organisms → cellular organisms → Bacteria | 942 | Open in IMG/M |
| 3300012207|Ga0137381_10721293 | All Organisms → cellular organisms → Bacteria | 866 | Open in IMG/M |
| 3300012207|Ga0137381_11266136 | All Organisms → cellular organisms → Bacteria | 630 | Open in IMG/M |
| 3300012208|Ga0137376_10545492 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1005 | Open in IMG/M |
| 3300012208|Ga0137376_11266276 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 627 | Open in IMG/M |
| 3300012208|Ga0137376_11463168 | All Organisms → cellular organisms → Bacteria | 574 | Open in IMG/M |
| 3300012210|Ga0137378_10556993 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1055 | Open in IMG/M |
| 3300012285|Ga0137370_10129784 | All Organisms → cellular organisms → Bacteria | 1444 | Open in IMG/M |
| 3300012350|Ga0137372_10755985 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 700 | Open in IMG/M |
| 3300012350|Ga0137372_10990233 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 587 | Open in IMG/M |
| 3300012351|Ga0137386_10891112 | All Organisms → cellular organisms → Bacteria | 638 | Open in IMG/M |
| 3300012355|Ga0137369_10736824 | All Organisms → cellular organisms → Bacteria | 676 | Open in IMG/M |
| 3300012359|Ga0137385_10315509 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1343 | Open in IMG/M |
| 3300012373|Ga0134042_1202764 | All Organisms → cellular organisms → Bacteria | 1202 | Open in IMG/M |
| 3300012380|Ga0134047_1098023 | All Organisms → cellular organisms → Bacteria | 949 | Open in IMG/M |
| 3300012380|Ga0134047_1198786 | All Organisms → cellular organisms → Bacteria | 1390 | Open in IMG/M |
| 3300012383|Ga0134033_1044238 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 659 | Open in IMG/M |
| 3300012393|Ga0134052_1099650 | All Organisms → cellular organisms → Bacteria | 1062 | Open in IMG/M |
| 3300012395|Ga0134044_1337574 | All Organisms → cellular organisms → Bacteria | 548 | Open in IMG/M |
| 3300012399|Ga0134061_1337730 | All Organisms → cellular organisms → Bacteria | 604 | Open in IMG/M |
| 3300012402|Ga0134059_1120664 | All Organisms → cellular organisms → Bacteria | 2643 | Open in IMG/M |
| 3300012403|Ga0134049_1148029 | All Organisms → cellular organisms → Bacteria | 585 | Open in IMG/M |
| 3300012403|Ga0134049_1320584 | All Organisms → cellular organisms → Bacteria | 537 | Open in IMG/M |
| 3300012406|Ga0134053_1322784 | All Organisms → cellular organisms → Bacteria | 1249 | Open in IMG/M |
| 3300012409|Ga0134045_1462427 | All Organisms → cellular organisms → Bacteria | 626 | Open in IMG/M |
| 3300012410|Ga0134060_1144224 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 723 | Open in IMG/M |
| 3300012917|Ga0137395_10759983 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 702 | Open in IMG/M |
| 3300012925|Ga0137419_10040203 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 2944 | Open in IMG/M |
| 3300012925|Ga0137419_10134597 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1765 | Open in IMG/M |
| 3300012925|Ga0137419_10136940 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1751 | Open in IMG/M |
| 3300012925|Ga0137419_10234123 | All Organisms → cellular organisms → Bacteria | 1376 | Open in IMG/M |
| 3300012927|Ga0137416_11390918 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 635 | Open in IMG/M |
| 3300012927|Ga0137416_11742004 | All Organisms → cellular organisms → Bacteria | 569 | Open in IMG/M |
| 3300012929|Ga0137404_11471654 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 630 | Open in IMG/M |
| 3300012930|Ga0137407_10952893 | All Organisms → cellular organisms → Bacteria | 812 | Open in IMG/M |
| 3300012972|Ga0134077_10252389 | All Organisms → cellular organisms → Bacteria | 731 | Open in IMG/M |
| 3300014154|Ga0134075_10030749 | All Organisms → cellular organisms → Bacteria | 2180 | Open in IMG/M |
| 3300014157|Ga0134078_10256654 | All Organisms → cellular organisms → Bacteria | 735 | Open in IMG/M |
| 3300014166|Ga0134079_10148042 | All Organisms → cellular organisms → Bacteria | 944 | Open in IMG/M |
| 3300015053|Ga0137405_1311337 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1337 | Open in IMG/M |
| 3300015053|Ga0137405_1336601 | All Organisms → cellular organisms → Bacteria | 8215 | Open in IMG/M |
| 3300015054|Ga0137420_1051272 | All Organisms → cellular organisms → Bacteria | 1303 | Open in IMG/M |
| 3300015054|Ga0137420_1090576 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1612 | Open in IMG/M |
| 3300015054|Ga0137420_1097110 | All Organisms → cellular organisms → Bacteria | 1277 | Open in IMG/M |
| 3300015054|Ga0137420_1124889 | All Organisms → cellular organisms → Bacteria | 1274 | Open in IMG/M |
| 3300015054|Ga0137420_1124890 | All Organisms → cellular organisms → Bacteria | 960 | Open in IMG/M |
| 3300015054|Ga0137420_1494313 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1965 | Open in IMG/M |
| 3300015356|Ga0134073_10121431 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 796 | Open in IMG/M |
| 3300015358|Ga0134089_10015119 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 2557 | Open in IMG/M |
| 3300015358|Ga0134089_10112594 | All Organisms → cellular organisms → Bacteria | 1052 | Open in IMG/M |
| 3300015359|Ga0134085_10329493 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 675 | Open in IMG/M |
