| Basic Information | |
|---|---|
| Family ID | F030072 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 186 |
| Average Sequence Length | 45 residues |
| Representative Sequence | VRDIDWPLAITLAVVFVVMSIVRWRYFRSVARRRARRREGDDTPP |
| Number of Associated Samples | 117 |
| Number of Associated Scaffolds | 186 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 32.97 % |
| % of genes near scaffold ends (potentially truncated) | 18.28 % |
| % of genes from short scaffolds (< 2000 bps) | 83.87 % |
| Associated GOLD sequencing projects | 104 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.43 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (97.849 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil (12.366 % of family members) |
| Environment Ontology (ENVO) | Unclassified (38.710 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (48.387 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 41.10% β-sheet: 0.00% Coil/Unstructured: 58.90% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.43 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 186 Family Scaffolds |
|---|---|---|
| PF08867 | FRG | 46.24 |
| PF02633 | Creatininase | 2.15 |
| PF12867 | DinB_2 | 2.15 |
| PF01804 | Penicil_amidase | 1.08 |
| PF13426 | PAS_9 | 1.08 |
| PF04342 | DMT_6 | 1.08 |
| PF00582 | Usp | 0.54 |
| PF13091 | PLDc_2 | 0.54 |
| PF01128 | IspD | 0.54 |
| PF08245 | Mur_ligase_M | 0.54 |
| PF02368 | Big_2 | 0.54 |
| PF16921 | Tex_YqgF | 0.54 |
| PF02653 | BPD_transp_2 | 0.54 |
| PF13994 | PgaD | 0.54 |
| COG ID | Name | Functional Category | % Frequency in 186 Family Scaffolds |
|---|---|---|---|
| COG1402 | Creatinine amidohydrolase/Fe(II)-dependent FAPy formamide hydrolase (riboflavin and F420 biosynthesis) | Coenzyme transport and metabolism [H] | 2.15 |
| COG2366 | Acyl-homoserine lactone (AHL) acylase PvdQ | Secondary metabolites biosynthesis, transport and catabolism [Q] | 1.08 |
| COG3169 | Uncharacterized membrane protein, DMT/DUF486 family | Function unknown [S] | 1.08 |
| COG0746 | Molybdopterin-guanine dinucleotide biosynthesis protein A | Coenzyme transport and metabolism [H] | 0.54 |
| COG1207 | Bifunctional protein GlmU, N-acetylglucosamine-1-phosphate-uridyltransferase/glucosamine-1-phosphate-acetyltransferase | Cell wall/membrane/envelope biogenesis [M] | 0.54 |
| COG1211 | 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase | Lipid transport and metabolism [I] | 0.54 |
| COG2068 | CTP:molybdopterin cytidylyltransferase MocA | Coenzyme transport and metabolism [H] | 0.54 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 97.85 % |
| Unclassified | root | N/A | 2.15 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000956|JGI10216J12902_104063936 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 794 | Open in IMG/M |
| 3300000956|JGI10216J12902_104930822 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1766 | Open in IMG/M |
| 3300003321|soilH1_10224497 | All Organisms → cellular organisms → Bacteria | 1547 | Open in IMG/M |
| 3300004114|Ga0062593_100940494 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 879 | Open in IMG/M |
| 3300004156|Ga0062589_100525101 | All Organisms → cellular organisms → Bacteria | 1005 | Open in IMG/M |
| 3300004463|Ga0063356_101315589 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1058 | Open in IMG/M |
| 3300004643|Ga0062591_102809691 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 516 | Open in IMG/M |
| 3300005093|Ga0062594_101668784 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 664 | Open in IMG/M |
| 3300005093|Ga0062594_103087278 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 521 | Open in IMG/M |
| 3300005293|Ga0065715_10925590 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 567 | Open in IMG/M |
| 3300005327|Ga0070658_10007143 | All Organisms → cellular organisms → Bacteria | 9016 | Open in IMG/M |
| 3300005327|Ga0070658_10021940 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis | 5121 | Open in IMG/M |
| 3300005327|Ga0070658_10068921 | All Organisms → cellular organisms → Bacteria | 2893 | Open in IMG/M |
| 3300005327|Ga0070658_10554348 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → unclassified Gemmatimonadaceae → Gemmatimonadaceae bacterium | 995 | Open in IMG/M |
| 3300005328|Ga0070676_10401356 | All Organisms → cellular organisms → Bacteria | 954 | Open in IMG/M |
| 3300005329|Ga0070683_100031897 | All Organisms → cellular organisms → Bacteria | 4794 | Open in IMG/M |
| 3300005329|Ga0070683_102173069 | All Organisms → cellular organisms → Bacteria | 533 | Open in IMG/M |
| 3300005329|Ga0070683_102441149 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 501 | Open in IMG/M |
| 3300005333|Ga0070677_10012309 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis | 2970 | Open in IMG/M |
| 3300005333|Ga0070677_10513712 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 651 | Open in IMG/M |
| 3300005336|Ga0070680_100053541 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis | 3295 | Open in IMG/M |
| 3300005336|Ga0070680_100759252 | All Organisms → cellular organisms → Bacteria | 835 | Open in IMG/M |
| 3300005354|Ga0070675_100321665 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1367 | Open in IMG/M |
| 3300005355|Ga0070671_100695647 | All Organisms → cellular organisms → Bacteria | 882 | Open in IMG/M |
| 3300005355|Ga0070671_100991996 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 736 | Open in IMG/M |
| 3300005364|Ga0070673_100101209 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 2373 | Open in IMG/M |
| 3300005366|Ga0070659_100349049 | All Organisms → cellular organisms → Bacteria | 1241 | Open in IMG/M |
| 3300005366|Ga0070659_101417558 | All Organisms → cellular organisms → Bacteria | 618 | Open in IMG/M |
| 3300005436|Ga0070713_102133362 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → unclassified Gemmatimonadaceae → Gemmatimonadaceae bacterium | 543 | Open in IMG/M |
| 3300005455|Ga0070663_101058084 | All Organisms → cellular organisms → Bacteria | 708 | Open in IMG/M |
| 3300005456|Ga0070678_101194214 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 705 | Open in IMG/M |
| 3300005456|Ga0070678_101287199 | All Organisms → cellular organisms → Bacteria | 680 | Open in IMG/M |
