NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F030149

Metagenome / Metatranscriptome Family F030149

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F030149
Family Type Metagenome / Metatranscriptome
Number of Sequences 186
Average Sequence Length 132 residues
Representative Sequence MFVPVKDKLDKLVALTPDDQEKLSYYKSIVPAMIANCHKAHQTIPGYESCKPEIEAFKWFDGINIPVHGYIDLKGDKVIIEDKCKMPRRGIVKKDGTRSWFPGKLPDRPSPYNLLQVDFYWSVFEVPVYLC
Number of Associated Samples 161
Number of Associated Scaffolds 186

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 93.55 %
% of genes near scaffold ends (potentially truncated) 97.85 %
% of genes from short scaffolds (< 2000 bps) 81.72 %
Associated GOLD sequencing projects 139
AlphaFold2 3D model prediction No

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (90.323 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous
(26.882 % of family members)
Environment Ontology (ENVO) Unclassified
(70.430 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Saline → Water (saline)
(75.806 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 27.48%    β-sheet: 23.66%    Coil/Unstructured: 48.85%
Feature Viewer
Powered by Feature Viewer


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 186 Family Scaffolds
PF01381HTH_3 69.89
PF01726LexA_DNA_bind 15.05
PF137592OG-FeII_Oxy_5 0.54



 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms99.46 %
UnclassifiedrootN/A0.54 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000117|DelMOWin2010_c10092026All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → unclassified Acidimicrobiia → Acidimicrobiia bacterium1141Open in IMG/M
3300000117|DelMOWin2010_c10115918All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium947Open in IMG/M
3300000117|DelMOWin2010_c10116226All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium945Open in IMG/M
3300000947|BBAY92_10210917All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium505Open in IMG/M
3300000949|BBAY94_10068509All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium981Open in IMG/M
3300002482|JGI25127J35165_1106364All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium562Open in IMG/M
3300005732|Ga0076920_124694All Organisms → Viruses → Predicted Viral2073Open in IMG/M
3300005738|Ga0076926_120421All Organisms → Viruses → Predicted Viral2080Open in IMG/M
3300005933|Ga0075118_10021774All Organisms → cellular organisms → Bacteria → Proteobacteria2606Open in IMG/M
3300006025|Ga0075474_10104564All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium912Open in IMG/M
3300006025|Ga0075474_10120664All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium836Open in IMG/M
3300006026|Ga0075478_10238635All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium547Open in IMG/M
3300006193|Ga0075445_10291862All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium552Open in IMG/M
3300006352|Ga0075448_10086815All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → unclassified Acidimicrobiia → Acidimicrobiia bacterium986Open in IMG/M
3300006467|Ga0099972_12355773All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium626Open in IMG/M
3300006735|Ga0098038_1155258All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium760Open in IMG/M
3300006802|Ga0070749_10271848All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium955Open in IMG/M
3300006868|Ga0075481_10328363All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium530Open in IMG/M
3300006919|Ga0070746_10181323All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → unclassified Acidimicrobiia → Acidimicrobiia bacterium1012Open in IMG/M
3300006920|Ga0070748_1314336All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium556Open in IMG/M
3300006925|Ga0098050_1069604All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → unclassified Acidimicrobiia → Acidimicrobiia bacterium912Open in IMG/M
3300006929|Ga0098036_1004315All Organisms → Viruses → Predicted Viral4880Open in IMG/M
3300006990|Ga0098046_1075678All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium762Open in IMG/M
3300007231|Ga0075469_10046425All Organisms → Viruses → Predicted Viral1323Open in IMG/M
3300007345|Ga0070752_1205555All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium783Open in IMG/M
3300007346|Ga0070753_1028838All Organisms → cellular organisms → Bacteria2395Open in IMG/M
3300007346|Ga0070753_1135253All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium941Open in IMG/M
3300007538|Ga0099851_1326656All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium538Open in IMG/M
3300007539|Ga0099849_1137175All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium953Open in IMG/M
3300007539|Ga0099849_1269818All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium621Open in IMG/M
3300007541|Ga0099848_1184971All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium754Open in IMG/M
3300007542|Ga0099846_1119954All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium960Open in IMG/M
3300007640|Ga0070751_1187712All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → unclassified Acidimicrobiia → Acidimicrobiia bacterium809Open in IMG/M
3300007863|Ga0105744_1052637All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → unclassified Acidimicrobiia → Acidimicrobiia bacterium1005Open in IMG/M
3300008012|Ga0075480_10423992All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium652Open in IMG/M
3300009027|Ga0102957_1325252All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium565Open in IMG/M
3300009071|Ga0115566_10246076All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → unclassified Acidimicrobiia → Acidimicrobiia bacterium1072Open in IMG/M
3300009449|Ga0115558_1357799All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → unclassified Acidimicrobiia → Acidimicrobiia bacterium574Open in IMG/M
3300009481|Ga0114932_10653862All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → unclassified Acidimicrobiia → Acidimicrobiia bacterium613Open in IMG/M
3300009496|Ga0115570_10088516All Organisms → cellular organisms → Bacteria1536Open in IMG/M
3300009496|Ga0115570_10312223All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → unclassified Acidimicrobiia → Acidimicrobiia bacterium680Open in IMG/M
3300009507|Ga0115572_10154023All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → unclassified Acidimicrobiia → Acidimicrobiia bacterium1347Open in IMG/M
3300009705|Ga0115000_10259919All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium1131Open in IMG/M
3300010296|Ga0129348_1017471All Organisms → cellular organisms → Bacteria2612Open in IMG/M
3300010368|Ga0129324_10044701All Organisms → cellular organisms → Bacteria2047Open in IMG/M
3300011013|Ga0114934_10015443All Organisms → cellular organisms → Bacteria4323Open in IMG/M
3300011013|Ga0114934_10124126All Organisms → Viruses → Predicted Viral1237Open in IMG/M
3300011118|Ga0114922_10203701All Organisms → cellular organisms → Bacteria1669Open in IMG/M
3300011118|Ga0114922_10210571All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → unclassified Acidimicrobiia → Acidimicrobiia bacterium1638Open in IMG/M
3300012920|Ga0160423_10101322All Organisms → cellular organisms → Bacteria2037Open in IMG/M
3300012920|Ga0160423_10111502All Organisms → cellular organisms → Bacteria1930Open in IMG/M
3300013010|Ga0129327_10044060All Organisms → cellular organisms → Bacteria2250Open in IMG/M
3300013010|Ga0129327_10163039All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → unclassified Acidimicrobiia → Acidimicrobiia bacterium1114Open in IMG/M
3300016734|Ga0182092_1088791All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium561Open in IMG/M
3300017708|Ga0181369_1076397All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium718Open in IMG/M
3300017710|Ga0181403_1060357All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → unclassified Acidimicrobiia → Acidimicrobiia bacterium790Open in IMG/M
3300017713|Ga0181391_1024980All Organisms → cellular organisms → Bacteria1473Open in IMG/M
3300017713|Ga0181391_1140979All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium535Open in IMG/M
3300017720|Ga0181383_1122458All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium698Open in IMG/M
3300017724|Ga0181388_1045804All Organisms → Viruses → Predicted Viral1060Open in IMG/M
3300017725|Ga0181398_1003433All Organisms → cellular organisms → Bacteria4292Open in IMG/M
3300017728|Ga0181419_1078788All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium826Open in IMG/M
3300017732|Ga0181415_1045350All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium1003Open in IMG/M
3300017733|Ga0181426_1094727All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium599Open in IMG/M
3300017734|Ga0187222_1117839All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium596Open in IMG/M
3300017738|Ga0181428_1068020All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → unclassified Acidimicrobiia → Acidimicrobiia bacterium831Open in IMG/M
3300017741|Ga0181421_1065614All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium956Open in IMG/M
3300017741|Ga0181421_1112975All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium705Open in IMG/M
3300017741|Ga0181421_1138732All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → unclassified Acidimicrobiia → Acidimicrobiia bacterium629Open in IMG/M
3300017742|Ga0181399_1070361All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → unclassified Acidimicrobiia → Acidimicrobiia bacterium890Open in IMG/M