| 3300017654|Ga0134069_1017278 | All Organisms → cellular organisms → Bacteria | 2143 | Open in IMG/M |
| 3300017654|Ga0134069_1374248 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 514 | Open in IMG/M |
| 3300017656|Ga0134112_10085953 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1172 | Open in IMG/M |
| 3300018007|Ga0187805_10479685 | All Organisms → cellular organisms → Bacteria | 582 | Open in IMG/M |
| 3300018431|Ga0066655_10211434 | All Organisms → cellular organisms → Bacteria | 1208 | Open in IMG/M |
| 3300018468|Ga0066662_10716679 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 957 | Open in IMG/M |
| 3300018468|Ga0066662_12368485 | All Organisms → cellular organisms → Bacteria | 558 | Open in IMG/M |
| 3300018482|Ga0066669_10902293 | All Organisms → cellular organisms → Bacteria | 791 | Open in IMG/M |
| 3300019233|Ga0184645_1132758 | All Organisms → cellular organisms → Bacteria | 1223 | Open in IMG/M |
| 3300019249|Ga0184648_1387453 | Not Available | 2388 | Open in IMG/M |
| 3300019259|Ga0184646_1003463 | All Organisms → cellular organisms → Bacteria | 931 | Open in IMG/M |
| 3300020170|Ga0179594_10259664 | All Organisms → cellular organisms → Bacteria | 656 | Open in IMG/M |
| 3300020170|Ga0179594_10363276 | All Organisms → cellular organisms → Bacteria | 549 | Open in IMG/M |
| 3300021073|Ga0210378_10077122 | All Organisms → cellular organisms → Bacteria | 1305 | Open in IMG/M |
| 3300021086|Ga0179596_10536492 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 594 | Open in IMG/M |
| 3300021951|Ga0222624_1026274 | All Organisms → cellular organisms → Bacteria | 784 | Open in IMG/M |
| 3300024275|Ga0247674_1045756 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 527 | Open in IMG/M |
| 3300024330|Ga0137417_1027158 | All Organisms → cellular organisms → Bacteria | 1818 | Open in IMG/M |
| 3300024330|Ga0137417_1121336 | All Organisms → cellular organisms → Bacteria | 783 | Open in IMG/M |
| 3300025915|Ga0207693_11333680 | All Organisms → cellular organisms → Bacteria | 535 | Open in IMG/M |
| 3300026277|Ga0209350_1025165 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1811 | Open in IMG/M |
| 3300026295|Ga0209234_1010572 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae | 3499 | Open in IMG/M |
| 3300026296|Ga0209235_1005239 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae | 7248 | Open in IMG/M |
| 3300026298|Ga0209236_1024449 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis | 3319 | Open in IMG/M |
| 3300026300|Ga0209027_1035163 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1893 | Open in IMG/M |
| 3300026306|Ga0209468_1126922 | All Organisms → cellular organisms → Bacteria | 743 | Open in IMG/M |
| 3300026306|Ga0209468_1205985 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 500 | Open in IMG/M |
| 3300026323|Ga0209472_1070933 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1438 | Open in IMG/M |
| 3300026324|Ga0209470_1277116 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 646 | Open in IMG/M |
| 3300026331|Ga0209267_1239504 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 646 | Open in IMG/M |
| 3300026332|Ga0209803_1254911 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 605 | Open in IMG/M |
| 3300026334|Ga0209377_1175010 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 764 | Open in IMG/M |
| 3300026335|Ga0209804_1178507 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 920 | Open in IMG/M |
| 3300026527|Ga0209059_1198282 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 681 | Open in IMG/M |
| 3300026529|Ga0209806_1190675 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 727 | Open in IMG/M |
| 3300026532|Ga0209160_1275342 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 571 | Open in IMG/M |
| 3300026536|Ga0209058_1241667 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 645 | Open in IMG/M |
| 3300026540|Ga0209376_1145417 | All Organisms → cellular organisms → Bacteria | 1143 | Open in IMG/M |
| 3300027513|Ga0208685_1063875 | All Organisms → cellular organisms → Bacteria | 793 | Open in IMG/M |
| 3300027875|Ga0209283_10675028 | All Organisms → cellular organisms → Bacteria | 648 | Open in IMG/M |
| 3300027903|Ga0209488_10810396 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 663 | Open in IMG/M |
| 3300027961|Ga0209853_1085777 | All Organisms → cellular organisms → Bacteria | 816 | Open in IMG/M |
| 3300027961|Ga0209853_1127021 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 631 | Open in IMG/M |
| 3300028536|Ga0137415_10937636 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 676 | Open in IMG/M |
| 3300031226|Ga0307497_10133345 | All Organisms → cellular organisms → Bacteria | 1011 | Open in IMG/M |
| 3300031421|Ga0308194_10002667 | All Organisms → cellular organisms → Bacteria | 2574 | Open in IMG/M |
| 3300031421|Ga0308194_10009709 | Not Available | 1810 | Open in IMG/M |
| 3300031421|Ga0308194_10037284 | All Organisms → cellular organisms → Bacteria | 1181 | Open in IMG/M |
| 3300031576|Ga0247727_10391163 | All Organisms → cellular organisms → Bacteria | 1127 | Open in IMG/M |
| 3300031576|Ga0247727_10516445 | All Organisms → cellular organisms → Bacteria | 923 | Open in IMG/M |
| 3300031720|Ga0307469_12313118 | All Organisms → cellular organisms → Bacteria | 524 | Open in IMG/M |