| 3300005456|Ga0070678_101978417 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 551 | Open in IMG/M |
| 3300005518|Ga0070699_100505556 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1098 | Open in IMG/M |
| 3300005530|Ga0070679_100710624 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 948 | Open in IMG/M |
| 3300005530|Ga0070679_100960844 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → unclassified Gemmatimonadaceae → Gemmatimonadaceae bacterium | 798 | Open in IMG/M |
| 3300005530|Ga0070679_101114838 | All Organisms → cellular organisms → Bacteria | 734 | Open in IMG/M |
| 3300005535|Ga0070684_101506482 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → unclassified Gemmatimonadaceae → Gemmatimonadaceae bacterium | 634 | Open in IMG/M |
| 3300005543|Ga0070672_100862383 | All Organisms → cellular organisms → Bacteria | 799 | Open in IMG/M |
| 3300005564|Ga0070664_100664966 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 969 | Open in IMG/M |
| 3300005564|Ga0070664_100861555 | All Organisms → cellular organisms → Bacteria | 849 | Open in IMG/M |
| 3300005564|Ga0070664_100986589 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 791 | Open in IMG/M |
| 3300005616|Ga0068852_100213657 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → unclassified Gemmatimonadaceae → Gemmatimonadaceae bacterium | 1831 | Open in IMG/M |
| 3300005616|Ga0068852_100519101 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1188 | Open in IMG/M |
| 3300005842|Ga0068858_100825103 | All Organisms → cellular organisms → Bacteria | 905 | Open in IMG/M |
| 3300006046|Ga0066652_100005045 | All Organisms → cellular organisms → Bacteria | 7741 | Open in IMG/M |
| 3300006046|Ga0066652_101928456 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 529 | Open in IMG/M |
| 3300006624|Ga0101567_10602607 | All Organisms → cellular organisms → Bacteria | 748 | Open in IMG/M |
| 3300006755|Ga0079222_10249683 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1114 | Open in IMG/M |
| 3300006755|Ga0079222_10757272 | All Organisms → cellular organisms → Bacteria | 782 | Open in IMG/M |
| 3300006806|Ga0079220_11535010 | All Organisms → cellular organisms → Bacteria | 573 | Open in IMG/M |
| 3300006844|Ga0075428_100127167 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis | 2773 | Open in IMG/M |
| 3300006876|Ga0079217_10014512 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 2636 | Open in IMG/M |
| 3300006876|Ga0079217_10522066 | All Organisms → cellular organisms → Bacteria | 746 | Open in IMG/M |
| 3300006894|Ga0079215_10038921 | All Organisms → cellular organisms → Bacteria | 1765 | Open in IMG/M |
| 3300006918|Ga0079216_10033778 | All Organisms → cellular organisms → Bacteria | 2076 | Open in IMG/M |
| 3300007004|Ga0079218_13110998 | All Organisms → cellular organisms → Bacteria | 560 | Open in IMG/M |
| 3300007820|Ga0104324_128707 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 2183 | Open in IMG/M |
| 3300009094|Ga0111539_10110569 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis | 3225 | Open in IMG/M |
| 3300009156|Ga0111538_11372435 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 892 | Open in IMG/M |
| 3300009177|Ga0105248_12681454 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 568 | Open in IMG/M |
| 3300009553|Ga0105249_12138907 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 632 | Open in IMG/M |
| 3300009661|Ga0105858_1243727 | All Organisms → cellular organisms → Bacteria | 545 | Open in IMG/M |
| 3300009789|Ga0126307_10025937 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis | 4477 | Open in IMG/M |
| 3300009789|Ga0126307_10387570 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1126 | Open in IMG/M |
| 3300009789|Ga0126307_10470495 | All Organisms → cellular organisms → Bacteria | 1014 | Open in IMG/M |
| 3300009840|Ga0126313_10134735 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1851 | Open in IMG/M |
| 3300009840|Ga0126313_10426807 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1054 | Open in IMG/M |
| 3300009840|Ga0126313_11248646 | All Organisms → cellular organisms → Bacteria | 613 | Open in IMG/M |
| 3300010039|Ga0126309_10041002 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 2167 | Open in IMG/M |
| 3300010040|Ga0126308_10092871 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1835 | Open in IMG/M |
| 3300010040|Ga0126308_10195955 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1296 | Open in IMG/M |
| 3300010041|Ga0126312_10682284 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 741 | Open in IMG/M |
| 3300010042|Ga0126314_10132652 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1723 | Open in IMG/M |
| 3300010042|Ga0126314_10561234 | All Organisms → cellular organisms → Bacteria | 831 | Open in IMG/M |
| 3300010044|Ga0126310_10078729 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1933 | Open in IMG/M |
| 3300010045|Ga0126311_10076126 | All Organisms → cellular organisms → Bacteria | 2239 | Open in IMG/M |
| 3300010045|Ga0126311_10170819 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1565 | Open in IMG/M |
| 3300010166|Ga0126306_10019868 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis | 4423 | Open in IMG/M |
| 3300010166|Ga0126306_10124907 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1887 | Open in IMG/M |
| 3300010166|Ga0126306_10758450 | All Organisms → cellular organisms → Bacteria | 781 | Open in IMG/M |
| 3300012905|Ga0157296_10318573 | All Organisms → cellular organisms → Bacteria | 551 | Open in IMG/M |
| 3300012955|Ga0164298_10283729 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → unclassified Gemmatimonadaceae → Gemmatimonadaceae bacterium | 1017 | Open in IMG/M |
| 3300012955|Ga0164298_11401331 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 541 | Open in IMG/M |
| 3300012961|Ga0164302_11498121 | All Organisms → cellular organisms → Bacteria | 556 | Open in IMG/M |
| 3300012985|Ga0164308_11065932 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 722 | Open in IMG/M |
| 3300013100|Ga0157373_10054234 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → unclassified Gemmatimonadaceae → Gemmatimonadaceae bacterium | 2849 | Open in IMG/M |