3300017744|Ga0181397_1109774All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → unclassified Acidimicrobiia → Acidimicrobiia bacterium721Open in IMG/M
3300017745|Ga0181427_1022039All Organisms → Viruses → Predicted Viral1589Open in IMG/M
3300017748|Ga0181393_1000230Not Available20866Open in IMG/M
3300017751|Ga0187219_1110394All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → unclassified Acidimicrobiia → Acidimicrobiia bacterium825Open in IMG/M
3300017757|Ga0181420_1063595All Organisms → cellular organisms → Bacteria1169Open in IMG/M
3300017758|Ga0181409_1043975All Organisms → Viruses → Predicted Viral1388Open in IMG/M
3300017759|Ga0181414_1083634All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → unclassified Acidimicrobiia → Acidimicrobiia bacterium844Open in IMG/M
3300017760|Ga0181408_1066537All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → unclassified Acidimicrobiia → Acidimicrobiia bacterium952Open in IMG/M
3300017765|Ga0181413_1266858All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium502Open in IMG/M
3300017770|Ga0187217_1113282All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → unclassified Acidimicrobiia → Acidimicrobiia bacterium919Open in IMG/M
3300017776|Ga0181394_1080355All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium1058Open in IMG/M
3300017781|Ga0181423_1328981All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → unclassified Acidimicrobiia → Acidimicrobiia bacterium559Open in IMG/M
3300017783|Ga0181379_1060170All Organisms → Viruses → Predicted Viral1437Open in IMG/M
3300017962|Ga0181581_10825177All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium551Open in IMG/M
3300017969|Ga0181585_10560535All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium760Open in IMG/M
3300017985|Ga0181576_10609793All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium660Open in IMG/M
3300018421|Ga0181592_10747545All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium649Open in IMG/M
3300019730|Ga0194001_1031570All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium650Open in IMG/M
3300019742|Ga0193965_1017743All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → unclassified Acidimicrobiia → Acidimicrobiia bacterium1386Open in IMG/M
3300019937|Ga0194022_1015451All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium1003Open in IMG/M
3300020174|Ga0181603_10304283All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium614Open in IMG/M
3300020418|Ga0211557_10483346All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium541Open in IMG/M
3300020422|Ga0211702_10099517All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium824Open in IMG/M
3300020428|Ga0211521_10437806All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium568Open in IMG/M
3300020439|Ga0211558_10059776All Organisms → cellular organisms → Bacteria1890Open in IMG/M
3300021356|Ga0213858_10490070All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium569Open in IMG/M
3300021375|Ga0213869_10282457All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → unclassified Acidimicrobiia → Acidimicrobiia bacterium714Open in IMG/M
3300021465|Ga0193947_1051712All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium642Open in IMG/M
3300021957|Ga0222717_10593806All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium582Open in IMG/M
3300021958|Ga0222718_10300649All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium833Open in IMG/M
3300021958|Ga0222718_10317449All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium803Open in IMG/M
3300021958|Ga0222718_10317457All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium803Open in IMG/M
3300021961|Ga0222714_10644395All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium524Open in IMG/M
3300022061|Ga0212023_1058821All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium533Open in IMG/M
3300022063|Ga0212029_1031387All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium746Open in IMG/M
3300022069|Ga0212026_1023126All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium887Open in IMG/M
3300022069|Ga0212026_1041863All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium685Open in IMG/M
3300022071|Ga0212028_1001656All Organisms → cellular organisms → Bacteria2493Open in IMG/M
3300022140|Ga0196885_100501All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium1011Open in IMG/M
3300022159|Ga0196893_1022951All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium578Open in IMG/M
3300022167|Ga0212020_1069659All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium593Open in IMG/M
3300022168|Ga0212027_1050661All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → unclassified Acidimicrobiia → Acidimicrobiia bacterium521Open in IMG/M
3300022176|Ga0212031_1049887All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium702Open in IMG/M
3300022178|Ga0196887_1016183All Organisms → cellular organisms → Bacteria2284Open in IMG/M
3300022183|Ga0196891_1053167All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium734Open in IMG/M
3300022198|Ga0196905_1050157All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium1189Open in IMG/M
3300022198|Ga0196905_1050397All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium1186Open in IMG/M
3300022825|Ga0222669_1048804All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → unclassified Acidimicrobiia → Acidimicrobiia bacterium683Open in IMG/M
3300022857|Ga0222653_1019320All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → unclassified Acidimicrobiia → Acidimicrobiia bacterium1429Open in IMG/M
3300023061|Ga0222700_1049527All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium689Open in IMG/M
3300023180|Ga0255768_10060761All Organisms → cellular organisms → Bacteria2720Open in IMG/M
(restricted) 3300023210|Ga0233412_10265467All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → unclassified Acidimicrobiia → Acidimicrobiia bacterium754Open in IMG/M
3300023227|Ga0222690_1004801All Organisms → Viruses → Predicted Viral2130Open in IMG/M
3300023230|Ga0222709_1009336All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium1273Open in IMG/M
3300023231|Ga0222689_1003872All Organisms → cellular organisms → Bacteria2380Open in IMG/M
3300023235|Ga0222634_1001351All Organisms → cellular organisms → Bacteria8471Open in IMG/M
3300023235|Ga0222634_1008134All Organisms → cellular organisms → Bacteria2201Open in IMG/M
3300023242|Ga0222708_1002116All Organisms → cellular organisms → Bacteria4682Open in IMG/M
3300023296|Ga0222664_1039416All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium835Open in IMG/M
3300024237|Ga0228653_1046789All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → unclassified Acidimicrobiia → Acidimicrobiia bacterium985Open in IMG/M
3300024262|Ga0210003_1298673All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium618Open in IMG/M
3300024344|Ga0209992_10061608All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → unclassified Acidimicrobiia → Acidimicrobiia bacterium1758Open in IMG/M
3300025071|Ga0207896_1064967All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium577Open in IMG/M
3300025085|Ga0208792_1045773All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium830Open in IMG/M
3300025085|Ga0208792_1056081All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → unclassified Acidimicrobiia → Acidimicrobiia bacterium732Open in IMG/M
3300025128|Ga0208919_1260917All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium500Open in IMG/M
3300025138|Ga0209634_1315989All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → unclassified Acidimicrobiia → Acidimicrobiia bacterium530Open in IMG/M
3300025151|Ga0209645_1210787All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium566Open in IMG/M
3300025168|Ga0209337_1334077All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium528Open in IMG/M
3300025266|Ga0208032_1021597All Organisms → Viruses → Predicted Viral1841Open in IMG/M
3300025543|Ga0208303_1017283All Organisms → Viruses → Predicted Viral2102Open in IMG/M
3300025603|Ga0208414_1008651All Organisms → cellular organisms → Bacteria4348Open in IMG/M
3300025626|Ga0209716_1012316All Organisms → Viruses → Predicted Viral3843Open in IMG/M
3300025636|Ga0209136_1030422All Organisms → Viruses → Predicted Viral2020Open in IMG/M
3300025645|Ga0208643_1099648All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → unclassified Acidimicrobiia → Acidimicrobiia bacterium798Open in IMG/M
3300025646|Ga0208161_1064015All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium1118Open in IMG/M
3300025652|Ga0208134_1027341All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → unclassified Acidimicrobiia → Acidimicrobiia bacterium2048Open in IMG/M
3300025652|Ga0208134_1108627All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium755Open in IMG/M
3300025674|Ga0208162_1037183All Organisms → cellular organisms → Bacteria1727Open in IMG/M
3300025712|Ga0209305_1250842All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → unclassified Acidimicrobiia → Acidimicrobiia bacterium503Open in IMG/M
3300025759|Ga0208899_1021817All Organisms → Viruses → Predicted Viral3180Open in IMG/M
3300025759|Ga0208899_1040635All Organisms → cellular organisms → Bacteria2078Open in IMG/M
3300025803|Ga0208425_1053260All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium1004Open in IMG/M
3300025803|Ga0208425_1058725All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium947Open in IMG/M