| 3300031753|Ga0307477_10382640 | All Organisms → cellular organisms → Bacteria | 965 | Open in IMG/M |
| 3300031949|Ga0214473_11192580 | All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → unclassified Candidatus Tectomicrobia → Candidatus Tectomicrobia bacterium RIFCSPLOWO2_02_FULL_70_19 | 789 | Open in IMG/M |
| 3300031965|Ga0326597_12197794 | All Organisms → cellular organisms → Bacteria → FCB group | 504 | Open in IMG/M |
| 3300033811|Ga0364924_006330 | All Organisms → cellular organisms → Bacteria | 2110 | Open in IMG/M |
| 3300033814|Ga0364930_0120019 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 899 | Open in IMG/M |
| 3300034643|Ga0370545_038622 | All Organisms → cellular organisms → Bacteria | 889 | Open in IMG/M |
| 3300034681|Ga0370546_030763 | All Organisms → cellular organisms → Bacteria | 761 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 28.49% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 17.74% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 17.20% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 9.14% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 5.91% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 4.84% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.76% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 2.69% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 2.15% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.08% |
| Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 1.08% |
| Biofilm | Environmental → Terrestrial → Cave → Unclassified → Unclassified → Biofilm | 1.08% |
| Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 1.08% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.54% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 0.54% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 0.54% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.54% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil | 0.54% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.54% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.54% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300002557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_20cm | Environmental | Open in IMG/M |
| 3300002908 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_40cm | Environmental | Open in IMG/M |
| 3300002911 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_2_20cm | Environmental | Open in IMG/M |
| 3300002914 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm | Environmental | Open in IMG/M |
| 3300004022 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqA_D1 | Environmental | Open in IMG/M |
| 3300004139 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF230 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005178 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 | Environmental | Open in IMG/M |
| 3300005180 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 | Environmental | Open in IMG/M |
| 3300005181 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 | Environmental | Open in IMG/M |
| 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Environmental | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005447 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 | Environmental | Open in IMG/M |
| 3300005450 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131 | Environmental | Open in IMG/M |
| 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
| 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
| 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
| 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
| 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Environmental | Open in IMG/M |
| 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Environmental | Open in IMG/M |
| 3300005552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 | Environmental | Open in IMG/M |
| 3300005555 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 | Environmental | Open in IMG/M |
| 3300005556 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 | Environmental | Open in IMG/M |
| 3300005558 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 | Environmental | Open in IMG/M |
| 3300005568 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 | Environmental | Open in IMG/M |
| 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Host-Associated | Open in IMG/M |
| 3300006031 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100 | Environmental | Open in IMG/M |
| 3300006034 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105 | Environmental | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006791 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102 | Environmental | Open in IMG/M |
| 3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
| 3300006846 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Host-Associated | Open in IMG/M |
| 3300006847 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Host-Associated | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009700 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG | Environmental | Open in IMG/M |