| 3300013100|Ga0157373_10386585 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → unclassified Gemmatimonadaceae → Gemmatimonadaceae bacterium | 1001 | Open in IMG/M |
| 3300013104|Ga0157370_11933960 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 529 | Open in IMG/M |
| 3300013306|Ga0163162_11139501 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 884 | Open in IMG/M |
| 3300013307|Ga0157372_10725935 | All Organisms → cellular organisms → Bacteria | 1155 | Open in IMG/M |
| 3300014969|Ga0157376_11945849 | All Organisms → cellular organisms → Bacteria | 625 | Open in IMG/M |
| 3300015194|Ga0167666_1029822 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → unclassified Gemmatimonadaceae → Gemmatimonadaceae bacterium | 1441 | Open in IMG/M |
| 3300015262|Ga0182007_10290089 | All Organisms → cellular organisms → Bacteria | 598 | Open in IMG/M |
| 3300015371|Ga0132258_11448339 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1735 | Open in IMG/M |
| 3300015374|Ga0132255_100626239 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1593 | Open in IMG/M |
| 3300018465|Ga0190269_11056662 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 621 | Open in IMG/M |
| 3300018469|Ga0190270_11253993 | All Organisms → cellular organisms → Bacteria | 782 | Open in IMG/M |
| 3300018476|Ga0190274_10213959 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1710 | Open in IMG/M |
| 3300018476|Ga0190274_10395824 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1337 | Open in IMG/M |
| 3300018476|Ga0190274_11758758 | All Organisms → cellular organisms → Bacteria | 714 | Open in IMG/M |
| 3300018476|Ga0190274_12507876 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 613 | Open in IMG/M |
| 3300018920|Ga0190273_10356773 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1007 | Open in IMG/M |
| 3300018920|Ga0190273_11165586 | All Organisms → cellular organisms → Bacteria | 652 | Open in IMG/M |
| 3300019361|Ga0173482_10428594 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 623 | Open in IMG/M |
| 3300020081|Ga0206354_11504071 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → unclassified Gemmatimonadaceae → Gemmatimonadaceae bacterium | 1184 | Open in IMG/M |
| 3300020082|Ga0206353_11170330 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → unclassified Gemmatimonadaceae → Gemmatimonadaceae bacterium | 1620 | Open in IMG/M |
| 3300021339|Ga0193706_1221398 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → unclassified Gemmatimonadaceae → Gemmatimonadaceae bacterium | 508 | Open in IMG/M |
| 3300021384|Ga0213876_10684656 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 546 | Open in IMG/M |
| 3300021445|Ga0182009_10017163 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 2668 | Open in IMG/M |
| 3300022756|Ga0222622_10101431 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1771 | Open in IMG/M |
| 3300022756|Ga0222622_10283116 | All Organisms → cellular organisms → Bacteria | 1135 | Open in IMG/M |
| 3300022756|Ga0222622_11185314 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 562 | Open in IMG/M |
| 3300023263|Ga0247800_1035617 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 865 | Open in IMG/M |
| 3300025899|Ga0207642_10067542 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1688 | Open in IMG/M |
| 3300025901|Ga0207688_10103020 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1650 | Open in IMG/M |
| 3300025907|Ga0207645_10231327 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1220 | Open in IMG/M |
| 3300025909|Ga0207705_10009873 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis | 6951 | Open in IMG/M |
| 3300025909|Ga0207705_10043869 | All Organisms → cellular organisms → Bacteria | 3213 | Open in IMG/M |
| 3300025909|Ga0207705_10132230 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1858 | Open in IMG/M |
| 3300025909|Ga0207705_10155665 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1714 | Open in IMG/M |
| 3300025909|Ga0207705_10938634 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 669 | Open in IMG/M |
| 3300025909|Ga0207705_10998218 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → unclassified Gemmatimonadaceae → Gemmatimonadaceae bacterium | 647 | Open in IMG/M |
| 3300025917|Ga0207660_10350574 | All Organisms → cellular organisms → Bacteria | 1183 | Open in IMG/M |
| 3300025917|Ga0207660_10783619 | All Organisms → cellular organisms → Bacteria | 778 | Open in IMG/M |
| 3300025920|Ga0207649_10343265 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1103 | Open in IMG/M |
| 3300025921|Ga0207652_10558067 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → unclassified Gemmatimonadaceae → Gemmatimonadaceae bacterium | 1029 | Open in IMG/M |
| 3300025921|Ga0207652_10852615 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 807 | Open in IMG/M |
| 3300025921|Ga0207652_11267292 | All Organisms → cellular organisms → Bacteria | 639 | Open in IMG/M |
| 3300025924|Ga0207694_10847930 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 772 | Open in IMG/M |
| 3300025931|Ga0207644_10439043 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1071 | Open in IMG/M |
| 3300025932|Ga0207690_11001119 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → unclassified Gemmatimonadaceae → Gemmatimonadaceae bacterium | 695 | Open in IMG/M |
| 3300025934|Ga0207686_11425555 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 570 | Open in IMG/M |
| 3300025940|Ga0207691_10986872 | All Organisms → cellular organisms → Bacteria | 703 | Open in IMG/M |
| 3300025940|Ga0207691_10996666 | All Organisms → cellular organisms → Bacteria | 699 | Open in IMG/M |
| 3300025940|Ga0207691_11143675 | All Organisms → cellular organisms → Bacteria | 647 | Open in IMG/M |
| 3300025944|Ga0207661_11956014 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 532 | Open in IMG/M |
| 3300025945|Ga0207679_10099911 | All Organisms → cellular organisms → Bacteria | 2266 | Open in IMG/M |
| 3300025945|Ga0207679_11791343 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 561 | Open in IMG/M |
| 3300025945|Ga0207679_12153337 | All Organisms → cellular organisms → Bacteria | 506 | Open in IMG/M |
| 3300026142|Ga0207698_10462757 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1227 | Open in IMG/M |
| 3300026142|Ga0207698_12271029 | Not Available | 555 | Open in IMG/M |