3300025818|Ga0208542_1054066All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → unclassified Acidimicrobiia → Acidimicrobiia bacterium1240Open in IMG/M
3300025822|Ga0209714_1037445All Organisms → cellular organisms → Bacteria1683Open in IMG/M
3300025840|Ga0208917_1023111All Organisms → cellular organisms → Bacteria2629Open in IMG/M
3300025853|Ga0208645_1164690All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → unclassified Acidimicrobiia → Acidimicrobiia bacterium826Open in IMG/M
3300025853|Ga0208645_1252258All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium586Open in IMG/M
3300025889|Ga0208644_1217229All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium816Open in IMG/M
3300026187|Ga0209929_1085649All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium836Open in IMG/M
3300027672|Ga0209383_1084612All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium1092Open in IMG/M
3300027714|Ga0209815_1010448All Organisms → cellular organisms → Bacteria4361Open in IMG/M
3300027810|Ga0209302_10460985All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → unclassified Acidimicrobiia → Acidimicrobiia bacterium567Open in IMG/M
3300027839|Ga0209403_10152219All Organisms → Viruses → Predicted Viral1431Open in IMG/M
3300027844|Ga0209501_10686290All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium555Open in IMG/M
3300027847|Ga0209402_10120683All Organisms → cellular organisms → Bacteria1787Open in IMG/M
3300028125|Ga0256368_1040956All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium823Open in IMG/M
3300028198|Ga0257121_1096811All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium1081Open in IMG/M
3300029293|Ga0135211_1026116All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium683Open in IMG/M
3300029306|Ga0135212_1028681All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium589Open in IMG/M
3300031519|Ga0307488_10347306All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium936Open in IMG/M
3300031569|Ga0307489_10036721All Organisms → cellular organisms → Bacteria2695Open in IMG/M
3300031578|Ga0307376_10599358All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium701Open in IMG/M
3300031578|Ga0307376_10665258All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium656Open in IMG/M
3300031629|Ga0307985_10029525All Organisms → cellular organisms → Bacteria2442Open in IMG/M
3300031669|Ga0307375_10335724All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → unclassified Acidimicrobiia → Acidimicrobiia bacterium958Open in IMG/M
3300031673|Ga0307377_10563774All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → unclassified Acidimicrobiia → Acidimicrobiia bacterium820Open in IMG/M
3300031696|Ga0307995_1025707All Organisms → cellular organisms → Bacteria2629Open in IMG/M
3300032073|Ga0315315_11511216All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → unclassified Acidimicrobiia → Acidimicrobiia bacterium582Open in IMG/M
3300032257|Ga0316205_10294775All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → unclassified Acidimicrobiia → Acidimicrobiia bacterium571Open in IMG/M
3300032274|Ga0316203_1013142All Organisms → Viruses → Predicted Viral2505Open in IMG/M
3300032373|Ga0316204_10163381All Organisms → cellular organisms → Bacteria1821Open in IMG/M
3300034374|Ga0348335_112128All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → unclassified Acidimicrobiia → Acidimicrobiia bacterium829Open in IMG/M
3300034418|Ga0348337_014614All Organisms → cellular organisms → Bacteria4263Open in IMG/M
3300034418|Ga0348337_079844All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → unclassified Acidimicrobiia → Acidimicrobiia bacterium1148Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous26.88%
SeawaterEnvironmental → Aquatic → Marine → Strait → Unclassified → Seawater15.05%
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine9.68%
Saline WaterEnvironmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Water5.38%
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine4.30%
Pelagic MarineEnvironmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine4.30%
Salt MarshEnvironmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh3.76%
Estuarine WaterEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water2.69%
Freshwater To Marine Saline GradientEnvironmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient2.15%
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine2.15%
Deep SubsurfaceEnvironmental → Aquatic → Marine → Volcanic → Unclassified → Deep Subsurface2.15%
SoilEnvironmental → Terrestrial → Soil → Clay → Unclassified → Soil2.15%
Deep SubsurfaceEnvironmental → Aquatic → Marine → Oceanic → Sediment → Deep Subsurface1.61%
Microbial MatEnvironmental → Aquatic → Marine → Coastal → Sediment → Microbial Mat1.61%
SeawaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Seawater1.61%
MarineEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine1.61%
SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Sediment1.08%
Surface SeawaterEnvironmental → Aquatic → Marine → Oceanic → Photic Zone → Surface Seawater1.08%
Sackhole BrineEnvironmental → Aquatic → Marine → Coastal → Unclassified → Sackhole Brine1.08%
Marine HarborEnvironmental → Aquatic → Marine → Harbor → Unclassified → Marine Harbor1.08%
Pond WaterEnvironmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Pond Water1.08%
Saline LakeEnvironmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Lake1.08%
Macroalgal SurfaceHost-Associated → Algae → Green Algae → Ectosymbionts → Unclassified → Macroalgal Surface1.08%
FreshwaterEnvironmental → Aquatic → Freshwater → River → Unclassified → Freshwater0.54%
Freshwater Microbial MatEnvironmental → Aquatic → Freshwater → River → Unclassified → Freshwater Microbial Mat0.54%
Deep OceanEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean0.54%
MarineEnvironmental → Aquatic → Marine → Inlet → Unclassified → Marine0.54%
SeawaterEnvironmental → Aquatic → Marine → Inlet → Unclassified → Seawater0.54%
MarineEnvironmental → Aquatic → Marine → Coastal → Sediment → Marine0.54%
Estuary WaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water0.54%
Sea-Ice BrineEnvironmental → Aquatic → Marine → Coastal → Unclassified → Sea-Ice Brine0.54%
MarineEnvironmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine0.54%
SeawaterEnvironmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater0.54%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000117Marine microbial communities from Delaware Coast, sample from Delaware MO Winter December 2010EnvironmentalOpen in IMG/M
3300000947Macroalgal surface ecosystem from Botany Bay, Sydney, Australia - BBAY92Host-AssociatedOpen in IMG/M
3300000949Macroalgal surface ecosystem from Botany Bay, Sydney, Australia - BBAY94Host-AssociatedOpen in IMG/M
3300002482Marine viral communities from the Pacific Ocean - ETNP_2_30EnvironmentalOpen in IMG/M
3300005732Seawater microbial communities from Vineyard Sound, MA, USA - Succinate ammended T7EnvironmentalOpen in IMG/M
3300005738Seawater microbial communities from Vineyard Sound, MA, USA - sterilised with crude oil T0EnvironmentalOpen in IMG/M
3300005933Saline lake microbial communities from Ace Lake, Antarctica - Antarctic Ace Lake Metagenome 02UKEEnvironmentalOpen in IMG/M
3300006025Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_<0.8_DNAEnvironmentalOpen in IMG/M
3300006026Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_<0.8_DNAEnvironmentalOpen in IMG/M
3300006193Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG029-DNAEnvironmentalOpen in IMG/M
3300006352Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG108-DNAEnvironmentalOpen in IMG/M
3300006467Coastal sediment microbial communities from Rhode Island, USA: Combined Assembly of Gp0121717, Gp0123912, Gp0123935EnvironmentalOpen in IMG/M
3300006735Marine viral communities from the Subarctic Pacific Ocean - 5B_ETSP_OMZ_AT15132_CsCl metaGEnvironmentalOpen in IMG/M
3300006802Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18EnvironmentalOpen in IMG/M
3300006868Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_>0.8_DNAEnvironmentalOpen in IMG/M
3300006919Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21EnvironmentalOpen in IMG/M
3300006920Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12EnvironmentalOpen in IMG/M
3300006925Marine viral communities from the Subarctic Pacific Ocean - 14_ETSP_OMZ_AT15311 metaGEnvironmentalOpen in IMG/M
3300006929Marine viral communities from the Subarctic Pacific Ocean - 4_ETSP_OMZ_AT15127 metaGEnvironmentalOpen in IMG/M
3300006990Marine viral communities from the Subarctic Pacific Ocean - 11B_ETSP_OMZ_AT15265_CsCl metaGEnvironmentalOpen in IMG/M
3300007231Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_30_>0.8_DNAEnvironmentalOpen in IMG/M
3300007345Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_30EnvironmentalOpen in IMG/M
3300007346Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_31EnvironmentalOpen in IMG/M
3300007538Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_2 Viral MetaGEnvironmentalOpen in IMG/M
3300007539Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1M Viral MetaGEnvironmentalOpen in IMG/M
3300007541Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaGEnvironmentalOpen in IMG/M
3300007542Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaGEnvironmentalOpen in IMG/M
3300007640Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_28EnvironmentalOpen in IMG/M