| 3300010099 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_40_2_16_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010124 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_40_5_4_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010126 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_40_2_0_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010127 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_40_2_8_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010133 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_40_5_8_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010142 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_40_2_4_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010329 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_11112015 | Environmental | Open in IMG/M |
| 3300010337 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09082015 | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300011413 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT231_2 | Environmental | Open in IMG/M |
| 3300011429 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT600_2 | Environmental | Open in IMG/M |
| 3300012175 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT399_2 | Environmental | Open in IMG/M |
| 3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012285 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012350 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012355 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaG | Environmental | Open in IMG/M |
| 3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012373 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_2_0_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012380 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_2_0_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012383 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_5_4_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012393 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_5_0_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012395 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_2_8_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012399 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_5_24_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012402 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_5_8_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012403 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_2_8_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012406 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_5_4_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012409 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_2_16_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012410 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_5_16_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012972 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300014154 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09212015 | Environmental | Open in IMG/M |
| 3300014157 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300014166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09182015 | Environmental | Open in IMG/M |
| 3300015053 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015054 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015356 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300015358 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300015359 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09182015 | Environmental | Open in IMG/M |
| 3300017654 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300017656 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_11112015 | Environmental | Open in IMG/M |
| 3300018007 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_5 | Environmental | Open in IMG/M |
| 3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300019233 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019249 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019259 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300020170 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300021073 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_b1 redo | Environmental | Open in IMG/M |
| 3300021086 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300021951 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300024275 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK15 | Environmental | Open in IMG/M |
| 3300024330 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026277 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_2_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026295 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026296 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026298 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026300 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026306 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102 (SPAdes) | Environmental | Open in IMG/M |
| 3300026323 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 (SPAdes) | Environmental | Open in IMG/M |
| 3300026324 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 (SPAdes) | Environmental | Open in IMG/M |
| 3300026331 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 (SPAdes) | Environmental | Open in IMG/M |
| 3300026332 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 (SPAdes) | Environmental | Open in IMG/M |