| 3300027637|Ga0209818_1043085 | All Organisms → cellular organisms → Bacteria | 1070 | Open in IMG/M |
| 3300027809|Ga0209574_10128737 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 751 | Open in IMG/M |
| 3300027886|Ga0209486_10837437 | All Organisms → cellular organisms → Bacteria | 605 | Open in IMG/M |
| 3300028587|Ga0247828_10766001 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 608 | Open in IMG/M |
| 3300030496|Ga0268240_10002726 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 2362 | Open in IMG/M |
| 3300030496|Ga0268240_10015304 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1380 | Open in IMG/M |
| 3300031232|Ga0302323_102314908 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 612 | Open in IMG/M |
| 3300031548|Ga0307408_100421410 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1151 | Open in IMG/M |
| 3300031548|Ga0307408_100569166 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1002 | Open in IMG/M |
| 3300031731|Ga0307405_11890635 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 532 | Open in IMG/M |
| 3300031824|Ga0307413_10487673 | All Organisms → cellular organisms → Bacteria | 987 | Open in IMG/M |
| 3300031852|Ga0307410_11271317 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 643 | Open in IMG/M |
| 3300031854|Ga0310904_10423912 | All Organisms → cellular organisms → Bacteria | 877 | Open in IMG/M |
| 3300031901|Ga0307406_11569256 | Not Available | 581 | Open in IMG/M |
| 3300031938|Ga0308175_100048575 | All Organisms → cellular organisms → Bacteria | 3655 | Open in IMG/M |
| 3300031938|Ga0308175_100100664 | All Organisms → cellular organisms → Bacteria | 2661 | Open in IMG/M |
| 3300031938|Ga0308175_100195173 | All Organisms → cellular organisms → Bacteria | 1989 | Open in IMG/M |
| 3300031938|Ga0308175_100231254 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1843 | Open in IMG/M |
| 3300031938|Ga0308175_100898613 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → unclassified Gemmatimonadaceae → Gemmatimonadaceae bacterium | 974 | Open in IMG/M |
| 3300031938|Ga0308175_101061581 | All Organisms → cellular organisms → Bacteria | 897 | Open in IMG/M |
| 3300031938|Ga0308175_101336283 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 799 | Open in IMG/M |
| 3300031938|Ga0308175_101710500 | All Organisms → cellular organisms → Bacteria | 704 | Open in IMG/M |
| 3300031938|Ga0308175_103181071 | Not Available | 509 | Open in IMG/M |
| 3300031939|Ga0308174_10038738 | All Organisms → cellular organisms → Bacteria | 3140 | Open in IMG/M |
| 3300031939|Ga0308174_11210054 | All Organisms → cellular organisms → Bacteria | 644 | Open in IMG/M |
| 3300031939|Ga0308174_11646345 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → unclassified Gemmatimonadaceae → Gemmatimonadaceae bacterium | 551 | Open in IMG/M |
| 3300031995|Ga0307409_102554210 | All Organisms → cellular organisms → Bacteria | 539 | Open in IMG/M |
| 3300031996|Ga0308176_10012338 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis | 6060 | Open in IMG/M |
| 3300031996|Ga0308176_10639003 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1098 | Open in IMG/M |
| 3300031996|Ga0308176_10720291 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → unclassified Gemmatimonadaceae → Gemmatimonadaceae bacterium | 1036 | Open in IMG/M |
| 3300031996|Ga0308176_11870783 | All Organisms → cellular organisms → Bacteria | 641 | Open in IMG/M |
| 3300031996|Ga0308176_12931625 | All Organisms → cellular organisms → Bacteria | 506 | Open in IMG/M |
| 3300032002|Ga0307416_103151852 | All Organisms → cellular organisms → Bacteria | 552 | Open in IMG/M |
| 3300032004|Ga0307414_12138012 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 523 | Open in IMG/M |
| 3300032074|Ga0308173_10059693 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis | 2819 | Open in IMG/M |
| 3300032074|Ga0308173_10708634 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 920 | Open in IMG/M |
| 3300032074|Ga0308173_12038287 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 541 | Open in IMG/M |
| 3300032075|Ga0310890_10629780 | All Organisms → cellular organisms → Bacteria | 833 | Open in IMG/M |
| 3300032080|Ga0326721_10097576 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → unclassified Gemmatimonadaceae → Gemmatimonadaceae bacterium | 1398 | Open in IMG/M |
| 3300032126|Ga0307415_101778743 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 596 | Open in IMG/M |
| 3300033412|Ga0310810_10069086 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae | 4269 | Open in IMG/M |
| 3300034268|Ga0372943_0248587 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → unclassified Gemmatimonadaceae → Gemmatimonadaceae bacterium | 1117 | Open in IMG/M |
| 3300034384|Ga0372946_0077996 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → unclassified Gemmatimonadaceae → Gemmatimonadaceae bacterium | 1530 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 12.37% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 11.29% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 10.22% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 9.68% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 8.06% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 5.38% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 5.38% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 4.84% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 2.69% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 2.69% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 2.15% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 2.15% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 2.15% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.61% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.61% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere | 1.61% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.61% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 1.08% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.08% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.08% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.08% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.08% |
| Glacier Forefield Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil | 0.54% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.54% |