3300007863Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1459B_0.2umEnvironmentalOpen in IMG/M
3300008012Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_<0.8_DNAEnvironmentalOpen in IMG/M
3300009027Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_A_H2O_MGEnvironmentalOpen in IMG/M
3300009071Pelagic marine microbial communities from North Sea - COGITO_mtgs_120405EnvironmentalOpen in IMG/M
3300009449Pelagic marine microbial communities from North Sea - COGITO_mtgs_110426EnvironmentalOpen in IMG/M
3300009481Deep subsurface microbial communities from Kolumbo volcano to uncover new lineages of life (NeLLi) - 2SBTROV12_ACTIVE470 metaGEnvironmentalOpen in IMG/M
3300009496Pelagic marine microbial communities from North Sea - COGITO_mtgs_120524EnvironmentalOpen in IMG/M
3300009507Pelagic marine microbial communities from North Sea - COGITO_mtgs_120607EnvironmentalOpen in IMG/M
3300009705Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_128EnvironmentalOpen in IMG/M
3300010296Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.8_DNAEnvironmentalOpen in IMG/M
3300010368Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_15_0.2_DNAEnvironmentalOpen in IMG/M
3300011013Deep subsurface microbial communities from Kolumbo volcano to uncover new lineages of life (NeLLi) - 4SBTROV10_white metaGEnvironmentalOpen in IMG/M
3300011118Deep subsurface microbial communities from Aarhus Bay to uncover new lineages of life (NeLLi) - Aarhus_00045 metaGEnvironmentalOpen in IMG/M
3300012920Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St8 metaGEnvironmentalOpen in IMG/M
3300013010Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.8_DNAEnvironmentalOpen in IMG/M
3300016734Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 041410CS metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300017708Marine viral communities from the Subarctic Pacific Ocean - Lowphox_04 viral metaGEnvironmentalOpen in IMG/M
3300017710Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 26 SPOT_SRF_2011-09-28EnvironmentalOpen in IMG/M
3300017713Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 14 SPOT_SRF_2010-08-11EnvironmentalOpen in IMG/M
3300017720Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 6 SPOT_SRF_2009-12-23EnvironmentalOpen in IMG/M
3300017724Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 11 SPOT_SRF_2010-05-17EnvironmentalOpen in IMG/M
3300017725Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 21 SPOT_SRF_2011-04-29EnvironmentalOpen in IMG/M
3300017728Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 42 SPOT_SRF_2013-04-24EnvironmentalOpen in IMG/M
3300017732Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 38 SPOT_SRF_2012-12-11EnvironmentalOpen in IMG/M
3300017733Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 49 SPOT_SRF_2013-12-23EnvironmentalOpen in IMG/M
3300017734Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 4 SPOT_SRF_2009-09-24 (version 2)EnvironmentalOpen in IMG/M
3300017738Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 51 SPOT_SRF_2014-02-12EnvironmentalOpen in IMG/M
3300017741Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 44 SPOT_SRF_2013-06-19EnvironmentalOpen in IMG/M
3300017742Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 22 SPOT_SRF_2011-05-21EnvironmentalOpen in IMG/M
3300017744Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 20 SPOT_SRF_2011-02-23EnvironmentalOpen in IMG/M
3300017745Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 50 SPOT_SRF_2014-01-15EnvironmentalOpen in IMG/M
3300017748Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 16 SPOT_SRF_2010-10-21EnvironmentalOpen in IMG/M
3300017751Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 13 SPOT_SRF_2010-07-21 (version 2)EnvironmentalOpen in IMG/M
3300017757Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 43 SPOT_SRF_2013-05-22EnvironmentalOpen in IMG/M
3300017758Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 32 SPOT_SRF_2012-05-30EnvironmentalOpen in IMG/M
3300017759Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 37 SPOT_SRF_2012-11-28EnvironmentalOpen in IMG/M
3300017760Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 31 SPOT_SRF_2012-02-16EnvironmentalOpen in IMG/M
3300017765Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 36 SPOT_SRF_2012-09-28EnvironmentalOpen in IMG/M
3300017770Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 15 SPOT_SRF_2010-09-15 (version 2)EnvironmentalOpen in IMG/M
3300017776Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 17 SPOT_SRF_2010-11-23EnvironmentalOpen in IMG/M
3300017781Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 46 SPOT_SRF_2013-08-14EnvironmentalOpen in IMG/M
3300017783Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 2 SPOT_SRF_2009-07-10EnvironmentalOpen in IMG/M
3300017962Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071404AT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300017969Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071407BT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300017985Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101412BT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018421Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071412BT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300019730Sediment microbial communities from the Broadkill River, Lewes, Delaware, United States ? FLT_7-8_MGEnvironmentalOpen in IMG/M
3300019742Microbial mat bacterial communities from the Broadkill River, Lewes, Delaware, United States - FB_8_MGEnvironmentalOpen in IMG/M
3300019937Freshwater microbial communities from the Broadkill River, Lewes, Delaware, United States ? IW29Aug16_MGEnvironmentalOpen in IMG/M
3300020174Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041409US metaG (spades assembly)EnvironmentalOpen in IMG/M
3300020418Marine microbial communities from Tara Oceans - TARA_B100002051 (ERX556028-ERR599136)EnvironmentalOpen in IMG/M
3300020422Marine prokaryotic communities collected during Tara Oceans survey from station TARA_076 - TARA_B100000513 (ERX555999-ERR599126)EnvironmentalOpen in IMG/M
3300020428Marine microbial communities from Tara Oceans - TARA_E500000331 (ERX556032-ERR599094)EnvironmentalOpen in IMG/M
3300020439Marine microbial communities from Tara Oceans - TARA_B100001939 (ERX556062-ERR599029)EnvironmentalOpen in IMG/M
3300021356Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO245EnvironmentalOpen in IMG/M
3300021375Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO132EnvironmentalOpen in IMG/M
3300021465Sediment microbial communities from the Broadkill River, Lewes, Delaware, United States ? FRT_0-1_MGEnvironmentalOpen in IMG/M
3300021957Estuarine water microbial communities from San Francisco Bay, California, United States - C33_18DEnvironmentalOpen in IMG/M
3300021958Estuarine water microbial communities from San Francisco Bay, California, United States - C33_27DEnvironmentalOpen in IMG/M
3300021961Estuarine water microbial communities from San Francisco Bay, California, United States - C33_3DEnvironmentalOpen in IMG/M
3300022061Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 (v2)EnvironmentalOpen in IMG/M
3300022063Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG (v2)EnvironmentalOpen in IMG/M
3300022069Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_30 (v2)EnvironmentalOpen in IMG/M
3300022071Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 (v2)EnvironmentalOpen in IMG/M
3300022140Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21 (v3)EnvironmentalOpen in IMG/M
3300022159Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_28 (v3)EnvironmentalOpen in IMG/M
3300022167Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_4 (v2)EnvironmentalOpen in IMG/M
3300022168Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_31 (v2)EnvironmentalOpen in IMG/M
3300022176Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG (v2)EnvironmentalOpen in IMG/M
3300022178Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 (v3)EnvironmentalOpen in IMG/M
3300022183Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 (v3)EnvironmentalOpen in IMG/M
3300022198Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG (v3)EnvironmentalOpen in IMG/M
3300022825Saline water microbial communities from Ace Lake, Antarctica - #730EnvironmentalOpen in IMG/M
3300022857Saline water microbial communities from Ace Lake, Antarctica - #419EnvironmentalOpen in IMG/M
3300023061Saline water microbial communities from Ace Lake, Antarctica - #1454EnvironmentalOpen in IMG/M
3300023180Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071412AT metaGEnvironmentalOpen in IMG/M
3300023210 (restricted)Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_anoxic_4_MGEnvironmentalOpen in IMG/M
3300023227Saline water microbial communities from Ace Lake, Antarctica - #1234EnvironmentalOpen in IMG/M
3300023230Saline water microbial communities from Ace Lake, Antarctica - #1692EnvironmentalOpen in IMG/M
3300023231Saline water microbial communities from Ace Lake, Antarctica - #1231EnvironmentalOpen in IMG/M
3300023235Saline water microbial communities from Ace Lake, Antarctica - #50EnvironmentalOpen in IMG/M
3300023242Saline water microbial communities from Ace Lake, Antarctica - #1576EnvironmentalOpen in IMG/M
3300023296Saline water microbial communities from Ace Lake, Antarctica - #604EnvironmentalOpen in IMG/M
3300024237Seawater microbial communities from Monterey Bay, California, United States - 65DEnvironmentalOpen in IMG/M