| 3300026334 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 (SPAdes) | Environmental | Open in IMG/M |
| 3300026335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 (SPAdes) | Environmental | Open in IMG/M |
| 3300026527 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 (SPAdes) | Environmental | Open in IMG/M |
| 3300026529 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 (SPAdes) | Environmental | Open in IMG/M |
| 3300026532 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 (SPAdes) | Environmental | Open in IMG/M |
| 3300026536 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 (SPAdes) | Environmental | Open in IMG/M |
| 3300026540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 (SPAdes) | Environmental | Open in IMG/M |
| 3300027513 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT890 (SPAdes) | Environmental | Open in IMG/M |
| 3300027875 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027961 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_30_40 (SPAdes) | Environmental | Open in IMG/M |
| 3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300031226 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 10_S | Environmental | Open in IMG/M |
| 3300031421 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_195 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031576 | Biofilm microbial communities from Wishing Well Cave, Virginia, United States - WW16-25 | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
| 3300031949 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT98D197 | Environmental | Open in IMG/M |
| 3300031965 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT100D185 | Environmental | Open in IMG/M |
| 3300033811 | Sediment microbial communities from East River floodplain, Colorado, United States - 28_j17 | Environmental | Open in IMG/M |
| 3300033814 | Sediment microbial communities from East River floodplain, Colorado, United States - 55_j17 | Environmental | Open in IMG/M |
| 3300034643 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_120 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300034681 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_121 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI25381J37097_10041221 | 3300002557 | Grasslands Soil | GLESLIAASAPPLGADEPALRERWKEAAVKLVLEGVAAR* |
| JGI25382J43887_104246311 | 3300002908 | Grasslands Soil | DPHLAAAQALILMIGYLSMEAVVAASARPLGGDEPALRERWREAAVDLVVAGVSAR* |
| JGI25390J43892_100205562 | 3300002911 | Grasslands Soil | AQALVLMVAYLQLELLIAASAAPLGADEPSLRERWKEAAVDLVVNGVRAVSS* |
| JGI25390J43892_101224531 | 3300002911 | Grasslands Soil | VLMVAYLQLESLIAASAAPLGADEPTLRERWKEAAVDLVVNGVRAVSS* |
| JGI25617J43924_102260832 | 3300002914 | Grasslands Soil | ILMVGYLQLESVVAASAPPLGAHEQSLRQRWKEAAVQLVVAGVATR* |
| Ga0055432_101359501 | 3300004022 | Natural And Restored Wetlands | LVLMLGYLRLEPMIAASAPPLTGDAPALRARWMRAAVDLYVAGVRAG* |
| Ga0058897_109277362 | 3300004139 | Forest Soil | VLMVGFLNLESVVSASAPSLAVDEPALRQRWREGATRLLVAGVAAR* |
| Ga0066688_106778072 | 3300005178 | Soil | LVLMVAYLGLESLIATSAPPLGADEPALRERWKEAAVRLVLDGVAAH* |
| Ga0066685_108650431 | 3300005180 | Soil | AQALILMVGYLRLESLIAASAPPLGADEPALRERWRKSAVDLVVNGVRSG* |
| Ga0066678_106144731 | 3300005181 | Soil | AAAQALILMVGYLNMEAVVAASARPLGADEPSLRERWREAAVDLVVAGVSTS* |
| Ga0070694_1013560721 | 3300005444 | Corn, Switchgrass And Miscanthus Rhizosphere | VGYLRHEAVIAASAPSLIADEPALRERWLKAVVDLVVNGVRA* |
| Ga0070708_1003242332 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | DPHLAAAQALILMVGYLSMEAVVAASARPLGGDEPALRERWREAAVDLVVAGVSAR* |
| Ga0066689_103920252 | 3300005447 | Soil | LGLESLIAVSAPPLGADEPALRERWKDAAVRLVLDGVATRPTSPTS* |
| Ga0066689_108219981 | 3300005447 | Soil | YLSMEAVIATSARPLGADEPSLRERWREAAVDLVVAGVSAG* |
| Ga0066682_100452122 | 3300005450 | Soil | QLESAIAASAPVLGADEPALRERWKEGAVSLIVNGVRAT* |
| Ga0070706_1018393441 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | MVGYLKLEELIAASAPPLGADEPALRERWKHAAVELVVNGVRVA* |
| Ga0070698_1022154632 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | HLTAAQALILMVGYLSMEAVIATSARPLGADEPSLRARWREAAVDLVVAGVSAS* |
| Ga0070699_1001641161 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | VLMIAYLQLESLIAASAAPLGADEPTLRQRWKQAAVDLVVNGVRAVSS* |
| Ga0070699_1010739232 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | HLAAAQALILMVGYLTMEAVVAASARPLGADEPSLRERWREAAVDLVVAGVSAS* |
| Ga0070697_1012220321 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | SLVLMVGYLGMESVIAASARPLGADEPALRERWKEAAVDLVVAGVAAR* |
| Ga0070693_1009025771 | 3300005547 | Corn, Switchgrass And Miscanthus Rhizosphere | VLMVGYLGMESVIAASARPLGADEPALRERWKNAAVELLVAGVAAR* |
| Ga0070704_1009660542 | 3300005549 | Corn, Switchgrass And Miscanthus Rhizosphere | AQALVLMVGYLRHEAVIAASAPSLIADEPALRERWLKAVVDLVVNGVRA* |
| Ga0066701_102753832 | 3300005552 | Soil | LIAASAPPLGSDEPALSRRWKEAAVRLVLEGVRAR* |
| Ga0066692_105317342 | 3300005555 | Soil | LMVAYLGLESLIAMSAPPLGADEPALRERWKEAAVRLVLDGIAAR* |
| Ga0066692_107866242 | 3300005555 | Soil | AQALILMVGYLSMEAVIATSARPLGADEPSLRERWREAAVDLVVAGVSAG* |
| Ga0066707_100847492 | 3300005556 | Soil | LIAASAAPLGADEPSLRERWKEAAVDLVVNGVRAVSS* |
| Ga0066698_104433942 | 3300005558 | Soil | YLGLEPLITASAPPLGADEPALRERWKEAAVRLVLQGVTAR* |
| Ga0066703_108863291 | 3300005568 | Soil | VAYLGLESLIAASAPPLGADEPALRERWKEAAVKLVLEGVRA* |