| Sugarcane Root And Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Sugarcane Root And Bulk Soil | 0.54% |
| Permafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost Soil | 0.54% |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 0.54% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.54% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.54% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 0.54% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.54% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.54% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.54% |
| Plant Roots | Host-Associated → Plants → Roots → Unclassified → Unclassified → Plant Roots | 0.54% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.54% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.54% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.54% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.54% |
| Agave | Host-Associated → Plants → Phylloplane → Unclassified → Unclassified → Agave | 0.54% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300003321 | Sugarcane bulk soil Sample H1 | Environmental | Open in IMG/M |
| 3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
| 3300004156 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1 | Environmental | Open in IMG/M |
| 3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
| 3300004643 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3 | Environmental | Open in IMG/M |
| 3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
| 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 | Host-Associated | Open in IMG/M |
| 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Environmental | Open in IMG/M |
| 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Host-Associated | Open in IMG/M |
| 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Environmental | Open in IMG/M |
| 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Host-Associated | Open in IMG/M |
| 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
| 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Host-Associated | Open in IMG/M |
| 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
| 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Environmental | Open in IMG/M |
| 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Environmental | Open in IMG/M |
| 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Host-Associated | Open in IMG/M |
| 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Host-Associated | Open in IMG/M |
| 3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
| 3300006624 | Soil microbial communities from the Leymus chinensis steppe, China - after adding 1.75 g N m- 2, yr-1 | Environmental | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
| 3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
| 3300006876 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS200 | Environmental | Open in IMG/M |
| 3300006894 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Control | Environmental | Open in IMG/M |
| 3300006918 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS100 | Environmental | Open in IMG/M |
| 3300007004 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost | Environmental | Open in IMG/M |
| 3300007820 | Permafrost core soil microbial communities from Svalbard, Norway - sample 2-12-2 Soapdenovo | Environmental | Open in IMG/M |
| 3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
| 3300009661 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil DNA_2013-062 | Environmental | Open in IMG/M |
| 3300009789 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot28 | Environmental | Open in IMG/M |
| 3300009840 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105A | Environmental | Open in IMG/M |
| 3300010039 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot56 | Environmental | Open in IMG/M |
| 3300010040 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot55 | Environmental | Open in IMG/M |
| 3300010041 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot104A | Environmental | Open in IMG/M |
| 3300010042 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105B | Environmental | Open in IMG/M |
| 3300010044 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot60 | Environmental | Open in IMG/M |
| 3300010045 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot61 | Environmental | Open in IMG/M |
| 3300010166 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot27 | Environmental | Open in IMG/M |
| 3300012905 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S013-104B-2 | Environmental | Open in IMG/M |
| 3300012955 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MG | Environmental | Open in IMG/M |
| 3300012961 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG | Environmental | Open in IMG/M |
| 3300012985 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MG | Environmental | Open in IMG/M |
| 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Host-Associated | Open in IMG/M |
| 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Host-Associated | Open in IMG/M |
| 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
| 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Host-Associated | Open in IMG/M |
| 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Host-Associated | Open in IMG/M |
| 3300015194 | Arctic soil microbial communities from a glacier forefield, Rabots glacier, Tarfala, Sweden (Sample Rb1c, glacier snout) | Environmental | Open in IMG/M |
| 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Host-Associated | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300018465 | Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 IS | Environmental | Open in IMG/M |
| 3300018469 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T | Environmental | Open in IMG/M |
| 3300018476 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 T | Environmental | Open in IMG/M |
| 3300018920 | Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 IS | Environmental | Open in IMG/M |
| 3300019361 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2 (version 2) | Environmental | Open in IMG/M |