3300024262Deep subsurface microbial communities from Baltic Sea to uncover new lineages of life (NeLLi) - Landsort_02402 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300024344Deep subsurface microbial communities from Kolumbo volcano to uncover new lineages of life (NeLLi) - 2SBTROV12_ACTIVE470 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025071Marine viral communities from the Pacific Ocean - LP-36 (SPAdes)EnvironmentalOpen in IMG/M
3300025085Marine viral communities from the Subarctic Pacific Ocean - 14_ETSP_OMZ_AT15311 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025128Marine viral communities from the Subarctic Pacific Ocean - 4_ETSP_OMZ_AT15127 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025138Marine viral communities from the Pacific Ocean - LP-40 (SPAdes)EnvironmentalOpen in IMG/M
3300025151Marine viral communities from the Pacific Ocean - ETNP_6_30 (SPAdes)EnvironmentalOpen in IMG/M
3300025168Marine viral communities from the Pacific Ocean - LP-53 (SPAdes)EnvironmentalOpen in IMG/M
3300025266Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG Antarct_66 (SPAdes)EnvironmentalOpen in IMG/M
3300025543Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300025603Saline lake microbial communities from Ace Lake, Antarctica - Antarctic Ace Lake Metagenome 02UKE (SPAdes)EnvironmentalOpen in IMG/M
3300025626Pelagic marine microbial communities from North Sea - COGITO_mtgs_120531 (SPAdes)EnvironmentalOpen in IMG/M
3300025636Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_90LU_22_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025645Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 (SPAdes)EnvironmentalOpen in IMG/M
3300025646Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300025652Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 (SPAdes)EnvironmentalOpen in IMG/M
3300025674Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1M Viral MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300025712Pelagic marine microbial communities from North Sea - COGITO_mtgs_110321 (SPAdes)EnvironmentalOpen in IMG/M
3300025759Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 (SPAdes)EnvironmentalOpen in IMG/M
3300025803Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_<0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025818Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_<0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025822Pelagic marine microbial communities from North Sea - COGITO_mtgs_110414 (SPAdes)EnvironmentalOpen in IMG/M
3300025840Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_>0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025853Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 (SPAdes)EnvironmentalOpen in IMG/M
3300025889Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 (SPAdes)EnvironmentalOpen in IMG/M
3300026187Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_C_H2O_MG (SPAdes)EnvironmentalOpen in IMG/M
3300027672Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG029-DNA (SPAdes)EnvironmentalOpen in IMG/M
3300027714Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG002-DNA (SPAdes)EnvironmentalOpen in IMG/M
3300027810Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean ARC135M Metagenome (SPAdes)EnvironmentalOpen in IMG/M
3300027839Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB11_86 (SPAdes)EnvironmentalOpen in IMG/M
3300027844Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_134 (SPAdes)EnvironmentalOpen in IMG/M
3300027847Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_126 (SPAdes)EnvironmentalOpen in IMG/M
3300028125Sea-ice brine viral communities from Beaufort Sea near Barrow, Alaska, United States - SBEnvironmentalOpen in IMG/M
3300028198Marine microbial communities from Saanich Inlet, British Columbia, Canada - SI106_100EnvironmentalOpen in IMG/M
3300029293Marine harbor viral communities from the Indian Ocean - SCH2EnvironmentalOpen in IMG/M
3300029306Marine harbor viral communities from the Indian Ocean - SCH3EnvironmentalOpen in IMG/M
3300031519Sea-ice brine microbial communities from Beaufort Sea near Barrow, Alaska, United States - SB 0.2EnvironmentalOpen in IMG/M
3300031569Sea-ice brine microbial communities from Beaufort Sea near Barrow, Alaska, United States - SB 1.2EnvironmentalOpen in IMG/M
3300031578Soil microbial communities from Risofladan, Vaasa, Finland - TR-2EnvironmentalOpen in IMG/M
3300031629Marine microbial communities from Ellis Fjord, Antarctic Ocean - #80EnvironmentalOpen in IMG/M
3300031669Soil microbial communities from Risofladan, Vaasa, Finland - TR-1EnvironmentalOpen in IMG/M
3300031673Soil microbial communities from Risofladan, Vaasa, Finland - TR-3EnvironmentalOpen in IMG/M
3300031696Marine microbial communities from Ellis Fjord, Antarctic Ocean - #262EnvironmentalOpen in IMG/M
3300032073Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 40m 3416EnvironmentalOpen in IMG/M
3300032257Microbial mat bacterial communities from mineral coupon in-situ incubated in ocean water Damariscotta River, Maine, United States - 3-month pyriteEnvironmentalOpen in IMG/M
3300032274Microbial mat bacterial communities from mineral coupon in-situ incubated in ocean water Damariscotta River, Maine, United States - 6-month pyrrhotite 1EnvironmentalOpen in IMG/M
3300032373Microbial mat bacterial communities from mineral coupon in-situ incubated in ocean water Damariscotta River, Maine, United States - 6-month pyrrhotite 2EnvironmentalOpen in IMG/M
3300034374Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_31 (v4)EnvironmentalOpen in IMG/M
3300034418Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_28 (v4)EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
DelMOWin2010_1009202633300000117MarineMFVPVKDKLDXLVALTPDDQEKLSHYKSIVPAMIANCHKAHQTIPGYESCKPEIEAFKWFDGINIPVHGYIDLKGDKVIIEDKCKMPRRGMVKKDGTRSWFPGKLPDKPSPIIYYK*
DelMOWin2010_1011591813300000117MarineMFVPVKEKLDKLVALTPDDQEKLSYYKSIVPAMIANCHKAHQTIPGYESCKPEIEAFKWFDGINIPVHGYIDLKGDKVIIEDKCKMPRRGIVKKDGTRSWFSGKLPDRPSPYNLLQVDFYWSVFEVPVYLCYVNEKE
DelMOWin2010_1011622613300000117MarineMFVPVKEKLDKLVALTPDDQEKLSYYKSIVPAMIANCHKAHQTIPGYESCKPEIEAFKWFEGINIPVHGYIDLKGDNLIIEDKCKMPRRGIVKKDGTRSWFPGKLPDRPSPYNLLQVDFYWSVFEVPVYLCYVNEKE
BBAY92_1021091713300000947Macroalgal SurfaceMFVPVEEKLKKFVPDLKDEDEFNHYKSIIRDMIANGHAAHQSIPGYETCKPEIEAFRWFDGINIPVHGYCDLKGDKLIIEDKCKFPRKGIVKKDGTRSWLTKKLPETSPEPFHLLQIDFYYSVFKVPVYLCYIN
BBAY94_1006850933300000949Macroalgal SurfaceMFVPIEEKLKKIIPNVDQHDEFEYYKQILPKMIANGHAAHQTIPGYKDCKPEIEAFRWFDNINIPVHGYCDLKGKVIIEDKCKFPKRGRVKKDGTRSWLTNKLPESVEPYNFLQIDFY
JGI25127J35165_110636423300002482MarineMFVPVEEKLKKIIPNTDQHDEFEYYKQILPKMIANGHAAHQTIPGYKDCKPEIEAFRWFDNINIPVHGYCDLKGKIIIEDKCKFPKRGRVKKDGTRSWLTNKLPESVEPYHFLQIDFYYSVFK
Ga0076920_12469483300005732MarineMFVPVKDKLDKLVALTPDDQEKLSYYKSIVPLMIANCHKAHQTIPGYDKCKPEVEAFKWFDGINIPVHGYIDLKGDNVIIEDKCKMPRRGIVKKDGTRSWFPGKLPDRPSPHNLLQVDFYYSVFEVPVYLCYVNEKEFRVYHADNCDE
Ga0076926_12042113300005738MarineMFVPVKDKLDKLVALTPDDQEKLSYYKSIVPLMIANCHKAHQTIPGYDKCKPEVEAFKWFDGINIPVHGYIDLKGDNVIIEDKCKMPRRGIVKKDGTRSWFPGKLPDRPSPHNLLQVDFYYSVFEVPVYLCYVNEKEF
Ga0075118_1002177493300005933Saline LakeMFVPVKDKLDKLVALTTDEQEKLSYFKSITPLMISNCHKAHQTIPGYDKCKPEVEAFKWFDGINIPVHGYIDLKGDNLIIEDKCKMPRRGIVKKDGTRSWFPGKLPVDRPSPYNLLQVDFYWSVFQVPVYLCYVNEVEFKVFHAGNCD
Ga0075474_1010456413300006025AqueousMFVPLLDKLNKIVPELHQQEEFDYYCSILPKMIANGHAAHQSIPGYETCKPEIEAFRWFDGITIPVHGYCDLKGDKLIIEDKCKFPKRGRVKKDGTRSWLTNKLPEDRPEAFHLLQIDFYWSVFKVPVYLCYINE
Ga0075474_1012066413300006025AqueousMFVPVEEKLKKFVPELKDEDEFNHYKSIIRDMIANGHAAHQSIPGYETCKPEIEAFRWFDGINIPVHGYCDLKGDKLIIEDKCKFPRKGIVKKDGTRSWLTKKLPETSPEPFHLLQIDFYYSVFKVPVYLCYINEKSYKVFHAGNC
Ga0075478_1023863513300006026AqueousMFVPVNDKLNKIIPELKDQDEFDHYKSIIRDMIANGHAAHQSIPGYDTCKPEIEAFRWFDGINIPVHGYCDLKGDKLIIEDKCKFPRKGIVKKDGTRSWLTKKLPENSPEPFHL
Ga0075445_1029186213300006193MarineMFVPVQEKLDKLVALTPDDQEKLSYYKSIVPLMISNCHKAHQTIPGYDKCKPEVEAFKWFDGINIPVHGYIDLKGDKVIIEDKCKMPRRGIVKKDGTRSWFSGKLPDRPSPYNLLQVDFYWSVFEVPVYLCYVNEKEFRVYHAGNCDE
Ga0075448_1008681513300006352MarineMFVPVKDKLDKLVALTPDDQEKLSYYKSIVPAMIANCHKAHQTIPGWESCKPEIEAFKWFDGINIPVHGYIDLKGDKVIIEDKCKMPRRGIVKKDGTRSWFSGKLPDRPS
Ga0099972_1235577323300006467MarineMFVPVEEKLKKFVPELKDEDEFNHYKSIIRDMIANGHAAHQSIPGYETCKPEIEAFRWFDGINIPVHGYCDLKGDKLIIEDKCKFPRKGIVKKDGTRSWLTKKLPETSPEPFHLLQIDFYYSVFKVPVYLCYINEKSYKVFHAGNCEELKPENIEKRIPKIIQRCKI
Ga0098038_115525813300006735MarineMFVPIEEKLKKIIPNVDQHDEFEYYKQILPKMIANGHAAHQTIPGYKDCKPEIEAFRWFDGINIPVHGYCDLKGKVIIEDKCKFPKRGRVKKDGTRSWLTNKLPETVEPYNFLQIDFYYSVFKLPVY
Ga0070749_1027184833300006802AqueousMFVPVKEKLDKLVALTPDDQEKLSYYKSIVPAMIANCHKAHQTIPGYESCKPEIEAFKWFEGINIPVHGYIDLKGDNLIIEDKCKMPRRGIVKKDGTRSWFPGKLPDRPSPYNLLQVDFYWSVFEVPVYLCYVNE
Ga0075481_1032836313300006868AqueousMFVPVNDKLNKIVPELKDQDEFDHYKSIIRDMIANGHAAHQSIPGYDTCKPEIEAFRWFDGINIPVHGYCDLKGDKLIIEDKCKFPRKGIVKKDGTRSWLTKKLPENSP
Ga0070746_1018132313300006919AqueousMFVPVKEKLDKLVALTPDDQEKLSYYKSIVPAMIANCHKAHQTIPGYESCKPEIEAFKWFEGINIPVHGYIDLKGDNLIIEDKCKMPRRGIVKKDGTRSWFPGKLPDRPSPYNLLQVDFYWSVFE
Ga0070748_131433623300006920AqueousMFVPVKEKLDKLVALTPDDQEKLSYYKSIVPAMIANCHKAHQTIPGYESCKPEIEAFKWFDGINIPVHGYIDLKGDKVIIEDKCKMPRRGIVKKDGTRSWFPGKLPDRPSPYNLLQVDFYWSVFEVPVYLCYVNEKEF
Ga0098050_106960413300006925MarineMFVSVQEKLDKLVALTPDDQEKLSHYKSIVPAMIANCHKAHQSIPGWESCKPEIEAFKWFDGINIPVHGYIDLKGDKVIIEDKCKMPRRGIVKKDGTRSWFPGKLPDKPSPYNLLQVDFYWSVFEVPVYLC
Ga0098036_1004315123300006929MarineMFVPINEKLKKIVPNLDQHEEFEYYKQILPKMIANGHAAHQSIPGYEDCKPEIEAFRWFDGINIPVHGYIDLKGDKLIIEDKCKFPRRGMVKKDGTRSWFPGKLPEDRPEPSIFYK*