| Ga0068861_1020627781 | 3300005719 | Switchgrass Rhizosphere | VDPHLTAAQALILMVGYLNMESVVVASARPLGVDEPALRERWRDAAVDLVVAGVSAR* |
| Ga0066651_103057972 | 3300006031 | Soil | VGYLQLESAIAASAPVLGADEPALRERWKAGAVSLMVNGVRAT* |
| Ga0066656_100541122 | 3300006034 | Soil | MEAVIATSARPLGADEPSLRERWREAAVDLVVAGVSAG* |
| Ga0066656_109802241 | 3300006034 | Soil | DDLDPHLAAAQALILMVGYLSLEAVVAASARPLGADEPALRERWREAAVELVVGGVSAR* |
| Ga0070716_1004368392 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | LGLESLIAVSAPPLGADEPALRERWKDAAVRLVLEGVAAR* |
| Ga0066653_106927531 | 3300006791 | Soil | SMEAVIATSAPPLGADEPSLRERWREAAVDLVVAGVSAN* |
| Ga0066665_102779572 | 3300006796 | Soil | APPLGADEPALRERWKDAAVRLVLDGVATRPTSPTS* |
| Ga0066659_102015162 | 3300006797 | Soil | VLMVAYLGLESLIAASAAPLGADEPALRERWKDAAVRLVLDGVAAH* |
| Ga0066659_108826742 | 3300006797 | Soil | YLGLESLIAASAPPLGADEPALRERWKEAAVKLVLEGVRA* |
| Ga0075421_1009743812 | 3300006845 | Populus Rhizosphere | GYLAMEGVVAASARPLDEPGLRERWREAAVDLVVNGVRAA* |
| Ga0075430_1012243831 | 3300006846 | Populus Rhizosphere | MESVIATSARPLGADEPALRERWKEAAVELLVAGVAAR* |
| Ga0075431_1009683142 | 3300006847 | Populus Rhizosphere | YLAMEGVVAASARPLDEPALRERWREAAVDLVVNGVRAA* |
| Ga0075425_1010166771 | 3300006854 | Populus Rhizosphere | IAMSAAPLGADEPALRERWKEAAVRLVLDGVAAH* |
| Ga0075426_101506392 | 3300006903 | Populus Rhizosphere | VLMVGYLKLEELIAASAPPLGADEPALRERWKHAAVELVVNGVRVA* |
| Ga0075424_1019026482 | 3300006904 | Populus Rhizosphere | AAAQALILMIGYLSMEGVIAASARPLDEPVLGERWREAAVELVVNGVRAA* |
| Ga0099794_106975101 | 3300007265 | Vadose Zone Soil | LESVVAASAPPLGADEQSLRERWKEAAVQLVVAGVAAR* |
| Ga0066710_1021521971 | 3300009012 | Grasslands Soil | LVLMVAYLGLESLIAASAPPLGADEPALRERWKEAAVKLVLEGVRA |
| Ga0066710_1038720862 | 3300009012 | Grasslands Soil | ESAIAASAPVLGADEPALRERWKAGAVSLIVNGVRAT |
| Ga0099829_100287433 | 3300009038 | Vadose Zone Soil | VAYLGLESLIATSAPPLGADEPALRQRWKDAAVRLVLDGVAAH* |
| Ga0099829_100289143 | 3300009038 | Vadose Zone Soil | VAYLGLESLIATSAPPLGADEPALRQRWKDAAVRLVLDGVVAH* |
| Ga0099830_102120921 | 3300009088 | Vadose Zone Soil | AYLGLESLTAMSAAPLGADEPALRERWKEAAVRLVLDGVAAH* |
| Ga0099830_116824132 | 3300009088 | Vadose Zone Soil | MVAYLGLESLIATSAPPLGADEPALRQRWKDAAVRLVLYVVAAH* |
| Ga0099827_102626812 | 3300009090 | Vadose Zone Soil | QALVLMVGYLKLEDLVAASAPPLGADEPALRGRWKQGAVDLVLGGVAAR* |
| Ga0099827_119120082 | 3300009090 | Vadose Zone Soil | AAAQALILMVGYLNMEAVVAASARPLGADEPSLRERWREAAVDLVVAGVSAS* |
| Ga0111539_109615182 | 3300009094 | Populus Rhizosphere | LMVGYLNMESVVVASARPLGVDEPALRERWRDAAVDLVVAGVSAR* |
| Ga0066709_1017741902 | 3300009137 | Grasslands Soil | LVLMVAYLGLESLIAASAPPLGADEPALRERWKEAAVKLVLEGVRA* |
| Ga0114129_110334652 | 3300009147 | Populus Rhizosphere | LVLMVGYLGMESAIAASARPLGADEPALRERWKEAAVDLVVAGVAAR* |
| Ga0075423_121880192 | 3300009162 | Populus Rhizosphere | ALILMIGYLSMEGVIAASARPLDEPVLGERWREAAVELVVNGVRAA* |
| Ga0116217_107515411 | 3300009700 | Peatlands Soil | LAYLALEPLVATSAAALGGDEPGLATRWKDAAVRLVVEGLAAR* |
| Ga0127450_10773852 | 3300010099 | Grasslands Soil | LESAIAASAPVLGADEPALRERWKEGAVSLIVNGVRAT* |
| Ga0127498_10435592 | 3300010124 | Grasslands Soil | VVAYLQLESLIAASAAPLGADEPTLRERWKEAAVDLVVNGVRAVSS* |
| Ga0127482_10641491 | 3300010126 | Grasslands Soil | IAASAPVLGADEPALRERWKEGAVSLIVNGVRAT* |
| Ga0127489_11201101 | 3300010127 | Grasslands Soil | GYLQLESAIAASAPVLGADEPALRERWKEGAVSLIVNGVRAT* |
| Ga0127459_11413761 | 3300010133 | Grasslands Soil | LESLIAASAAPLGSDEPALSRRWKDAAVRLMIEGVAAPRP* |
| Ga0127459_11787141 | 3300010133 | Grasslands Soil | LLVGYLQLESAIAASTPVLGGDEPALRERWKEGAVSLVVNGVRAT* |
| Ga0127483_10626692 | 3300010142 | Grasslands Soil | VGYLNMEAVVAASARPLGADEPSLRERWREAAVDLVVAGVSAS* |
| Ga0134111_102123351 | 3300010329 | Grasslands Soil | MEAVVAASARPLGADEPSLRERWREAAVDLVVAGVSAG* |
| Ga0134062_105422692 | 3300010337 | Grasslands Soil | GLESLIAASAPPLGADEPALRERWKEAAVKLVLEGVRA* |
| Ga0137392_107787432 | 3300011269 | Vadose Zone Soil | SLIAMSAAPLGADEPALRERWKEAAVRLVLDGIAAR* |
| Ga0137393_100389563 | 3300011271 | Vadose Zone Soil | LIAMSAPPLGADEPALRERWKDAAVRLVLDGVAAR* |
| Ga0137333_10039281 | 3300011413 | Soil | IATSARPLGSDEPALAQRWKDAALRLVLEGVSAR* |
| Ga0137455_11432671 | 3300011429 | Soil | TAAQGLVLMVGYLGMESAIAASAGPLCADESALRERWKAAAVDLVVAGVAAR* |
| Ga0137321_10856161 | 3300012175 | Soil | VDPHLTAAQALMLMVGYLNMESVVAASARPLGADEPALRERWRDAAVDLVVAGVSAG* |
| Ga0137364_113571752 | 3300012198 | Vadose Zone Soil | VGYLGMESVIAASARPLGADEPALRERWRQAAVELVVAGVAAP* |
| Ga0137383_100786031 | 3300012199 | Vadose Zone Soil | LESLIAMSAPPLGADEPALRERWKEAAVRLVLDGVAAH* |
| Ga0137383_108705312 | 3300012199 | Vadose Zone Soil | LGLESLIAASAPPLGADEPALRERWKEAAVKLVLEGVRA* |
| Ga0137383_111546682 | 3300012199 | Vadose Zone Soil | VAYLGLESLIAMSAPPLGADEPALRERWKEAAVRLVLDGIAAR* |
| Ga0137382_100801012 | 3300012200 | Vadose Zone Soil | MVAYLGLESLIAASAPPLGADEPALRERWKEAAVRLVLDGVAAH* |
| Ga0137399_116338132 | 3300012203 | Vadose Zone Soil | DDRDPHLAAAQALILMVGYLSMEAVIATSARPLGADEPSLRERWREAAVDLVVAGVSAS* |
| Ga0137380_106228581 | 3300012206 | Vadose Zone Soil | ILMVGYLSLEAVVAASARPLGADEPALRERWREAAVELVVGGVSAR* |
| Ga0137381_107212932 | 3300012207 | Vadose Zone Soil | GYLKLEELIAASAPPLGADEPALRERWKHAAVELVVNGVRVA* |
| Ga0137381_112661362 | 3300012207 | Vadose Zone Soil | LTAAQALILMVGYLSMEAVVAASARPLGADEPALRERWREAAVDLVVAGVSAS* |