| 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300021339 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3c1 | Environmental | Open in IMG/M |
| 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Host-Associated | Open in IMG/M |
| 3300021445 | Bulk soil microbial communities from the field in Mead, Nebraska, USA - 072115-187_1 MetaG | Environmental | Open in IMG/M |
| 3300022756 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1 | Environmental | Open in IMG/M |
| 3300023263 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S092-311B-6 | Environmental | Open in IMG/M |
| 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027637 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS200 (SPAdes) | Environmental | Open in IMG/M |
| 3300027809 | Agave microbial communities from Guanajuato, Mexico - Mg.Ma.rz (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027886 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost (SPAdes) | Environmental | Open in IMG/M |
| 3300028587 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day3 | Environmental | Open in IMG/M |
| 3300030496 | Bulk soil microbial communities from Mexico - Penjamo (Pe) metaG (v2) | Environmental | Open in IMG/M |
| 3300031232 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_3 | Environmental | Open in IMG/M |
| 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Host-Associated | Open in IMG/M |
| 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Host-Associated | Open in IMG/M |
| 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Host-Associated | Open in IMG/M |
| 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Host-Associated | Open in IMG/M |
| 3300031854 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D1 | Environmental | Open in IMG/M |
| 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Host-Associated | Open in IMG/M |
| 3300031938 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1 | Environmental | Open in IMG/M |
| 3300031939 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R2 | Environmental | Open in IMG/M |
| 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Host-Associated | Open in IMG/M |
| 3300031996 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R2 | Environmental | Open in IMG/M |
| 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Host-Associated | Open in IMG/M |
| 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Host-Associated | Open in IMG/M |
| 3300032074 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R1 | Environmental | Open in IMG/M |
| 3300032075 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D3 | Environmental | Open in IMG/M |
| 3300032080 | Soil microbial communities from Southern Great Plains, Lamont, Oklahoma, United States - SGP_1_2016 | Environmental | Open in IMG/M |
| 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Host-Associated | Open in IMG/M |
| 3300033412 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NC | Environmental | Open in IMG/M |
| 3300034268 | Forest soil microbial communities from Eldorado National Forest, California, USA - SNFC_MG_FRD_1.2 | Environmental | Open in IMG/M |
| 3300034384 | Forest soil microbial communities from Eldorado National Forest, California, USA - SNFC_MG_KNG_2.2 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI1027J12803_1075238872 | 3300000955 | Soil | MHNIDWPLAITLAVVFVVMSIVRWRYFRSLARRRARRAEESAGADR |
| JGI10216J12902_1040639362 | 3300000956 | Soil | VRDIDWPLAIVLAVVFVVMSVLRWRYFRSVARRRARPPERDDTPR* |
| JGI10216J12902_1049308223 | 3300000956 | Soil | VSDIDWPLAITLAVVFVVMSVLRWRYFRSVARRRARRAESDDAPR* |
| soilH1_102244974 | 3300003321 | Sugarcane Root And Bulk Soil | MKEIDWPLAIVLAVAFVVMSVVRWRYFKSLARRRSQAARKDPPSD* |
| Ga0062593_1009404942 | 3300004114 | Soil | VSVRDVDWPLAITLAVVFVVMSLVRWRYFRSLARRRARRLEGKDAPR* |
| Ga0062589_1005251012 | 3300004156 | Soil | VRDIDWPLAILLAVMFVVMSVFRWRYFRSVARRRAQRREDGGSTP* |
| Ga0063356_1013155892 | 3300004463 | Arabidopsis Thaliana Rhizosphere | VRDIDWPLAITLAVVFVVMSVVRWRYFRSVARRRARPPEGDDSPR* |
| Ga0062591_1028096912 | 3300004643 | Soil | VRDIDWPLAITLAVMFVVISIVRWRYFRSVARRRARRREEHDAPP* |
| Ga0062594_1016687842 | 3300005093 | Soil | MRDIDWPLAITLAVVFVVMSVVRWRYFRSVARRRARPPKGDDTPR* |
| Ga0062594_1030872782 | 3300005093 | Soil | VRDIDWPLAITLAVMFVVISIVRWRYFRSVARRRAQRREGDDAPH* |
| Ga0065715_109255902 | 3300005293 | Miscanthus Rhizosphere | MSDIDWPLAITLAVVFVVMSVVRWRYFRSVARRRARPPKGDDTPR* |
| Ga0070658_100071435 | 3300005327 | Corn Rhizosphere | VKNIDWPLAIVLGVVFVAMSVVRWRYFKSLARRRNEARRKRPPPD* |
| Ga0070658_100219406 | 3300005327 | Corn Rhizosphere | VKDIDWPLAIVLVVVFVVMSVVRWRYFKSLARRRSQARRKEPPTG* |
| Ga0070658_100689215 | 3300005327 | Corn Rhizosphere | VKDIDWPLAITLAVVFVVMSVVRWRYFKSLARRRSQRPPAPRD* |
| Ga0070658_105543482 | 3300005327 | Corn Rhizosphere | MKDVDWPLAITLAVVFVVMSVVRWRYFKSLARRRRRPPPQDPPAA* |
| Ga0070676_104013561 | 3300005328 | Miscanthus Rhizosphere | DWPLAITLAVVFVVMSVVRWRYFRSVARRRARPPKGDDTPR* |
| Ga0070683_1000318976 | 3300005329 | Corn Rhizosphere | VRDIDWPLAITLAVVFVVMSIVRWRYFRSVARRRARRREGNDTPS* |
| Ga0070683_1021730692 | 3300005329 | Corn Rhizosphere | MRDIDWPLAITLAVMFVVISIVRWRYFRSVARRRAQRREGDDAPH* |
| Ga0070683_1024411492 | 3300005329 | Corn Rhizosphere | MRDVDWPLAITLAVVFVVMSIVRWRYFRSVARRRARRLEGDDPPR* |
| Ga0070677_100123096 | 3300005333 | Miscanthus Rhizosphere | MRDIDWPLAITLAVVFVVMSVVRWRYFRSVARRRARLPKGDDTPR* |
| Ga0070677_105137122 | 3300005333 | Miscanthus Rhizosphere | VRDVDWPLAITLAVMFVVISIVRWRYFRSVARRRARRRDDDAPP* |
| Ga0070680_1000535414 | 3300005336 | Corn Rhizosphere | VKDIDWPLAIVLGVAFVVMSVVRWRYFKSLARRRSQASRKGPPPA* |
| Ga0070680_1007592522 | 3300005336 | Corn Rhizosphere | MKDIDWPLAIVLVVVFVVMSVARWRYFQSLARRRRRPPRDGPPPG* |
| Ga0070675_1003216653 | 3300005354 | Miscanthus Rhizosphere | VRDIDWPLAITLAVVFVVMSIVRWRYFRSVARRRARRREGDDTRP* |
| Ga0070671_1006956472 | 3300005355 | Switchgrass Rhizosphere | RDIDWPLAITLAVVFVVMSIVRWRYFRSVARRRARRREGDDTRP* |
| Ga0070671_1009919961 | 3300005355 | Switchgrass Rhizosphere | MHSIDWPLAITLAVVFVVMSIVRWRYFRSLARRRARRAEES |
| Ga0070673_1001012093 | 3300005364 | Switchgrass Rhizosphere | VRDIDWPLAITLAVMFVVMSIVRWRYFRSVARRRAQRREGDDAPH* |
| Ga0070659_1003490492 | 3300005366 | Corn Rhizosphere | IDWPLAITLAVMFVVISIVRWRYFRSVARRRAQRREGDDAPH* |
| Ga0070659_1014175582 | 3300005366 | Corn Rhizosphere | VKDIDWPLAIVLGVAFVVMSVVRWHYFQSRARRRRQPPREGPPPG* |