Ga0098046_107567823300006990MarineMFVPILEKLKKINPTTDEYDEFEHYKTIIPKMIANGHAAHQTIPGYENCKPEIEAFRWFDGVNIPVHGYIDLKGDKVIIEDKCKFPRKGKIKKDGTRSWFTSKLPEDKPEPYNLLQVDFYWSVFKVPVYLCYINEESFKVFH
Ga0075469_1004642543300007231AqueousMFVPVKDKLDKLVALTPDDQEKLSYYKSIVPAMITNCHKAHQTIPGYESCKPEIEAFKWFDGINIPVHGYIDLKGDKVIIEDKCKMPRRGIVKKDGTRSWFPGKLPDRPSPYNLLQVDFYWSVFEVPVYLCYVNEKEFRVYHAGNCD
Ga0070752_120555523300007345AqueousMFVPVKEKLDKLVALTPDDQEKLSYYKSIVPAMIANCHKAHQTIPGYESCKPEIEAFKWFEGINIPVHGYIDLKGDNLIIEDKCKMPRRGIVKKDGTRSWFPGKLPDRPSPYNLLQVDFYWSVFEVPVYLCYVNEKEFRVYHA
Ga0070753_102883893300007346AqueousMFVPVQEKLDKLVALTPDDQEKLNHYKSIVPAMIANCHKAHQSIPGWESCKPEIEAFKWFDGINIPVHGYIDLKGDNVIIEDKCKMPTRGIVKKDGTRSWFPGKLPDRP
Ga0070753_113525313300007346AqueousMFVPVKEKLDKLVALTPDDQEKLSYYKSIVPAMIANCHKAHQTIPGYESCKPEIEAFKWFDGINIPVHGYIDLKGDKVIIEDKCKMPRRGIVKKDGTRSWFAGKLPDRPSPYNLLQVDFYWSVFEVPVYLCYVNEKEFR
Ga0099851_132665613300007538AqueousMFVPLLDKLNKIVPELHQQEEFDYYCSILPKMIANGHTAHQSIPGYETCKPEIEAFRWFDGITIPVHGYCDLKGDKLIIEDKCKFPKRGRVKKDGTRSWLTNKLPEDRPEAFHLLQIDFYWSVFKVPVYLCYINEESFKVFHAGNCD
Ga0099849_113717513300007539AqueousMFVPVKDKLDKLVALTPDDQEKLSYYKSIVPAMIANCHKAHQTIPGYESCKPEIEAFKWFDGINIPVHGYIDLKGDKVIIEDKCKMPRRGIVKKDGTRSWFPGKLPDRPSPYNLLQVDFYWSVFEVPVYLCYVNEKEFR
Ga0099849_126981823300007539AqueousMFVPVNDKLNRIVPELKDQDEFDHYKSIIRDMIANGHAAHQSIPGYDTCKPEIEAFRWFDGINIPVHGYCDLKGDKLIIEDKCKFPRKGIVKKDGTRSWLTKKLPENSPEP
Ga0099848_118497113300007541AqueousMFVPVNDKLNKIITELKDQDEFDHYKSIIRDMIANGHAAHQTIPGYDTCKPEIEAFRWFDGINIPVHGYCDLKGDKLIIEDKCKFPRKGIVKKDGTRSWLTKKLPENSPDPF
Ga0099846_111995423300007542AqueousMFVPVEEKLKKFVPELKDEDEFNHYKSIIRDMIANGHAAHQSISGYETCKPEIEAFRWFDGINIPVHGYCDLKGDKLIIEDKCKFPRKGIVKKDGTRSWLTKKLPETSPEPFHLLQIDFYYSVFKVPVYLCYINEKSYKVFH
Ga0070751_118771223300007640AqueousMFVPVKEKLDKLVALTPDDQEKLSYYKSIVPAMIANCHKAHQTIPGYESCKPEIEAFKWFEGINIPVHGYIDLKGDNLIIEDKCKMPRRGIVKKDGTRSWFSGKLPDRPSPYNLLQVDFYWS
Ga0105744_105263733300007863Estuary WaterMFVSVQEKLDKLVALTPDDQEKLSHYKSIVPAMIANCHKAHQSIPGWESCKPEIEAFKWFDGINIPVHGYIDLKGDKVIIEDKCKMPRRGIVKKDGTRSWFPGKLPDRPSP
Ga0075480_1042399213300008012AqueousMFVPVQEKLDKLVALTPDDQEKLSHYKSIVPLMIANCHKAHQSIPGWESCKPEIEAFKWFDGINIPVHGYIDLKGDKVIIEDKCKMPRRGIVKKDGTRSWFPGKLPDKPSPYNLLQIDFYWSVFEVPVYLCYVNEKEFRVYHADN
Ga0102957_132525223300009027Pond WaterMFVPIEEKLKKIIPAAEYHDEFEHYKQILPSMIANGHAAHKTIPGYDTTKPEIEAFRWFDGINIPVHGYCDHKGEVIIEDKCKFPRRGRVKKDGTRSWLTSKLPENEPEPYNLLQVDFYYSVFKVPVYLCYINE
Ga0115566_1024607633300009071Pelagic MarineMFVPVQEKLDKLVALTPDDQEKLSHYKSIVPAMIANCHKAHQSIPGWESCKPEIEAFKWFDGINIPVHGYIDLKGDKVIIEDKCKMPRRGIVKKDGTRSWFPGKLPDKPSPYNLLQVDFYWSVFK
Ga0115558_135779923300009449Pelagic MarineMFVPVQEKLDKLVALTPDDQEKLSHYKSIVPAMIANCHKAHQSIPGWESCKPEIEAFKWFDGINIPVHGYIDLKGDKVIIEDKCKMPRRGIVKKDGTRSWFPGKLPDRPSPYNLLQVDFYWSVFEVPVYLCYVN
Ga0114932_1065386213300009481Deep SubsurfaceMTFVSVQKKLDKLVALTPDDQEKLSHYKSIVPAMIANCHKAHQSIPGWESCKPEIEAFKWFDGINIPVHGYIDLKGDKVIIEDKCKMPRRGIVKKDGTRSWFPGKLPDKPSPYN
Ga0115570_1008851613300009496Pelagic MarineMFVPVKDKLDKLVALTPDDQEKLSYYKSIVPLMIANCHKAHQTIPGYDKCKPEVEAFKWFDGINIPVHGYIDLKGDNVIIEDKCKMPRRGIVKKDGTRSWFPGKLPDRPSPHNLLQVDFYYSVFEVPVYLCYVIEKKFRF
Ga0115570_1031222323300009496Pelagic MarineMFVPVQEKLDKLVALTPDDQEKLSHYKSIVPAMIANCHKAHQSIPGWESCKPEIEAFKWFDGINIPVHGYIDLKGDKVIIEDKCKMPRRGIVKKDGTRSWFPGKLPDRPSPY
Ga0115572_1015402353300009507Pelagic MarineMTFVSVQEKLDKLVALTPDDQEKLSHYKSIVPAMIANCHKAHQSIPGWESCKPEIEAFKWFDGINIPVHGYIDLKGDKVIIEDKCKMPRRGIVKKDGTRSWFPGKLPDRPSPYNLLQVDFYWSVFEVPVYLCYVNEKEFRVYSADNCDE
Ga0115000_1025991913300009705MarineMFVPVNDKLDKLVALTPDDQEKLSYYKSIVPLMISNCHKAHQTIPGYDKCKPEVEAFKWFDGINIPVHGYIDLKGDKVIIEDKCKMPRRGIVKKDGTRSWFPGKLPDRPSPYNLLQVDFYWSVFEVPVYLCYVNEKEFRVYHA
Ga0129348_101747193300010296Freshwater To Marine Saline GradientMFVPVNDKLNKIIPELKDQDEFDHYKSIIRDMIANGHAAHQTIPGYDTCKPEIEAFRWFDGINIPVHGYCDLKGDKLIIEDKCKFPRKGIVKKDGTRSWLTKKLPENSPEPFHLLQIDFYYSVFKVPVYLC
Ga0129324_1004470113300010368Freshwater To Marine Saline GradientMFVPVKEKLDKLVALTPDDQEKLSYYKSIVPAMIANCHKAHQTIPGYESCKPEIEAFKWFEGINIPVHGYIDLKGDNLIIEDKCKMPRRGIVKKDGTRSWFPGKLPDRPSPYNLLQVDFYWSVFEVPVYLCYVNEKEFRV
Ga0114934_1001544313300011013Deep SubsurfaceMTFVSVQEKLDKLVALTPDDQEKLSHYKSIVPAMIANCHKAHQSIPGWESCKPEIEAFKWFDGINIPVHGYIDLKGDKVIIEDKCKMPRRGIVKKDGTRSWFPGKLPDKPSPYNLLQVDFYWSVFEVPVYL
Ga0114934_1012412613300011013Deep SubsurfaceMFVPIEEKLKKIIPNVDQHDEFEYYKQILPKMIANGHAAHQTIPGYKDCKPEIEAFRWFDGINIPVHGYCDLKGKVIIEDKCKFPKRGRVKKDGTRSWLTNKLPETVEPYNFLQIDFYY
Ga0114922_1020370163300011118Deep SubsurfaceMFVPVKDKLDKLVALTPDDQEKLSYYKSIVPLMIANCHKAHQTIPGYDKCKPEVEAFKWFDGINIPVHGYIDLKGDNVIIEDKCKMPRRGIVKKDGTRSWFPGKLPDRPSPYNLLQVDFYWSVFEVPVYLCYVNEK
Ga0114922_1021057113300011118Deep SubsurfaceMFVPVKDKLDKLVALTPDDQEKLSYYKSIVPAMIANCHKAHQTIPGYESCKPEIEAFKWFDGINIPVHGYIDLKGDKVIIEDKCKMPRRGIVKKDGTRSWFSGKLPDRPSPYNLLQVDFY
Ga0160423_1010132283300012920Surface SeawaterMFTPINEKFKKINVHLSQFDEFEYYKSIIPLMIENGHKAHQTIPGYEKCKPEIEAFKWFDGINIPVHGYVDLLGDVIIEDKCKFPRKGRVKKDGTRSWLTNKLPEEKP
Ga0160423_1011150213300012920Surface SeawaterMFVPIEEKLKKIIPNVDQHDEFEYYKQILPKMIANGHAAHQTIPGYKDCKPEIEAFRWFDNINIPVHGYCDLKGKVIIEDKCKFPKKGRVKKDGTRSWLTNKLPETVEPYNFLQIDFYYSVFKLPV
Ga0129327_1004406013300013010Freshwater To Marine Saline GradientMFVPVKDKLDKLVALTPDDQEKLSHYKSIVPAMIANCHKAHQTIPGYESCKPEIEAFKWFDGINIPVHGYIDLKGDKVIIEDKCKMPRRGMVKKDGTRSWFPGKLPDKPSPYNLLQVDFYWSVFEVPVYLCYVNEKDFRVYH
Ga0129327_1016303933300013010Freshwater To Marine Saline GradientMFVPVKEKLDKLVALTPDDQEKLSYYKSIVPAMIANCHKAHQTIPGYESCKPEIEAFKWFEGINIPVHGYIDLKGDNLIIEDKCKMPRRGIVKKDGTRSWFPGKLPDR
Ga0182092_108879123300016734Salt MarshMFVPVEEKLKKFVPELKDEDEFNHYKSIIRDMIANGHAAHQSIPGYETCKPEIEAFRWFDGINIPVHGYCDLKGDKLIIEDKCKFPRKGIVKKDGTRSWLTKKLPETSPEPFHLLQIDFYYSVFK
Ga0181369_107639723300017708MarineMFVPVQEKLDKLVALTPDDQEKLSHYKSIVPAMIANCHKAHQSIPGWESCKPEIEAFKWFDGINIPVHGYIDLKGDKVIIEDKCKMPRRGIVKKDGTRSWFPGKLPDKPSPYNLLQVDFYWSVFEVPVYLCYVNEKEFRVYHADNCD
Ga0181403_106035713300017710SeawaterMFVPVQEKLDKLVALTPDDQEKLSHYKSIVPAMIANCHKAHQSIPGWESCKPEIEAFKWFDGINIPVHGYIDLKGDKVIIEDKCKMPRRGIVKKDGTRSWFPGKLPDK
Ga0181391_102498013300017713SeawaterMFVPVQEKLDKLVALTPDDQEKLSHYKSIVPAMIANCHKAHQSIPGWESCKPEIEAFKWFDGINIPVHGYIDLKGDKVIIEDKCKMPRRGIVKKDGTRSWFPGKLPDKPSPYNLLQVDFYWSVFEVPVYLCYVNEKEFRVYHADN
Ga0181391_114097923300017713SeawaterMFVPILEKLKKINPTTDEYDEFEHYKTIIPKMIANGHAAHQTIEGYDTCKPEIEAFRWFNGVNIPVHGYIDLKGDKVIIEDKCKFPRKGKIKKDGTRSWFTSKLPEDKPEPYNLLQ
Ga0181383_112245823300017720SeawaterMFVPIEEKLKKIIPNVDQHDEFEYYKQILPKMIANGHAAHQTIPGYKDCKPEIEAFRWFDDINIPVHGYCDLKGKVIIEDKCKFPKRGRVKKDGTRSWLTNKLPETVEPYNFL
Ga0181388_104580413300017724SeawaterMFVPILEKLKKINPTTDEYDEFEHYKTIIPKMIANGHAAHQTIEGYDTCKPEIEAFRWFNGVNIPVHGYIDLKGDKVIIEDKCKFPRKGKIKKDGTRSWFTSKLPEDKPEPYNLLQVDFYWSVFKVPVY
Ga0181398_1003433133300017725SeawaterMFVPIEEKLKKIIPNVDQHDEFEYYKQILPKMIANGHAAHQTIPGYKDCKPEIEAFRWFDGINIPVHGYCDLKGKVIIEDKCKFPKRGRVKKDGTRSWLTNKLPETVEPYNFLQIDFYYSVFKLPVYICYIN
Ga0181419_107878823300017728SeawaterMFVPIEEKLKKIIPNVDQHDEFEYYKQILPKMIANGHAAHQTIPGYKDCKPEIEAFRWFEGINIPVHGYCDLKGKVIIEDKCKFPKRGRVKKDGTRSWLTNKLPETVEPYNFLQIDFYYSVFKLPVYICYINEESYKVFSADNCDDLKPENIE
Ga0181415_104535033300017732SeawaterMFVPVKDKLDKLVALTPDDQEKLSHYKSIVPAMIANCHKAHQTIPGYESCKPEIEAFKWFDGINIPVHGYIDLKGDKVIIEDKCKMPRRGMVKKDGTRSWFPGKLPDKPSPYNLLQVDFYWSVFEVPVYLCYVNEK
Ga0181426_109472723300017733SeawaterMIVPVKDKLDKLVALTPDDQEKLSHYKSIVPAMIANCHKAHQTIPGYESCKPEIEAFKWFDGINIPIHGYIDLKGDKVIIEDKCRMPRRGMVKKDGTRSWFPGKLPDKPSPYNLLQVDFYWSVFEVPVYLCYV
Ga0187222_111783923300017734SeawaterMFVPIEEKLKKIIPNVDQHDEFEYYKQILPKMIANGHAAHQTIPGYKDCKPEIEAFRWFEGINIPVHGYCDLKGKVIIEDKCKFPKRGRVKKDGTRSWLTNKLPETVEPYNFLQIDFYYSVFKLPVYI
Ga0181428_106802033300017738SeawaterMFVPVKDKLDKLVALTPDDQEKLSHYKSIVPAMIANCHKAHQTIPGYESCKPEIEAFKWFDGINIPIHGYIDLKGDKVIIEDKCRMPRRGMVKKDGTRSWFPGKLPDKPSPYNLLQVDFYFSVFEVPVY
Ga0181421_106561433300017741SeawaterMFVPIEEKLKKIIPNVDQHDEFAYYKQILPKMIANGHAAHQTIPGYKDCKPEIEAFRWFDGINIPVHGYCDLKGKVIIEDKCKFPKRGRVKKDGTRSWLTNKLPETVEPYNFLQIDFYYSVFKLPVYICYINEESYKVFSADNCD
Ga0181421_111297523300017741SeawaterMFVPVEEKLKKFVPELKDEDEFNYYKSIIRDMIANGHAAHQSIPGYETCKPEIEAFRWFDGINIPVHGYCDLKGDKLIIEDKCKFPRKGIVKKDGTRSWLTKKLPETSPEPFHLLQIDFYYSVFKVPVYLCYINEKSY
Ga0181421_113873213300017741SeawaterMFVPVKDKLDKLVALTPDDQEKLSHYKSIVPAMIANCHKAHQTIPGYESCKPEIEAFKWFDGINIPIHGYIDLKGDKVIIEDKCRMPRRGMVKKDGTRSWFPGKLPDKPSPYNLLQVDFYWSVFEV
Ga0181399_107036123300017742SeawaterMFVSVQEKLDKLVALTPDDQEKLSHYKSIVPSMIANCHKAHQSIPGWESCKPEIEAFKWFDGINIPVHGYIDLKGDKVIIEDKCKMPRRGIVKKDGTRSWFPGKLPDKPSPYNLLQVDFYWSVFEV
Ga0181397_110977423300017744SeawaterMFVSVQEKLDKLVALTPDDQEKLSHYKSIVPAMIANCHKAHQSIPGWESCKPEIEAFKWFDGINIPVHGYIDLKGDNLIIEDKCKMPRRGIVKKDGTRSWFPGKLPDKPS
Ga0181427_102203913300017745SeawaterMFVPVKDKLDKLVALTPDDQEKLSHYKSIVPAMIANCHKAHQTIPGYESCKPEIEAFKWFDGINIPVHGYIDLKGDKVIIEDKCKMPRRGMVKKDGTRSWFPGKLPDKPSPYNLLQVDFYWSVFEVPVYLCYVNEKEFRV
Ga0181393_1000230403300017748SeawaterMFVPIEEKLKKIIPNVDQHDEFEYYKQILPKMIANGHAAHQTIPGYKDCKPEIEAFRWFDGINIPVHGYIDLKGKVIIEDKCKFPKRGRVKKDGTRSWLTNKLPETVEPYNFLQIDFYYSVFKLPVYICY
Ga0187219_111039423300017751SeawaterMFVSVQEKLDKLVALTPDDQEKLSHYKSIVPAMIANCHKAHQSIPGWESCKPEIEAFKWFDGINIPVHGYIDLKGDKVIIEDKCKMPRRGMVKKDGTRSWFPGKLPDKPSPYNLLQV
Ga0181420_106359543300017757SeawaterMFVSVEEKLKKFVPELKDEDEFNYYKSIIRDMIANGHAAHQSIPGYETCKPEIEAFRWFDGINIPVHGYCDLKGDKLIIEDKCKFPRKGIVKKDGTRSWLTKKLPETSPEPFHLLQIDFYYSVFKVPVYLCYI
Ga0181409_104397553300017758SeawaterMFVPIEEKLKKIIPNVDQHDEFEYYKQILPKMIANGHAAHQTIPGYKDCKPEIEAFRWFDGINIPVHGYCDLKGKVIIEDKCKFPKRGRVKKDGTRSWLTNKLPETVEPYNFLQIDFYYSVFKLPVYICYINEESY
Ga0181414_108363413300017759SeawaterMFVSVQEKLDKLVALTPDDQEKLSHYKSIVPAMIANCHKAHQSIPGWESCKPEIEAFKWFDGINIPVHGYIDLKGDNLIIEDKCKMPRRGIVKKDGTRSWFPGKLPDKPSPYNLLQVDFY