| Ga0137376_105454922 | 3300012208 | Vadose Zone Soil | VLMVAYLGLESLIATSAPPLGADEPALRERWKDAAVRLVLEGVAAR* |
| Ga0137376_112662762 | 3300012208 | Vadose Zone Soil | VLMVAYLGLESLIAASAPPLGADEPALRERWKEAAVKLVLEGVRA* |
| Ga0137376_114631681 | 3300012208 | Vadose Zone Soil | MEAVIAASARPLGADEPALRERWRQTAIDLVVAGVAAR* |
| Ga0137378_105569931 | 3300012210 | Vadose Zone Soil | LIAASAAPLGADEPALRERWKDAAVRLVLDGVAAH* |
| Ga0137370_101297842 | 3300012285 | Vadose Zone Soil | AAQALILMVGYLSMEAVVAASARPLGADEPSLRERWRDAAVDLVVAGVSAS* |
| Ga0137372_107559851 | 3300012350 | Vadose Zone Soil | EPLIAMSAAPLGADEPALRERWKDAAVTLVLEGVTS* |
| Ga0137372_109902331 | 3300012350 | Vadose Zone Soil | AYLGLESLIATSAPPLGADEPALRERWKDAAVRLVLEGVAAR* |
| Ga0137386_108911122 | 3300012351 | Vadose Zone Soil | LESLIAASAPPLGSDEPALSRRWKEAAVRLVLEGVAAR* |
| Ga0137369_107368242 | 3300012355 | Vadose Zone Soil | YLGMESAIAASARPLGADEPALRERWKEAAVELVVAGVAAR* |
| Ga0137385_103155092 | 3300012359 | Vadose Zone Soil | MVAYLGLESLIAASAPPLGADEPALRERWKQGAVKLVLEGIAAR* |
| Ga0134042_12027641 | 3300012373 | Grasslands Soil | LLVGYLQLESAIAASAPVLGADEPALRERWKEGAVSLIVNGVRAT* |
| Ga0134047_10980232 | 3300012380 | Grasslands Soil | AIAASAPVLGADEPALRERWKEGAVSLIVNGVRAT* |
| Ga0134047_11987862 | 3300012380 | Grasslands Soil | LLVGYLQLESAIAASAPVLGADEPALRERWKAGAVSLMVNGVRAT* |
| Ga0134033_10442381 | 3300012383 | Grasslands Soil | LMVAYLGLESLIATSAAPLGADEPALRERWKEAAVRLVLDGVAAH* |
| Ga0134052_10996502 | 3300012393 | Grasslands Soil | ASAAPLGSDEPALSRRWKDAAVRLMIEGVAAPRP* |
| Ga0134044_13375742 | 3300012395 | Grasslands Soil | ILMVGYLSMEAVIATSARPLGADEPSLRERWREAAVDLVVAGVSAS* |
| Ga0134061_13377302 | 3300012399 | Grasslands Soil | VGYLGLESLIAASAAPLGGDEPALSRRWKDAAVRLMIEGVAAPRP* |
| Ga0134059_11206642 | 3300012402 | Grasslands Soil | AYLQLESLIAASAAPLGADEPTLRERWKEAAVDLVVNGVRAVSS* |
| Ga0134049_11480292 | 3300012403 | Grasslands Soil | LMVGYLNMEAVVAASARPLGADEPSLRERWREAAVDLVVAGVSAS* |
| Ga0134049_13205842 | 3300012403 | Grasslands Soil | AAAQALILMVGYLSMEAVIATSARPLGADEPSLRERWREAAVDLVVAGVSAS* |
| Ga0134053_13227842 | 3300012406 | Grasslands Soil | LMVGYLGLESLIAASAAPLGSDEPALSRRWKDAAVRLMIEGVAAPRP* |
| Ga0134045_14624271 | 3300012409 | Grasslands Soil | LILMVGYLNMEAVVAASARPLGADEPSLRERWREAAVDLVVAGVSTS* |
| Ga0134060_11442242 | 3300012410 | Grasslands Soil | VLMVAYLGLESLIAMSAAPLGADEPALRERWKEAAVRLVLDGVAAH* |
| Ga0137395_107599832 | 3300012917 | Vadose Zone Soil | LEELIAASAPPLGADEPALRERWKHAAVELVVNGVRVA* |
| Ga0137419_100402033 | 3300012925 | Vadose Zone Soil | VAYLGLESLIAMSAPSLSADEPALRERWKEAAVRLVLDGIATR* |
| Ga0137419_101345971 | 3300012925 | Vadose Zone Soil | VAYLGLESLIAMSAPSLSADEPALRERWKEAAVRLVLDGIAAR* |
| Ga0137419_101369401 | 3300012925 | Vadose Zone Soil | ESLIAMSAPPLGADEPALRERWKEAAVRLVLEGITAR* |
| Ga0137419_102341231 | 3300012925 | Vadose Zone Soil | AAQALILMVGYLSMETVIATSARPLGADEPSLRERWREAAVDLVVAGVSAS* |
| Ga0137416_113909181 | 3300012927 | Vadose Zone Soil | LIAASAPPLGSDEPALSLRWKEAAVRLVLEGVRAR* |
| Ga0137416_117420041 | 3300012927 | Vadose Zone Soil | MVGYLGMESVIAASARPLGADEPALRERWKEAAVDLVVAGVAAR* |
| Ga0137404_114716542 | 3300012929 | Vadose Zone Soil | LVLMVAYLGLESLIAMSAAPLGADEPALRERWKEAAVRLVLDGIAAR* |
| Ga0137407_109528931 | 3300012930 | Vadose Zone Soil | LDPHLAAAQALILMVGYLSMESVIATSARPLGADEPSLRARWREAAVDLVVAGVSAS* |
| Ga0134077_102523891 | 3300012972 | Grasslands Soil | PHLAAAQALILMVGYLSMEAVIATSARPLGADEPSLRERWREAAVDLVVAGVSAG* |
| Ga0134075_100307493 | 3300014154 | Grasslands Soil | AQALILMVGYLNMEAVVAASARPLGADEPSLRERWREAAVDLVVAGVSAG* |
| Ga0134078_102566541 | 3300014157 | Grasslands Soil | DDLDPHLAAAQALILMVGYLSMEAVVAASARPLGADEPSLRERWRDAAVDLVVAGVSAS* |
| Ga0134079_101480422 | 3300014166 | Grasslands Soil | DPHLAAAQALILMVGYLSMEAVIATSARPLGADEPSLRERWREAAVDLVVAGVSAS* |
| Ga0137405_13113372 | 3300015053 | Vadose Zone Soil | MVAYLGLESLIAMSAAPLGADEPALRERWKEAAVRLVLDGIAAARL |
| Ga0137405_133660119 | 3300015053 | Vadose Zone Soil | VAHAMSAAPLGADEPALRERWKEGAVASLVLDGVAAH* |
| Ga0137420_10512722 | 3300015054 | Vadose Zone Soil | VDPHLAAAQALILMVGYLSMEAVIATSARPLGADEPSLRERWREAAVDLVVAGVSAS* |
| Ga0137420_10905761 | 3300015054 | Vadose Zone Soil | MVAYLGLESLIAMSAAPLGADEPALRERWKEAAVRLVLDGIAAR* |
| Ga0137420_10971101 | 3300015054 | Vadose Zone Soil | SAWKPLVGYLSMEAVIATSARPLGADEPSLRERWREAAVDLVVAGVSAS* |
| Ga0137420_11248891 | 3300015054 | Vadose Zone Soil | SFDPLMVGYLSMEAVIATSARPLGADEPSLRERWREAAVDLVVAGVSAS* |
| Ga0137420_11248902 | 3300015054 | Vadose Zone Soil | AAQALILMVGYLSMEAVIATSARPLGADEPSLRERWREAAVDLVVAGVSAS* |
| Ga0137420_14943133 | 3300015054 | Vadose Zone Soil | MESVIAASARPLGADESALRERWKEAAVDLVVAGVAAR* |
| Ga0134073_101214311 | 3300015356 | Grasslands Soil | LGLESLIATSAPPLGADEPALRERWKEAAVRLVLDGVAAH* |
| Ga0134089_100151191 | 3300015358 | Grasslands Soil | ESLIAMSAAPLGADEPALRERWKEAAVRLVLDGVAAH* |
| Ga0134089_101125942 | 3300015358 | Grasslands Soil | ILMVGYLSMEAVIATSARPLGADEPSLRERWREAAVDLVVAGVSAG* |
| Ga0134085_103294931 | 3300015359 | Grasslands Soil | LESLIAASAPPLGADEPALRERWKDSAVKLVLEGVAAR* |
| Ga0134069_10172781 | 3300017654 | Grasslands Soil | GVAASARPLGADEPSLRERWREAAVDLVVAGVSAS |
| Ga0134069_13742482 | 3300017654 | Grasslands Soil | VLMVAYLGLESLIAMSAGPLSADEPALRERWKDAAVRLVLDGVAAH |
| Ga0134112_100859531 | 3300017656 | Grasslands Soil | QALVLMVAYLGLESLIAASAPPLGADEPTLRERWKQAAVNLVLEGVSAR |
| Ga0187805_104796851 | 3300018007 | Freshwater Sediment | LMVGFLNLESVVSASAPSLAVDEPALRQRWREGATRLLVAGVAAR |