| Ga0070713_1021333622 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | VRNVDWPLAIVLAIVFVVMSVVRWRYFKGLARRRGERQRREPPGGRGGGA* |
| Ga0070663_1010580842 | 3300005455 | Corn Rhizosphere | MRDIDWPLAITLAVMFVVMSIVRWRYFRSVARRRAQRREGDDAPH* |
| Ga0070678_1011942142 | 3300005456 | Miscanthus Rhizosphere | MHNIDWPLAITLAVVFVVMSIVRWRYFRSVARRRARRAEESSGV |
| Ga0070678_1012871992 | 3300005456 | Miscanthus Rhizosphere | IDWPLAITLAVVFVVMSVVRWRYFRSVARRRARLPKGDDTPR* |
| Ga0070678_1019784172 | 3300005456 | Miscanthus Rhizosphere | VRGIDWPLAITLAVVFVVMSVLRWRYFRSVARRRARRRENDGAGS* |
| Ga0070699_1005055561 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | MRNVDWPLAVTMAIVFVVMSVVRWRYFRSLARRTARRAEQRDSPPK* |
| Ga0070679_1007106242 | 3300005530 | Corn Rhizosphere | VRDIDWPLAITLAVVFVVMSVLRWRYFRSVARRRARRRENDGAGS* |
| Ga0070679_1009608441 | 3300005530 | Corn Rhizosphere | MKDIDWPLAITLVVVFVVMSVVRWRYFQSLARRRRKPPGEGSPPG* |
| Ga0070679_1011148382 | 3300005530 | Corn Rhizosphere | VKDVDWPLAIVLGVAFVVMSVVRWRYFKSLARRRSQRQRDGKPPA* |
| Ga0070684_1015064821 | 3300005535 | Corn Rhizosphere | VKDIDWPLAIVLGVVFVVMSVVRWRYFKSLARRRSQARRKEPP |
| Ga0070672_1008623832 | 3300005543 | Miscanthus Rhizosphere | VSNVDWPLAIMLAVVFVVMSVVRWRYFRSAARRWSRRTEKDPPRD* |
| Ga0070664_1006649663 | 3300005564 | Corn Rhizosphere | VRDIDWPLAITLAVVFVVMSIVRWRYFRSVARRRARRREGDDTPP* |
| Ga0070664_1008615551 | 3300005564 | Corn Rhizosphere | DIDWPLAITLAVVFVVMSIVRWRYFRSVARRRARRREGNDTPS* |
| Ga0070664_1009865892 | 3300005564 | Corn Rhizosphere | VRDIDWPLAITLAVMFVVISFVRWRYFRSVARRRAQRREGDDAPH* |
| Ga0068852_1002136571 | 3300005616 | Corn Rhizosphere | MKDVDWPLAITLAVVFVVMSVVRWRYFKSLARRRRKAGTQDPPAG* |
| Ga0068852_1005191012 | 3300005616 | Corn Rhizosphere | VNGIDWPLAVTLAFVFVVMSFLRWRYFRSRARRLDRERARREPPVS* |
| Ga0068858_1008251032 | 3300005842 | Switchgrass Rhizosphere | VRDFDWPLAITLAVMFVVISIVRWRYFRSVARRRAQRREGDDAPH* |
| Ga0066652_1000050452 | 3300006046 | Soil | MRDVDWPLAIVLAVVFVAMSVVRWRYFRSVARRRARRPEGDDTPR* |
| Ga0066652_1019284562 | 3300006046 | Soil | MHNIDWPLAITLAVVFVVMSVVRWRYFKSLARRRARRTEL |
| Ga0101567_106026071 | 3300006624 | Soil | VKNIDWPLAILLAVVFVVMSVVRWRYFQSRARRRSQRPPRPRE* |
| Ga0079222_102496832 | 3300006755 | Agricultural Soil | MHDVDWPLAITLAVVFVVMSVVRWRYFRSVARRRAQRREGGESSP* |
| Ga0079222_107572722 | 3300006755 | Agricultural Soil | RYPRHFHRLMKNIDWPLAIVLGVVFVAMSVVRWRYFKSLARRRNQARREGPPPS* |
| Ga0079220_115350102 | 3300006806 | Agricultural Soil | MKDIDWPLAIVLGVAFVVMSVVRWHYFQSRARRRRQPPREGPPPV* |
| Ga0075428_1001271675 | 3300006844 | Populus Rhizosphere | VRDIDWPLAITLAVVFVVMSVVRWRYFRSVARRRARRTEDDDTPR* |
| Ga0079217_100145125 | 3300006876 | Agricultural Soil | VSDVDWPLAITLGVVFVVMSVFRWRYFRSVARRRAQRREDDGTPG* |
| Ga0079217_105220662 | 3300006876 | Agricultural Soil | MGDIDWPLAITLAVVFVVMSVLRWRYFRSVARRRARRPEGDDTPR* |
| Ga0079215_100389212 | 3300006894 | Agricultural Soil | VSDVDWPLAITLGVVFVVMSVFRWRYFRSVARRRAQRRDDDGTPG* |
| Ga0079216_100337782 | 3300006918 | Agricultural Soil | VSDVDWPLAITLGVVFVVMSVFRWRYFRSVARRRTQRREDDGTPG* |
| Ga0079218_131109981 | 3300007004 | Agricultural Soil | RLDRALAVSDIDWPLAITLAVVFVVMSVLRWRYFRSVARRRARRPEGDDTPR* |
| Ga0104324_1287074 | 3300007820 | Soil | VKNIDWPLAITLTIVFVVMSLVRWRYFRSLARRRRRQSPRDGGAPPT* |
| Ga0111539_101105696 | 3300009094 | Populus Rhizosphere | VRDIDWPLAITLAVMFVLISIVRWRYFRSVARRRAQRRDGDDAPH* |
| Ga0111538_113724352 | 3300009156 | Populus Rhizosphere | MRDIDWPLAITLAVVFVVMSIVRWRYFRSVARRRARRREGDDTPS* |
| Ga0105248_126814542 | 3300009177 | Switchgrass Rhizosphere | VSNVDWPLAITLAVVFVVMSVVRWRYFRSVARRRARRAEQEPPRE* |
| Ga0105249_121389072 | 3300009553 | Switchgrass Rhizosphere | VREIDWPLALTLAVVFVVMSVVRWRYFRSVARRRAKRA |
| Ga0105858_12437272 | 3300009661 | Permafrost Soil | VIDIDWPLAITLAVVFVVMSVVRWRYFKSAAKRWGRGRTPPGE* |
| Ga0126307_100259375 | 3300009789 | Serpentine Soil | VRDIDWPLAITLAIVFVVMSVVRWRYFRSVARRRARRSEQGDSST* |
| Ga0126307_103875702 | 3300009789 | Serpentine Soil | VRDVDWPLAITLAIVFVLMSVVRWRYFRSVARRRARRSEHGDSPP* |
| Ga0126307_104704952 | 3300009789 | Serpentine Soil | MRDIDWPLAITLAVMFVVMSVVRWRYFRSVARRRARPPEGDDTPR* |
| Ga0126313_101347354 | 3300009840 | Serpentine Soil | VRDVDWPLAITLAIVFVVMSVVRWRYFRSVARRRARRSDEGDSVT* |
| Ga0126313_104268072 | 3300009840 | Serpentine Soil | VRDIDWPLAITLVVVFVVMSIFRWRYFRSVARRRTRRPEGDDKRP* |
| Ga0126313_112486462 | 3300009840 | Serpentine Soil | VSDIDWPLAITLAVVFVVMSVVRWRYFRSVARRRARRTEGDDRPR* |
| Ga0126309_100410022 | 3300010039 | Serpentine Soil | VRDIDWPLAITLAILFVVMSVVRWRYFRSVARRRARRSDHGDSAT* |
| Ga0126308_100928712 | 3300010040 | Serpentine Soil | VRDIDWPLAITLAIVFVVMSVVRWRYFRSVARRRARRSDQGDSAT* |
| Ga0126308_101959553 | 3300010040 | Serpentine Soil | MRDVDWPLAITLAIVFVVMSVVRWRYFRSVARRRRRSAEGSDAPP* |
| Ga0126312_106822842 | 3300010041 | Serpentine Soil | VRDVDWPLAITLAIVFVVMSVVRWRYFRSVARRRARRSD |
| Ga0126314_101326524 | 3300010042 | Serpentine Soil | VRDVDWPLAITLAIVFIVMSVVRWHYFRSVARRRARRSDEGDSVT* |
| Ga0126314_105612342 | 3300010042 | Serpentine Soil | MRDIDWPLAITLVVVFVVMSIFRWRYFRSVARRRARRPDGDDQRP* |
| Ga0126310_100787293 | 3300010044 | Serpentine Soil | VRDVDWPLAITLAIVFVVMSVVRWRYFRSVARRRARRSDESDSVT* |
| Ga0126311_100761264 | 3300010045 | Serpentine Soil | VRDVDWPLAITLAIVFIVMSVVRWRYFRSVARRRARRSDEGDSVT* |
| Ga0126311_101708194 | 3300010045 | Serpentine Soil | VRDIDWPLAITLAIVFVVMSVVRWRYFRSVARRRARRSDEGDSVT |
| Ga0126306_100198685 | 3300010166 | Serpentine Soil | VRDVDWPLAITLAIVFVVMSVVRWRYFRSVARRRARRSDEDDSAT* |
| Ga0126306_101249073 | 3300010166 | Serpentine Soil | VRDVDWPLAISLAIVFVVMSVVRWRYFRSVARRRARGSNQGDSAP* |
| Ga0126306_107584501 | 3300010166 | Serpentine Soil | DRVRDIDWPLAVTLAIVFVVMSVVRWRYFRSVARRRTRPPTGDDVPPP* |
| Ga0157296_103185732 | 3300012905 | Soil | VSNVDWPLAITLAVVFVVMSVVRWRYFRSVARRRARPPKGDDTPR* |
| Ga0164298_102837291 | 3300012955 | Soil | VDWPLAIVLAIVFVVMSVVRWRYFKGLARRRGERQRREPPGGRGGGA* |
| Ga0164298_114013311 | 3300012955 | Soil | MHDIDWPLAITLAVVFLVMSVVRWRYFRSVARRRAKQREPDDTLP* |
| Ga0164302_114981212 | 3300012961 | Soil | MRNVDWPLAITLAVVFVVMSVVRWRYFKGLARRRSQRDRKEPPQG* |
| Ga0164308_110659322 | 3300012985 | Soil | MHNIDWPLAITLAVVFVVMSIVRWRYFRSVARRRARRAEESSGVDR |
| Ga0157373_100542341 | 3300013100 | Corn Rhizosphere | VKDIDWPLAIVLGVAFVVMSVVRWHYFQSRARRRRQPPREGPPPV* |
| Ga0157373_103865852 | 3300013100 | Corn Rhizosphere | VKNIDWPLAIMLGVVFVAMSVVRWRYFKSLARRRSKRQHQGPPPPA* |