Ga0181408_106653713300017760SeawaterMFVPVQEKLDKLVALTPDDQEKLSHYKSIVPAMIANCHKAHQSIPGWESCKPEIEAFKWFDGINIPVHGYIDLKGDKVIIEDKCKMPRRGIVKKDGTRSWFPGKLPDKPSPYNL
Ga0181413_126685813300017765SeawaterMFVSVQEKLDKLVAFTPDDQEKLSHYKSIVPAMIANCHKAHQSIPGWESCKPEIEAFKWFDGINIPVHGYIDLKGDKVIIEDKCRMPRRGMVKKDGTRSWFPGKLPDKPSPYNLLQVDFYWSVFEVPVYLCYVNEK
Ga0187217_111328213300017770SeawaterMFVPVKDKLDKLVALTPDDQEKLSHYKSIVPAMIANCHKAHQSIPGWESCKPEIEAFKWFDGINIPVHGYIDLKGDKVIIEDKCKMPRRGMVKKDGTRSWFPGKLPDKPSPYNLLQVDFYWSVFEVPVYLCY
Ga0181394_108035513300017776SeawaterMFVPVQEKLDKLVALTPDDQEKLSHYKSIVPAMIANCHKAHQSIPGWESCKPEIEAFKWFDGINIPVHGYIDLKGDKVIIEDKCKMPRRGMVKKDGTRSWFPGKLPDKPSPYNLLQVDFYWSVFEVPVYLCYVNEKEFR
Ga0181423_132898113300017781SeawaterMFVSVQEKLDKLVALTPDDQEKLSHYKSIVPSMIANCHKAHQSIPGWESCKPEIEAFKWFDGINIPVHGYIDLKGDNLIIEDKCKMPRRGIVKKDGTRSWFPGKLPDRPSPYNLLQVDFYWSVFEVPVYLCYVN
Ga0181379_106017013300017783SeawaterMFVPIEEKLKKIIPNVDQHDEFEYYKQILPKMIANGHAAHQTIPGYKDCKPEIEAFRWFDDINIPVHGYCDLKGKVIIEDKCKFPKRGRVKKDGTRSWLTNKLPETVEPYNFLQIDFYYSVFKLPVYI
Ga0181581_1082517723300017962Salt MarshMFVPVNDKLNKIIPELKDQDEFDHYKSIIRDMIANGHAAHQSIPGYDTCKPEIEAFRWFDGINIPVHGYCDLKGDKLIIEDKCQFPRKGIIKKDGTRSWSTSKLPEDSPK
Ga0181585_1056053523300017969Salt MarshMFVPVEEKLKKFVPELKDEDEFNHYKSIIRDMIANGHAAHQSIPGYETCKPEIEAFRWFDGINIPVHGYCDLKGDKLIIEDKCKFPRKGIVKKDGTRSWLTKKLPETSPEPFHLLQIDFYYSVFKVPVYLCYINEKSYKVFH
Ga0181576_1060979323300017985Salt MarshMFVPIEEKLKKINPTSDEFDEFEHYKSILPKMIANGHAAHQTIPGYETCKPEIEAFRWFDGINIPVHGYIDLKGDKVIIEDKCKFPRKGKIKKDGTRSWFTSKLPEDKPEPYNLLQVDFYWSVFKVPVYLCYINEESFKVFHAGNC
Ga0181592_1074754523300018421Salt MarshMFVPVNDKLNKIIPELKDQDEFDHYKSIIRDMIANGHAAHQSIPGYDTCKPEIEAFRWFDGINIPVHGYCDLKGDKLIIEDKCKFPRKGIVKKDGTRSWLTKKLPENSPEPFHLLQIDFYYSVFKVPVYLCYINEKSYKVFHAGNCEELKPENIEKRIPKIIQRCKVRQ
Ga0194001_103157023300019730SedimentMFVPVEEKLKKFVPELKDEDEFNHYKSIIRDMIANGHAAHQSIPGYETCKPEIEAFRWFDGINIPVHGYCDLKGDKLIIEDKCKFPRKGIVKKDGTRSWLTKKLPETSPEPFHLLQIDFYYSVFKVPVYLCYINEKSYK
Ga0193965_101774353300019742Freshwater Microbial MatMFVPVEEKLKKFVPELKDEDEFNHYKSIIRDMIANGHAAHQSIPGYETCKPEIEAFRWFDGINIPVHGYCDLKGDKLIIEDKCKFPRKGIVKKDGTRSWLTKKLPETSPEPFHLLQIDFYYSVFKVPVY
Ga0194022_101545133300019937FreshwaterMFVPVEEKLKKFVPELKDEDEFNHYKSIIRDMIANGHAAHQSIPGYETCKPEIEAFRWFDGINIPVHGYCDLKGDKLIIEDKCKFPRKGIVKKDGTRSWLTKKLPETSPEPFHLLQ
Ga0181603_1030428313300020174Salt MarshMFVPVEEKLKKFVPELKDEDEFNHYKSIIRDMIANGHAAHQSIPGYETCKPEIEAFRWFDGINIPVHGYCDLKGDKLIIEDKCKFPRKGIVKKDGTRSWLTKKLPETSPEPFHLLQIDFYYSVFKVPVYPCYI
Ga0211557_1048334623300020418MarineMFIPVNEKLKKITPELSQRDEFEHYKSILPLMIENGHKAHQTIPGFNNCKPEIEAFRWFDGIEIPIHGYIDLKGEIIIEDKCKFPRKGRIKKDGTRSWSTTKLPEERPDPFHLLQIDFYYSVFKLPVYLCYINEETFKV
Ga0211702_1009951713300020422MarineMFVPVLEKIKKINPTTNEYDEFEHYKTIIPKMIANGHAAHQTIPGYDTCKPEIEAFRWFDGVNIPVHGYIDLKGDKVIIEDKCKFPRKGKLKKDNTRSFSTTKLPETPDTKHLLQVDFY
Ga0211521_1043780613300020428MarineMFVPIEEKLKKIIPNVDQHDEFEYYKQILPKMIANGHAAHQTIPGYKDCKPEIEAFRWFDGINIPVHGYCDLKGKVIIEDKCKFPKRGRVKKDGTRSWLTNKLPETVEPYNFLQIDFYYSVFKLPVYICYINEESYKVFS
Ga0211558_1005977613300020439MarineMFIPVEEKLKKIIPDLNYRDEFEHYKSILPKMIENGHKAHQTIPGYDKCKPEIEAFRWFDGINIPIHGYCDLKGDIIIEDKCKFPRKGRIKKDGTRSWTTAKLPEERPDPFHLLQV
Ga0213858_1049007023300021356SeawaterMFVPIEEKLKKIIPDAEYHDEFEHYKQILPSMIANGHAAHKTIPGYETTKPEIEAFRWFDGINIPVHGYCDHKGEVIIEDKCKFPRRGRVKKDGTRSWLTSKLPENEPEPYNLLQVDFYYSVFKVPVYLCYINEETYK
Ga0213869_1028245723300021375SeawaterMFVPVKDKLDKLVALTPDDQEKLSHYKSIVPAMIANCHKAHQSIPGWESCKPEIEAFKWFDGINIPVHGYIDLKGDKVIIEDKCKMPRRGIVKKDGTRSWFPGKLPDRPSPYNLLQVDF
Ga0193947_105171213300021465SedimentMFVPVEEKLKKFVPELKDEDEFNHYKSIIRDMIANGHAAHQSIPGYETCKPEIEAFRWFDGINIPVHGYCDLKGDKLIIEDKCKFPRKGIVKKDGTRSWLTKKLPETSPEPFHLLQIDFYYSVFKVPVYLCYINEKSYKVF
Ga0222717_1059380613300021957Estuarine WaterMFVPIIEKLKKINPNLDQEEEFEHYCQILPKMIANGHAAHQTIPGYKTTKPEIEAFRWFDGISIPVHGYVDLKGDNVIIEDKCKFPRRGRPKKDGTRSWLTSKLPENEPEP
Ga0222718_1030064913300021958Estuarine WaterMFVPIKEKLKKIIPDSEYHDEFEHYKKILPSMIANGHAAHKTIPGYDTTKPEIEAFRWFDGINIPVHGYCDHKGEVIIEDKCKFPRRGRVKKDGTRSWLTSKLPENEPEPYNLLQVDFYYSV
Ga0222718_1031744923300021958Estuarine WaterMFIPVREKLKKIVPNLDQQEEYDYYCSILPNMIANGHAAHKSIPGYETCKPEIEAFRWFDGINIPVHGYCDLKGDKLIIEDKCKFPKRGRVKKDGTRSWLTNKLPEDKPDSFHLLQIDFYYSVFQVPV
Ga0222718_1031745713300021958Estuarine WaterMFVPVREKLKKIVPNLDQQEEYDYYCSILPNMIANGHAAHKSIPGYKTCKPEIEAFRWFDGINIPVHGYCDLKGDKLIIEDKCKFPKRGRVKKDGTRSWLTNKLPEDKPDSFHLLQIDFYYSVFQVPV
Ga0222714_1064439513300021961Estuarine WaterMFVPVEEKLKKFVPELKDEDEFNHYKSIIRDMIANGHAAHQSIPGYETCKPEIEAFRWFDGINIPVHGYCDLKGDKLIIEDKCKFPRKGIVKKDGTRSWLTKKLPETSPEPFHLLQIDFYYSVFKVPVYLCYINEKSYKVFHAGNCE
Ga0212023_105882123300022061AqueousMFVPVKEKLDKLVALTPDDQEKLSYYKSIVPAMIANCHKAHQTIPGYESCKPEIEAFKWFDGINIPVHGYIDLKGDKVIIEDKCKMPRRGIVKKDGTRSWFPGKLPDRPSPYNLLQVDFYWSVFEVPVYLCYVNEKEFRVYHAGN
Ga0212029_103138723300022063AqueousMFVPVNDKLNKIIPELKDQDEFDHYKSIIRDMIANGHAAHQTIPGYDTCKPEIEAFRWFDGINIPVHGYCDLKGDKLIIEDKCKFPRKGIVKKDGTRSWLTKKLPENSPEPFHLLQIDFYYSVFKVPVYLCYINEKSYKVFHAGNCED
Ga0212026_102312613300022069AqueousMFVPVEEKLKKFVPELKDEDEFNHYKSIIRDMIANGHAAHQSIPGYETCKPEIEAFRWFDGINIPVHGYCDLKGDKLIIEDKCKFPRKGIVKKDGTRSWLTKKLPETSPEPFHLLQIDFYYSVFKVPVYLCYINE
Ga0212026_104186323300022069AqueousMFVPLLDKLNKIVPELHQQEEFDYYCSILPKMIANGHAAHQSIPGYETCKPEIEAFRWFDGITIPVHGYCDLKGDKLIIEDKCKFPKRGRVKKDGTRSWLTNKLPEDRPEAFHLLQIDFYWSVFKVPVYLCYINEESFKVFHA
Ga0212028_100165693300022071AqueousMFVPVEEKLKKFVPELKDEDEFNHYKSIIRDMIANGHAAHQSIPGYETCKPEIEAFRWFDGINIPVHGYCDLKGDKLIIEDKCKFPRKGIVKKDGTRSWLTKKLPETSPEPFHLLQIDFYYSVFKVPVYLCYINEKSYKVFHAGNCEEL
Ga0196885_10050113300022140AqueousMFVPVEEKLKKFVPELKDEDEFNHYKSIIRDMIANGHAAHQSIPGYETCKPEIEAFRWFDGINIPVHGYCDLKGDKLIIEDKCKFPRKGIVKKDGTRSWLTKKLPETSPEPFHLLQIDFYYSVFKVPVYLCYINEKSYKVFHAGNCEELKPENIEKRIPKIIQRCKIR
Ga0196893_102295123300022159AqueousMFVPVEEKLKKFVPELKDEDEFNHYKSIIRDMIANGHAAHQSIPGYETCKPEIEAFRWFDGINIPVHGYCDLKGDKLIIEDKCKFPRKGIVKKDGTRSWLTKKLPETSPEPF
Ga0212020_106965923300022167AqueousMFVPVNDKLNKIIPELKDQDEFDHYKSIIRDMIANGHAAHQTIPGYDTCKPEIEAFRWFDGINIPVHGYCDLKGDKLIIEDKCKFPRKGIVKKDGTRSWLTKKLPENSPEP
Ga0212027_105066123300022168AqueousMFVPVKDKLDKLVALTPDDQEKLSYYKSIVPLMIANCHKAHQTIPGYDKCKPEVEAFKWFDGINIPVHGYIDLKGDNVIIEDKCKMPRRGIVKKDGTRSWFPGKLPDRP
Ga0212031_104988713300022176AqueousMFVPLLDKLNKIVPELHQQEEFDYYCSILPKMIANGHAAHQSIPGYETCKPEIEAFRWFDGITIPIHGFCDLKGDKLIIEDKCKFPKRGRVKKDGTRSWLTNKLPEDRPEAFHLLQIDFYWSVFKVPVYLCYINEESFKVS
Ga0196887_101618313300022178AqueousMFVPVQEKLDKLVALTPDDQEKLSHYKSIVPAMIANCHKAHQSIPGWESCKPEIEAFKWFDGINIPVHGYIDLKGDKVIIEDKCKMPRRGIVKKDGTRSWFPGKLPDRPSPYNLLQIDFYWSVFEVPVYLCYVNEKEFRVYHADN
Ga0196891_105316713300022183AqueousMFVPVNDKLNKIVPELKDQDEFDHYKSIIRDMIANGHAAHQSIPGYDTCKPEIEAFRWFDGINIPVHGYCDLKGDKLIIEDKCKFPRKGIVKKDGTRSWLTKKLPENSPEPFHLLQIDFYYSVFKVPVYLCYINEKSY
Ga0196905_105015713300022198AqueousMFVPLLDKLNKIVPELHQQEEFDYYCSILPKMIANGHAAHQSIPGYETCKPEIEAFRWFDGITIPIHGFCDLKGDKLIIEDKCKFPKRGRVKKDGTRSWLTNKLPEDRPEAFHLLQIDFYWSVFKVPVYLCYINEESFKVFHAGNCDE
Ga0196905_105039713300022198AqueousMFVPLLDKLNKIVPELHQQEEFDYYCSILPKMIANGHTAHQSIPGYETCKPEIEAFRWFDGITIPVHGYCDLKGDKLIIEDKCKFPKRGRVKKDGTRSWLTNKLPEDRPEAFHLLQIDFYWSVFKVPVYLCYINEESFKVFHAGNCDE
Ga0222669_104880423300022825Saline WaterMFVPVNDKLDKLVALTPDDQEKLSYYKSIVPLMISNCHKAHQTIPGYDKCKPEVEAFKWFDGINIPVHGYIDLKGDKVIIEDKCKMPRRGIVKKDGTRSWFPGKLPDRPSPYNLLQVDFYWSVFEVP
Ga0222653_101932063300022857Saline WaterMFVPVNDKLDKLVALTPDDQEKLSYYKSIVPLMISNCHKAHQTIPGYDKCKPEVEAFKWFDGINIPVHGYIDLKGDKVIIEDKCKMPRRGIVKKDGTRSWFPGKLPDRPSP
Ga0222700_104952723300023061Saline WaterMFVPVKDKLDKLVALTPADQEKLSYYKSIVPLMISNCHKAHQTIPGYDKCKPEVEAFKWFDGINIPIHGYIDLKGDNLIIEDKCKMPRRGIVKKDGTRSWFPGKLPVDKPSPYNLLQVD
Ga0255768_1006076113300023180Salt MarshMFVPVEEKLKKFVPELKDEDEFNHYKSIIRDMIANGHAAHQSIPGYETCKPEIEAFRWFDGINIPVHGYCDLKGDKLIIEDKCKFPRKGIVKKDGTRSWLTKKLPETSPEPFHLLQIDFYYSVFKVPVYLCYINEKSYKVFHAGNCEELKPENIEKRIPKIIQR
(restricted) Ga0233412_1026546713300023210SeawaterMFVPVKDKLDKLVALTPDDQEKLSYYKSIVPAMIANCHKAHQTIPGYESCKPEIEAFKWFEGINIPVHGYIDLKGDNLIIEDKCKMPRRGIVKKDGTRSWFPGKLPDRPSPYNLLQVDFY
Ga0222690_100480183300023227Saline WaterMFVPVKDKLDKLVALTPADQEKLSYYKSIVPLMISNCHKAHQTIPGYDKCKPEVEAFKWFDGVNIPIHGYIDLKGDNLIIEDKCKMPRRGIVKKDGTRSWFPGKLPVDKPSPYNLLQVDFYWSVFQVPVYLCYVNEVEFKV
Ga0222709_100933613300023230Saline WaterMFVPVKDKLDKLVALTPADQEKLSYYKSIVPLMISNCHKAHQTIPGYDKCKPEVEAFKWFDGINIPIHGYIDLKGDNLIIEDKCKMPRRGIVKKDGTRSWFPGKLPVDKPSPYNLLQVDFYWSV
Ga0222689_100387293300023231Saline WaterMFVPVNDKLDKLVALTPDDQEKLSYYKSIVPLMISNCHKAHQTIPGYDKCKPEVEAFKWFDGINIPVHGYIDLKGDKVIIEDKCKMPRRGIVKKDGTRSWFPGKLPDRPSPYNLLQVDFYWSVFEVPVYLCYVNEKEFR
Ga0222634_100135113300023235Saline WaterMFVPVNDKLDKLVALTPDDQEKLSYYKSIVPLMISNCHKAHQTIPGYDKCKPEVEAFKWFDGINIPVHGYIDLKGDKVIIEDKCKMPRRGIVKKDGTRSWFPGKLPDRPSPYNLLQVDFYWSVFEVPVYLCYVNEKEFRVYHADNC
Ga0222634_100813483300023235Saline WaterMFVPVKDKLDKLVALTTDEQEKLSYFKSITPLMISNCHKAHQTIPGYDKCKPEVEAFKWFDGINIPVHGYIDLKGDNLIIEDKCKMPRRGIVKKDGTRSWFPGKLPVDRPSPYN
Ga0222708_1002116133300023242Saline WaterMFVPVKDKLDKLVALTPADQEKLSYYKSIVPLMISNCHKAHQTIPGYDKCKPEVEAFKWFDGVNIPIHGYIDLKGDNLIIEDKCKMPRRGIVKKDGTRSWFPGKLPVDKPSPYNLLQVDFYWSVFQVPVY
Ga0222664_103941623300023296Saline WaterMFVPVKDKLDKLVALTPADQEKLSYYKSIVPLMISNCHKAHQTIPGYDKCKPEVEAFKWFDGINIPIHGYIDLKGDNLIIEDKCKMPRRGIVKKDGTRSWFPGKLPVDKPSPYNLLQVDFYWSVFQVPVYLC
Ga0228653_104678913300024237SeawaterMFVPVQEKLDKLVALTPDDQEKLSHYKSIVPAMIANCHKAHQSIPGWESCKPEIEAFKWFDGINIPVHGYIDLKGDKVIIEDKCKMPRRGIVKKDGTRSWFPGKLPDKPSPYNLLQVDFYWSVFEVPVYLCYVN
Ga0210003_129867323300024262Deep SubsurfaceMFVPLLDKLNKIVPELHQQEEFDYYCSILPKMIANGHTAHQSIPGYETCKPEIEAFRWFDGITIPLHGYCDLKGDKLIIEDKCKFPKRGRVKKDGTRSXLTNKLPEDRPEVFHLLQI
Ga0209992_1006160873300024344Deep SubsurfaceMTFVSVQEKLDKLVALTPDDQEKLSHYKSIVPAMIANCHKAHQSIPGWESCKPEIEAFKWFDGINIPVHGYIDLKGDKVIIEDKCKMPRRGMVKKDGTRSWFPGKLPDKPSPYNLLQVDFYW