| Ga0066655_102114342 | 3300018431 | Grasslands Soil | AASAAPLGSDEPALSRRWKDAAVRLMIEGVAAPRP |
| Ga0066662_107166791 | 3300018468 | Grasslands Soil | GLESLIAMSAPPLGADEPALRERWKEAAVRLVLDGIAAR |
| Ga0066662_123684851 | 3300018468 | Grasslands Soil | GYLQLESVVAASAPPLGADEPTLRERWKEAAVQLVVAGVAAR |
| Ga0066669_109022932 | 3300018482 | Grasslands Soil | LAAAQALILMVGYLSMEAVVAASARPLGADEPALRERWREAAVDLVVAGVSAR |
| Ga0184645_11327581 | 3300019233 | Groundwater Sediment | LILMVGYLSMESVIAASARPLGADEPALRERWREAAVDLVVAGVSAG |
| Ga0184648_13874531 | 3300019249 | Groundwater Sediment | EPLIAASAPPLGADEQTLRVRWRHAAVDLVVSGVAAPAG |
| Ga0184646_10034632 | 3300019259 | Groundwater Sediment | LILMVGYLSMESVVAASARPLGADEPALRERWREAAVDLVVAGVSAG |
| Ga0179594_102596642 | 3300020170 | Vadose Zone Soil | PHLAAAQALILMVGYLSMEAVIATSARPLGADEPSLRERWRDAAVDLVVAGVSAG |
| Ga0179594_103632762 | 3300020170 | Vadose Zone Soil | VVAASARPLGADEPALRERWREAAVELVVGGVSAR |
| Ga0210378_100771221 | 3300021073 | Groundwater Sediment | LMVGYLSMESVVAASARPLGADEPALRERWREAAVDLVVAGVSAG |
| Ga0179596_105364922 | 3300021086 | Vadose Zone Soil | LGLESLIAMSAAPLGADEPALRERWKEAAVRLVLDGIAAR |
| Ga0222624_10262742 | 3300021951 | Groundwater Sediment | LMIGYLGMESAIAASARPLGADEPALRERWKAAAVDLVVAGVAAR |
| Ga0247674_10457561 | 3300024275 | Soil | VLMVAYLGLESLIAVSAPPLGADEPALRERWKDAAVRLVLEGVAAR |
| Ga0137417_10271581 | 3300024330 | Vadose Zone Soil | AVVAASARPLGADEPALRERWREAAVELVVGGVSAR |
| Ga0137417_11213362 | 3300024330 | Vadose Zone Soil | EAVVAASARPLGADEPALRERWREAAVELVVGGVSAR |
| Ga0207693_113336801 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | SMEAVVAASARPLGADEPSLRERWRDAAVDLVVAGVSAS |
| Ga0209350_10251651 | 3300026277 | Grasslands Soil | AAAQALVLMVAYLGLESLIAASAPPLGADEPALRERWKEAAVKLVLEGVRA |
| Ga0209234_10105723 | 3300026295 | Grasslands Soil | LAAAQALILMIGYLSMEAVVAASARPLGADEPALRERWRQAAVDLVVAGVSVR |
| Ga0209235_10052391 | 3300026296 | Grasslands Soil | ALVLMVAYLGLESLIAASAPPLGADEPALRARWKEAAVKLVLEGVRA |
| Ga0209236_10244491 | 3300026298 | Grasslands Soil | QALVLMVAYLQLESLIAASAAPLGADEPTLRERWQAAAVDLVVNGVRAVSS |
| Ga0209027_10351632 | 3300026300 | Grasslands Soil | LGLESLIATSAPPLGADEPALRERWKDAAVRLVLDGVAAH |
| Ga0209468_11269222 | 3300026306 | Soil | LESAIAASAPVLGADEPALRERWKEGAVSLIVNGVRSS |
| Ga0209468_12059851 | 3300026306 | Soil | NLEPLIAANAPPLGADEPGLRDRWKEAAVKLVLEGVTAH |
| Ga0209472_10709331 | 3300026323 | Soil | AYLGLESLIAASAPPLGADEPALRERWKEAAVKLVLEGVRA |
| Ga0209470_12771161 | 3300026324 | Soil | AQALILMVGYLNMEAVVAASARPLGADEPSLRERWREAAVDLVVAGVSAG |
| Ga0209267_12395041 | 3300026331 | Soil | ESLIATSAPPLGADEPALRERWKEAAVRLVLDGVAAH |
| Ga0209803_12549111 | 3300026332 | Soil | LGLESLIAVSAPPLGADEPALRERWKDAAVRLVLDGVATRPTSPTS |
| Ga0209377_11750101 | 3300026334 | Soil | AYLGLESLIATSAPPLGADEPALRERWKDAAVRLVLDGVAAH |
| Ga0209804_11785071 | 3300026335 | Soil | LMVAYLGLESLIATSAPPLGADEPALRERWKEAAVRLVLDGVAAH |
| Ga0209059_11982821 | 3300026527 | Soil | LESLIATSAPPLGADEPALRERWKDAAVRLVLDGVAAH |
| Ga0209806_11906751 | 3300026529 | Soil | VLMVAYLGLESLIATSAPPLGADEPALRERWKEAAVRLVLDGVAAH |
| Ga0209160_12753421 | 3300026532 | Soil | VAYLGLESLIAMSAPPLGADEPALRERWKEAAVKLVLDGVSAH |
| Ga0209058_12416671 | 3300026536 | Soil | LGLESLIAMSAPPLGADEPSLRERWKEAAVRLILEGVATRQTPSTS |
| Ga0209376_11454172 | 3300026540 | Soil | GYLQLESAIAASAPVLGADEPALRERWKAGAVSLMVNGVRAT |
| Ga0208685_10638752 | 3300027513 | Soil | AAQALMLMVGYLNMESVVAASARPLGADEPALRQRWRDAAVDLVVAGVSAS |
| Ga0209283_106750281 | 3300027875 | Vadose Zone Soil | AYLQLESLIAASAAPLGADEPTLRDRWKEAAVDLVVNGVRAVSS |
| Ga0209488_108103962 | 3300027903 | Vadose Zone Soil | MMDENGMPIAASAPSLGSDEPALSRRWKDAAVRLVLEGVAAR |
| Ga0209853_10857771 | 3300027961 | Groundwater Sand | LMVGYLSMESVVAASARPLGADEPALRERWREAAVDLVVTGVSAS |
| Ga0209853_11270211 | 3300027961 | Groundwater Sand | ALVLMVAYLGLESLIAASAPPLGADEPALRERWKEAAVQLVLEGVATR |
| Ga0137415_109376361 | 3300028536 | Vadose Zone Soil | LIAASAPPLGSDEPALSLRWKEAAVRLVLEGVRAR |
| Ga0307497_101333451 | 3300031226 | Soil | TAAQALMLMVGYLSMEAVVAASARPLGADEPSLRERWRDAAVDLVVAGVRAS |
| Ga0308194_100026672 | 3300031421 | Soil | GYLGMESAIAASARPLGADEPALRERWKEAAVDLVVAGVAAR |
| Ga0308194_100097091 | 3300031421 | Soil | QALILMVGYLSMEAVIATSARPLGADEPSLRARWREAAVDLVVAGVSAG |
| Ga0308194_100372841 | 3300031421 | Soil | LILMVGYLSMEAVIATSARPLGADEPSLRARWREAAVDLVVAGVSAS |
| Ga0247727_103911632 | 3300031576 | Biofilm | ALVLMVGYLGLESAIAASAPPLGADEPALRRRWQDAAVELVVNGVRAN |
| Ga0247727_105164451 | 3300031576 | Biofilm | MVGYLGMESAIAASARPLGADEPALRERWKEAAVDLVVAGVAAR |
| Ga0307469_123131182 | 3300031720 | Hardwood Forest Soil | MEAVIATSARPLGADEPSLRARWREAAVDLVVAGVSAS |
| Ga0307477_103826402 | 3300031753 | Hardwood Forest Soil | HLTAAQALVLMVGFLNLESVVSASAPALAVDEPALRQRWREGATRLLVAGVAAH |
| Ga0214473_111925801 | 3300031949 | Soil | GYLRLESLIAASAAPLGADEPALRGRWRDAAVELVVNGVRAA |
| Ga0326597_121977942 | 3300031965 | Soil | MIGYLKLESLIAASAPSLAADEPALRERWRKSAVELVVNGVRAG |
| Ga0364924_006330_1974_2108 | 3300033811 | Sediment | MIGYLKLESLIAASAPPLAADEPALRERWRRSAVELVVNGVKAG |
| Ga0364930_0120019_732_866 | 3300033814 | Sediment | MVGYLSMEAVVATSARPLGADEPSLRERWRQAAVDLVVAGVSAS |
| Ga0370545_038622_753_887 | 3300034643 | Soil | MVGYLSMEAVIATSARPLGADEPSLRERWREAAVDLVVAGVSVS |
| Ga0370546_030763_621_737 | 3300034681 | Soil | MESAIAASARPLGADEPALRERWKEAAVDLVVAGVAAR |
| ⦗Top⦘ |