Ga0207896_106496723300025071MarineMFVPVKDKLDKLVALTPDDQEKLSYYKSIVPAMIANCHKAHQTIPGYESCKPEIEAFKWFDGINIPVHGYIDLKGDKVIIEDKCKMPRRGIVKKDGTRSWFPGKLPDRPSPYNLLQVDFYWSVFEVPVYLC
Ga0208792_104577323300025085MarineMFVPVQEKLDKLVALTPDDQEKLSHYKSIVPAMIANCHKAHQSIPGWESCKPEIEAFKWFDGINIPVHGYIDLKGDKVIIEDKCKMPRRGIVKKDGTRSWFPGKLPDKPSPYNLLQVDFYWSVFEVPVYLCYVNEKEFRVYHADNC
Ga0208792_105608123300025085MarineMFVSVQEKLDKLVALTPDDQEKLSHYKSIVPAMIANCHKAHQSIPGWESCKPEIEAFKWFDGINIPVHGYIDLKGDKVIIEDKCKMPRRGIVKKDGTRSWFPGKLPDKPSPYNLLQVDFYWSVFEVPVYLCYVNE
Ga0208919_126091713300025128MarineMFVPILEKLKKINPTTDEYDEFEHYKTIIPKMIANGHAAHQTIEGYDTCKPEIEAFRWFDGVNIPVHGYIDLKGDKVIIEDKCKFPRKGKIKKDGTRSWFTSKLPEDKPEPYNLLQVDF
Ga0209634_131598923300025138MarineMFVPVKDKLDKLVALTPDDQEKLSYYKSIVPAMIANCHKAHQTIPGYESCKPEIEAFKWFDGINIPVHGYIDLKGDKVIIEDKCKMPRRGIVKKDGTRSWFPGKLPDRPSPYNLLQVDFYWSVFE
Ga0209645_121078723300025151MarineMTFVSVQEKLDKLVALTPDDQEKLSHYKSIVPAMIANCHKAHQSIPGWESCKPEIEAFKWFDGINIPVHGYIDLKGDKVIIEDKCKMPRRGIVKKDGTRSWFPGKLPDKPSPYNLLQVDFYWSVFEVPVYLCYVNEKEFRV
Ga0209337_133407713300025168MarineMFVPVKDKLDKLVALTPDDQEKLSYYKSIVPAMIANCHKAHQTIPGYESCKPEIEAFKWFDGINIPVHGYIDLKGDKVIIEDKCKMPRRGMVKKDGTRSWFSGKLPDRPSPYNLLQVDFYWSVFEVPVYLCYVN
Ga0208032_102159713300025266Deep OceanMFVPVKDKLDKLVALTPDDQEKLSHYKSIVPAMIANCHKAHQTIPGYESCKPEIEAFKWFDGINIPVHGYIDLKGDKVIIEDKCKMPRRGIVKKDGTRSWFSGKLPDRPSPYNLLQVDFYWSVFEVPVYLCYVNEKEFRVYHAG
Ga0208303_101728383300025543AqueousMFVPVKDKLDKLVALTPDDQEKLSYYKSIVPLMIANCHKAHQTIPGYDKCKPEVEAFKWFDGINIPVHGYIDLKGDNVIIEDKCKMPRRGIVKKDGTRSWFPGKLPDRPSPHNLLQVDF
Ga0208414_100865113300025603Saline LakeMFVPVKDKLDKLVALTTDEQEKLSYFKSITPLMISNCHKAHQTIPGYDKCKPEVEAFKWFDGINIPVHGYIDLKGDNLIIEDKCKMPRRGIVKKDGTRSWFPGKLPVDRPSPYNLL
Ga0209716_1012316123300025626Pelagic MarineMFVPVKDKLDKLVALTPDDQEKLSYYKSIVPLMIANCHKAHQTIPGYDKCKPEVEAFKWFDGINIPVHGYIDLKGDNVIIEDKCKMPRRGIVKKDGTRSWFPGKLPDRPSPHNLLQVDFYYSVFEVPVYLCYVNEKEFRVYHADNC
Ga0209136_103042283300025636MarineMFVPVKDKLDKLVALTPDDQEKLSYYKSIVPLMIANCHKAHQTIPGYDKCKPEVEAFKWFDGINIPVHGYIDLKGDNVIIEDKCKMPRRGIVKKDGTRSWFPGKLPDRPSPHNLLQVDFY
Ga0208643_109964823300025645AqueousMFVPVQEKLDKLVALTPDDQEKLSYYKSIVPLMIANCHKAHQTIPGWESCKPEIEAFKWFDGINIPVHGYIDLKGDNVIIEDKCKMPRRGIVKKDGTRSWFSGKLPDRPSPYNLLQVDFYWSVFEVPVYLC
Ga0208161_106401513300025646AqueousMFVPVNDKLNKIIPELKDQDEFDHYKSIIRDMIANGHAAHQSIPGYDTCKPEIEAFRWFDGINIPVHGYCDLKGDKLIIEDKCKFPRKGIVKKDGTRSWLTKKLPENSPEPFHLLQIDFYYSVFKVPVYLCYINEKSYKVF
Ga0208134_102734113300025652AqueousMFVPVQEKLDKLVALTPDDQEKLSHYKSIVPAMIANCHKAHQSIPGWESCKPEIEAFKWFDGINIPVHGYIDLKGDKVIIEDKCKMPRRGIVKKDGTRSWFPGKLPDRPSPYNL
Ga0208134_110862713300025652AqueousMFVPVKEKLDKLVALTPDDQEKLSYYKSIVPAMIANCHKAHQTIPGYESCKPEIEAFKWFEGINIPVHGYIDLKGDNLIIEDKCKMPRRGIVKKDGTRSWFPGKLPDRPSPYNLLQVDFYWSVFEVPVYLCY
Ga0208162_103718313300025674AqueousMFVSVQEKLDKLVALTPDDQEKLSHYKSIVPAMIANCHKAHQSIPGWESCKPEIEAFKWFDGINIPVHGYIDLKGDKVIIEDKCKMPRRGMVKKDGTRSWFPGKLPDKPSPYNLLQIDFYWSVFEVPVYLCYVNEKEF
Ga0209305_125084213300025712Pelagic MarineMFVPVQEKLNKLVALTPDDQEKLSHYKSIVPAMIANCHKAHQSIPGWESCKPEIEAFKWFDGINIPVHGYIDLKGDKVIIEDKCKMPRRGIVKKDGTRSWFPGKLPDKPSPYNLLQVDFY
Ga0208899_102181713300025759AqueousMFVSVQEKLDKLVALTPDDQEKLSHYKSIVPAMIANCHKAHQSIPGWESCKPEIEAFKWFDGINIPVHGYIDLKGDKVIIEDKCKMPRRGIVKKDGTRSWFPGKLPDRPSPYNL
Ga0208899_104063573300025759AqueousMFVPVNDKLNKIVPELKDQDEFDHYKSIIRDMIANGHAAHQSIPGYDTCKPEIEAFRWFDGINIPVHGYCDLKGDKLIIEDKCKFPRKGIVKKDGTRSWLTKKLPENSPEPFHLLQIDFYYSVFKVPVYLCYINEKSYKVFHAGNCEELKPENIEKRIPKIIQRC
Ga0208425_105326033300025803AqueousMFVPVNDKLNKIVPELKDQDEFDHYKSIIRDMIANGHAAHQSIPGYDTCKPEIEAFRWFDGINIPVHGYCDLKGDKLIIEDKCKFPRKGIVKKDGTRSWLTKKLPENSPEPFHLLQIDFYYSVFKVPVYLCYINEKSYK
Ga0208425_105872523300025803AqueousMFVPLKEKLNRFIPDIKIQEEFEYYKTILPKMIANGHAAHQSIPGYDTCKPEIEAFRWFDGINIPVHGYCDLKGDKLIIEDKCQFPRKGIIKKDGTRSWSTSKLPEDSPKNFHLLQVDFYYSVFKVPIYLCYINEKSYKVFHADNCEELKPENIEKRIPRIIQR
Ga0208542_105406613300025818AqueousMFVPVKDKLDKLVALTPDDQEKLSYYKSIVPLMIANCHKAHQTIPGYDKCKPEVEAFKWFDGINIPVHGYIDLKGDNLIIEDKCKMPRRGIVKKDGTRSWFPGKLPDRPSPHNLLQVDFYYSVFEVPVYLCYVNEKEFRVYHADN
Ga0209714_103744563300025822Pelagic MarineMFVPVKDKLDKLVALTPDDQEKLSYYKSIVPLMIANCHKAHQTIPGYDKCKPEVEAFKWFDGINIPVHGYIDLKGDNVIIEDKCKMPRRGIVKKDGTRSWFPGKLPDRPSPHNLLQVDFYYSVFEVPVYLCYVNEKEFRVYHA
Ga0208917_102311113300025840AqueousMFVPLKEKLNRFIPDIKIQEEFEYYKTILPKMIANGHAAHQSIPGYDTCKPEIEAFRWFDGINIPVHGYCDLKGDKLIIEDKCQFPRKGIIKKDGTRSWSTSKLPEDSPKNFHLLQVDFYYSVFKVPIYLCYINEKSYKVFHADNCAELKPENIEKRIPRIIQRCK
Ga0208645_116469023300025853AqueousMFVPVQEKLDKLVALTPDDQEKLNHYKSIVPAMIANCHKAHQSIPGWESCKPEIEAFKWFDGINIPVHGYIDLKGDKVIIEDKCKMPRRGIVKKDGTRSWFPGKLPDRPSPYNL
Ga0208645_125225813300025853AqueousMFVPVKEKLDKLVALTPDDQEKLSYYKSIVPAMIANCHKAHQTIPGYESCKPEIEAFKWFDGINIPVHGYIDLKGDKVIIEDKCKMPRRGIVKKDGTRSWFAGKLPDRPSPYNLLQVDFYWSVFEVPVYLCYVNEKEFRVYHAGNCD
Ga0208644_121722923300025889AqueousMFVPVKDKLDKLVALTPDDQEKLSHYKSIVPAMIANCHKAHQTIPGYESCKPEIEAFKWFDGINIPVHGYIDLKGDKVIIEDKCKMPRRGIVKKDGTRSWFPGKLPDRPSPYNLLQVDFYWSVFEVPVYLCYVNEK
Ga0209929_108564913300026187Pond WaterMFVPIEEKLKKIIPDPEYHDEFEHYKQILPSMIANGHAAHKTIPGYKTTKPEIEAFRWFDGINIPVHGYCDHKGEIIIEDKCKFPRRGRVKKDGTRSWLTSKLPENEPEPYNLLQVDFYYSVFKVPVYLCYINE
Ga0209383_108461233300027672MarineMFVPVNDKLDKLVALTPDDQEKLSYYKSIVPLMISNCHKAHQTIPGYDKCKPEVEAFKWFDGINIPVHGYIDLKGDKVIIEDKCKMPRRGIVKKDGTRSWFPGKLPDRPSPYNLLQVDFYWSVFEVPVYLCYVNEKEFRVYHAG
Ga0209815_1010448133300027714MarineMFVPVNDKLDKLVALTPDDQEKLSYYKSIVPLMISNCHKAHQTIPGYDKCKPEVEAFKWFDGINIPVHGYIDLKGDKVIIEDKCKMPRRGIVKKDGTRSWFSGKLPDRPSPYNLLQVDFYWSVFEVPVYLCYVNEKEFRVYHAGNCDE
Ga0209302_1046098523300027810MarineMFVPVNDKLDKLVALTPDDQEKLSYYKSIVPLMISNCHKAHQTIPGYDKCKPEVEAFKWFDGINIPVHGYIDLKGDKVIIEDKCKMPRRGIVKKDGTRSWFPGKLPDRPSPYN
Ga0209403_1015221913300027839MarineMFVPVNDKLDKLVALTPDDQEKLSYYKSIVPLMISNCHKAHQTIPGYDKCKPEVEAFKWFDGINIPVHGYIDLKGDKVIIEDKCKMPRRGMVKKDGTRSWFAGKLPDRPSPYNLLQVDFYWSVFEVPVYLCYVNEK
Ga0209501_1068629023300027844MarineMFVPVKDKLDKLVALTPDDQEKLSYYKSIVPLMISNCHKAHQTIPGYDKCKPEVEAFKWFDGINIPVHGYIDLKGDNLIIEDKCKMPRRGKVKIDGTRSWFPGKLPVDRPSPYNLLQVDFYWSVFQVPVYLCYVNEKEFKVFHAGNCEELKPENI
Ga0209402_1012068313300027847MarineMFVPVKDKLDKLIALTPDDQEKLSYYKSIVPLMISNCHKAHQTIPGYDKCKPEVEAFKWFDGINIPVHGYIDLKGDNLIIEDKCKMPRRGKVKIDGTRSWFPGKLPVDRPSPYNLLQVDFYWSVFQVPVYLCYVNEKEFKVFHAGNCEELKPENI
Ga0256368_104095613300028125Sea-Ice BrineMFVPVKDKLDKLVALTPDDQEKLSYYKSIVPAMIANCHKAHQTIPGYESCKPEIEAFKWFDGINIPVHGYIDLKGDKVIIEDKCKMPRRGIVKKDGTRSWFPGKLPDRPSPYNLLQVDFYWSVFEVPVYLCYVNEKEFRVYHAGNCDE
Ga0257121_109681113300028198MarineMFVSVQEKLDKLVALTPDDQEKLSHYKSIVPSMIANCHKAHQTIPGWESCKPEIEAFKWFDGINIPVHGYIDLKGDKVIIEDKCKMPRRGMVKKDGTRSWFPGKLPDKPSPYNLLQVDFYWSVFEVPVYLCYVNEKEFRVYHADNCDELKPENIK
Ga0135211_102611613300029293Marine HarborMFVPVLEKLKKINPTTDEYDEFEHYKLILPKMIANGHAAHQTIPGFDTCKPEIEAFRWFDGINIPVHGYIDLKGDKVIIEDKCKFPRKGKIKKDGTRSWFTSKLPEDKPEPFNLLQVDFYWSVFKVPVYLCYINEETFKVFHAVDRDWETKT
Ga0135212_102868123300029306Marine HarborMFVPVLEKLKKINPTTDEYDEFEHYKSILPKMIANGHAAHQTIPGYDTCKPEIEAFRWFDGINIPVHGYIDLKGDKVIIEDKCKFPRKGKIKKDGTRSWFTSKLPEDKPEPFNLLQVDFYWSVFKVPVYLCYINEESFKVFHACDRDWETKT
Ga0307488_1034730613300031519Sackhole BrineMFVPVKDKLDKLVALTPDDQEKLSYYKSIVPLMIANCHKAHQTIPGYESCKPEIEAFKWFDGINIPVHGYIDLKGDKVIIEDKCKMPRRGIVKKDGTRSWFPGKLPDRPSPYNLLQVDFYWSVFEVPVYLCYVNEKEFRVYHA
Ga0307489_1003672113300031569Sackhole BrineMFVPVNDKLDKLVALTPDDQEKLSYYKSIVPLMISNCHKAHQTIPGYDKCKPEVEAFKWFDGINIPVHGYIDLKGDKVIIEDKCKMPRRGIVKKDGTRSWFPGKLPDRPSPYNLLQVDFYWSVFEVPVYLCYVNEKEFRVYH
Ga0307376_1059935823300031578SoilMFVPLLDKLNKIVPELHQQEEFDYYCSILPKMIANGHAAHQSIPGYETCKPEIEAFRWFDGITIPVHGYCDLKGDKLIIEDKCKFPKRGRVKKDGTRSWLTNKLPEDRPEAFHLLQIDFYWSVFKVPVYLCYI
Ga0307376_1066525813300031578SoilMFVPVKDKLDKLVALTTDEQEKLSYFKSITPLMISNCHKAHQTIPGYDKCKPEVEAFKWFDGINIPVHGYIDLKGDNLIIEDKCKMPRRGIVKKDGTRSWFPGKLPVDRPSPYNLLQVDFYWSVFQVPVYLCYVNEVEFKVFHAGNCDEL
Ga0307985_1002952513300031629MarineMFVPVNDKLDKLVALTPDDQEKLSYYKSIVPLMISNCHKAHQTIPGYDKCKPEVEAFKWFDGINIPVHGYIDLKGDKVIIEDKCKMPRRGIVKKDGTRSWFPGKLPDRPSPYNLLQVDFYWSVFEVPVY
Ga0307375_1033572433300031669SoilMFVPVQEKLDKLVALTPDDQEKLSYYKSIVPLMIANCHKAHQTIPGWESCKPEIEAFKWFDGINIPVHGYIDLKGDNLIIEDKCKMPRRGMVKKDGTRSWFSGKLPDRPSPYNLLQVDFYWSVFEVPVYLCYV
Ga0307377_1056377413300031673SoilMFVPVQEKLDKLVALTPDDQEKLSYYKSIVPLMIANCHKAHQTIPGWESCKPEIEAFKWFDGINIPVHGYIDLKGDNVIIEDKCKMPRRGIVKKDGTRSWFSGKLPDRPSPYNLLQVDFYYSVFEVPVYLCY
Ga0307995_102570713300031696MarineMFVPVNDKLDKLVALTPDDQEKLSYYKSIVPLMISNCHKAHQTIPGYDKCKPEVEAFKWFDGINIPVHGYIDLKGDKVIIEDKCKMPRRGIVKKDGTRSWFPGKLPDRPSPYNLLQVDFYWSVFEVPVYLCYVNEKE
Ga0315315_1151121613300032073SeawaterMFVPVKDKLDKLVALTPDDQEKLSHYKSIVPAMIANCHKAHQSIPGWESCKPEIEAFKWFDGINIPVHGYIDLKGDKVIIEDKCKMPRRGIVKKDGTRSWFPGKLPDKPSPYN
Ga0316205_1029477513300032257Microbial MatMFVPVKDKLDKLVALTPDDQEKLSHYKSIVPLMIANCHKAHQTIPGYESCKPEIEAFKWFDGINIPVHGYIDLKGDKVIIEDKCKMPRRGMVKKDGTRSWFPGKLPDKPSPYNLLQVDFYWSVFE
Ga0316203_101314293300032274Microbial MatMFVPVKEKLDKLVALTPDDQEKLSYYKSIVPAMIANCHKAHQTIPGYESCKPEIEAFKWFDGINIPVHGYIDLKGDKVIIEDKCKMPRRGIVKKDGTRSWFPGKLPDRPSPYNLLQVDFYWSVFEVPVYLCYVNEK
Ga0316204_1016338163300032373Microbial MatMFVPVNDKLNKIVPELKDQDEFDHYKSIIRDMIANGHAAHQSIPGYDTCKPEIEAFRWFDGINIPVHGYCDLKGDKLIIEDKCKFPRKGIVKKDGTRSWLTKKLPENSPEPFHLLQIDFYYSVFKVPVYLCYINEKSYKVFHAGNCEELKPENIEKRIPKIIQR
Ga0348335_112128_465_8273300034374AqueousMFVPVKDKLDKLVALTPDDQEKLSHYKSIVPAMIANCHKAHQTIPGYESCKPEIEAFKWFDGINIPVHGYIDLKGDKVIIEDKCKMPRRGMVKKDGTRSWFPGKLPDKPSPYNLLQVDFY
Ga0348337_014614_3899_42613300034418AqueousMFVPLKEKLNRFIPDIKIQEEFEYYKTILPKMIANGHAAHQSIPGYDTCKPEIEAFRWFDGINIPVHGYCDLKGDKLIIEDKCQFPRKGIIKKDGTRSWSTSKLPEDSPKNFHLLQVDFY
Ga0348337_079844_3_3593300034418AqueousMFVPVQEKLDKLVALTPDDQEKLSHYKSIVPLMIANCHKAHQSIPGWESCKPEIEAFKWFDGINIPVHGYIDLKGDKVIIEDKCKMPRRGIVKKDGTRSWFPGKLPDRPSPYNLLQVDF


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.