| Ga0157370_119339601 | 3300013104 | Corn Rhizosphere | MRDIDWPLAITLAVVFVVMSIVRWRYFRSLARRRARREEASGAD |
| Ga0163162_111395012 | 3300013306 | Switchgrass Rhizosphere | VRDIDWPLAITLAVMFVVISIVRWRYFRSVARRRAQRREGADAPH* |
| Ga0157372_107259352 | 3300013307 | Corn Rhizosphere | MRNVDWPLAITLAVVFVVMSIVRWRYFKGLARRRSQRDRKEPPQG* |
| Ga0157376_119458492 | 3300014969 | Miscanthus Rhizosphere | GDRVSNVDWPLAITLAVVFVVMSVVRWRYFRSVARRRARRAEQDPPRE* |
| Ga0167666_10298224 | 3300015194 | Glacier Forefield Soil | VDWPLALGLIVVFVVMSMVRWRYFKSLARRRDAARRQKEAPPTP* |
| Ga0182007_102900892 | 3300015262 | Rhizosphere | MRDVDWPLAITLALMFVVMSTVRWRYFRSVARRRTERRARDEAAP* |
| Ga0132258_114483391 | 3300015371 | Arabidopsis Rhizosphere | MQNIDWPLAITLAVVFVVMSLVRWRYFRSLARRRGLRDTAP |
| Ga0132255_1006262394 | 3300015374 | Arabidopsis Rhizosphere | VREIDWPLAITLAVVFVLMSVVRWRYFRSLARRRAKRAEDVERGGPPE |
| Ga0190269_110566622 | 3300018465 | Soil | VSDIDWPLAITLAVVFVVMSVFRWRYFRSVARRRAQRSEGDGTPG |
| Ga0190270_112539932 | 3300018469 | Soil | VRDIDWPLAITLAVVFVVMSVVRWRYFRSVARRRAKRSESDDTPR |
| Ga0190274_102139593 | 3300018476 | Soil | VRDIDWPLAITLAVVFVVMSIVRWRYFRSVARRRARRSESDDTPR |
| Ga0190274_103958242 | 3300018476 | Soil | VSNVDWPLAIMLAVVFVVMSVVRWRYFRSVARRRARRSEQDPPRE |
| Ga0190274_117587582 | 3300018476 | Soil | MRDVDWPLAGTLAIVFVVMSVVRWRYFRSVARRAERKPGREDAPPS |
| Ga0190274_125078762 | 3300018476 | Soil | VRDIDWPLAITLAIVFVVMSVVRWRYFRSVARRRAERSNRGDPRS |
| Ga0190273_103567732 | 3300018920 | Soil | MSDVDWPLAIGLAIVFVVMSLVRWRYFKSVARRMSRDRTRDEPPPSA |
| Ga0190273_111655862 | 3300018920 | Soil | VRDVDWPLAITLAIVFVVMSVVRWRYFRSVARRRARRPDQGDSST |
| Ga0173482_104285942 | 3300019361 | Soil | MRDIDWPLAITLAVVFVVMSVVRWRYFRSVARRRARQREGDDEQ |
| Ga0206354_115040713 | 3300020081 | Corn, Switchgrass And Miscanthus Rhizosphere | VKDIDWPLAIVLVVVFVVMSVVRWRYFKSLARRRSQARRKEPPTG |
| Ga0206353_111703302 | 3300020082 | Corn, Switchgrass And Miscanthus Rhizosphere | VKDIDWPLAIVLVVVFVVMSVVRWRYFKSLARRRSQARHKEPPAG |
| Ga0193706_12213982 | 3300021339 | Soil | MKHIDWPFAITLAIIFVVMSVVRWRYFQSLARRRSRRASVTRVPPSA |
| Ga0213876_106846562 | 3300021384 | Plant Roots | VSNIDWPLAIMLAVVFVVMSVVRWRYFRSVARRRSNRMPQDPPRD |
| Ga0182009_100171634 | 3300021445 | Soil | MRGVDWPLAITLAVVFVVMSVFRWRYFRSVARRRAQRRERDETSV |
| Ga0222622_101014312 | 3300022756 | Groundwater Sediment | MRDIDWPLAITLAVVFVVMSVVRWRYFRSVARRRARLPKGDDTPR |
| Ga0222622_102831162 | 3300022756 | Groundwater Sediment | VRDIDWPLAITLAVVFVVMSIVRWRYFRSVARRRARRREGNDTPS |
| Ga0222622_111853142 | 3300022756 | Groundwater Sediment | VSDIDWPLAITLAVVFVVMSVVRWRYFRSVARRRARRTEGDDRPH |
| Ga0247800_10356172 | 3300023263 | Soil | MSDIDWPLAITLAVVFVVMSVVRWRYFRSVARRRARPPKGDDTPR |
| Ga0207642_100675421 | 3300025899 | Miscanthus Rhizosphere | MQNVDWPLAITLAVMFIVISIVRWRYFRSLARRRARRE |
| Ga0207688_101030202 | 3300025901 | Corn, Switchgrass And Miscanthus Rhizosphere | VRDIDWPLAITLAVMFVVISIVRWRYFRSVARRRAQRREGDDAPH |
| Ga0207645_102313273 | 3300025907 | Miscanthus Rhizosphere | VRDIDWPLAITLAVVFVVMSVVRWRYFRSVARRRARPPKGDDTPR |
| Ga0207705_100098736 | 3300025909 | Corn Rhizosphere | VKNIDWPLAIVLGVVFVAMSVVRWRYFKSLARRRNEARRKRPPPD |
| Ga0207705_100438695 | 3300025909 | Corn Rhizosphere | VKDIDWPLAITLAVVFVVMSVVRWRYFKSLARRRSQRPPAPRD |
| Ga0207705_101322303 | 3300025909 | Corn Rhizosphere | VKDIDWPLAIVLGVVFVVMSVVRWRYFKSLARRRSQARPKEPPAG |
| Ga0207705_101556652 | 3300025909 | Corn Rhizosphere | MSQVDWPLAIMLAVVFIVMSVVRWRYFRSAAKRWGRRPPSDDAPTG |
| Ga0207705_109386342 | 3300025909 | Corn Rhizosphere | VRDIDWPLAITLAVVFVVMSIVRWRYFRSVARRRARRREGDDTRP |
| Ga0207705_109982182 | 3300025909 | Corn Rhizosphere | VKDVDWPLAIVLGVAFVVMSVVRWHYFQSRARRRRGPPREGPPPG |
| Ga0207660_103505742 | 3300025917 | Corn Rhizosphere | MKDIDWPLAIVLVVVFVVMSVARWRYFQSLARRRRRPPRDGPPPG |
| Ga0207660_107836191 | 3300025917 | Corn Rhizosphere | AIVLGVAFVVMSVVRWRYFKSLARRRSQRQRDGKPPA |
| Ga0207649_103432653 | 3300025920 | Corn Rhizosphere | VRDIDWPLAITLAVMFVVISIVRWRYFRSVARRRAQRRE |
| Ga0207652_105580672 | 3300025921 | Corn Rhizosphere | VKDIDWPLAIVLGVAFVVMSVVRWHYFQSRARRRRQPPREGPPPV |
| Ga0207652_108526152 | 3300025921 | Corn Rhizosphere | VRDIDWPLAITLAVVFVVMSVLRWRYFRSVARRRARRRENDGAGR |
| Ga0207652_112672922 | 3300025921 | Corn Rhizosphere | VKDVDWPLAIVLGVAFVVMSVVRWRYFKSLARRRSQRQRDGKPPA |
| Ga0207694_108479303 | 3300025924 | Corn Rhizosphere | VRDFDWPLAITLAVMFVVISIVRWRYFRSVARRRAQRREGDDAPH |
| Ga0207644_104390433 | 3300025931 | Switchgrass Rhizosphere | VRDIDWPLAITLAVMFVVISIVRWRYFRSVARRRAQRREGGDAPH |
| Ga0207690_110011192 | 3300025932 | Corn Rhizosphere | VKDIDWPLAIVLGVAFVVMSVVRWHYFQSRARRRRQPPREGPPPG |
| Ga0207686_114255552 | 3300025934 | Miscanthus Rhizosphere | VRDVDWPLAITLAVMFVVISIVRWRYFRSVARRRARRRDDDAPP |
| Ga0207691_109868721 | 3300025940 | Miscanthus Rhizosphere | VSNVDWPLAIMLAVVFVVMSVVRWRYFRSAARRWSRRTEKDPPRD |
| Ga0207691_109966662 | 3300025940 | Miscanthus Rhizosphere | VSNVDWPLAITLAVVFVVMSVVRWRYFRSVARRRARRAEQEPPRE |
| Ga0207691_111436751 | 3300025940 | Miscanthus Rhizosphere | PRVDRALTMRDIDWPLAITLAVVFVVMSVVRWRYFRSVARRRARPPKGDDTPR |
| Ga0207661_119560142 | 3300025944 | Corn Rhizosphere | MRDVDWPLAITLAVVFVVMSIVRWRYFRSVARRRARRLEGDDPPR |
| Ga0207679_100999112 | 3300025945 | Corn Rhizosphere | VRDIDWPLAILLAVMFVVMSVFRWRYFRSVARRRAQRREDGGSTP |
| Ga0207679_117913431 | 3300025945 | Corn Rhizosphere | MRDIDWPLAITLAVVFVVMSVVRWRYFRSVARRRARPPKGDDTLR |
| Ga0207679_121533372 | 3300025945 | Corn Rhizosphere | VRDIDWPLAITLAVVFVVMSIVRWRYFRSVARRRARRREGDDTPP |
| Ga0207698_104627572 | 3300026142 | Corn Rhizosphere | VNGIDWPLAVTLAFVFVVMSFLRWRYFRSRARRLDRERARREPPVS |
| Ga0207698_122710292 | 3300026142 | Corn Rhizosphere | MRNVDWPLAITLAVVFVVMSVVRWRYFRSVARRRSRRAEQDPPRD |
| Ga0209818_10430852 | 3300027637 | Agricultural Soil | DVDWPLAIALGVVFVVMSVFRWRYFRSVARRRAQRRDDDGTPG |
| Ga0209574_101287373 | 3300027809 | Agave | MRDIDWPLAITLAVVFVVMSVFRWRYFRSVARRRAQRRARDETSPR |
| Ga0209486_108374372 | 3300027886 | Agricultural Soil | VSDIDWPLAITLAVVFVVMSVLRWRYFRSVARRRARRPEGDDTPR |
| Ga0247828_107660011 | 3300028587 | Soil | VRDIDWPLAITLAVVFVVMSVVRWRYFRSVARRRARPPKSDDTPG |
| Ga0268240_100027263 | 3300030496 | Soil | MRDIDWPLAITLAVVFVVMSVFRWRYFRSVARRRAQRRERDEPSP |
| Ga0268240_100153043 | 3300030496 | Soil | MRDIDWPLAIMLAVVFVVMSVFRWRYFRSVARRRTQRRERDEPAP |
| Ga0302323_1023149082 | 3300031232 | Fen | VIDIDWPLAITLAVVFVVMSVVRWRYFKSAAKRWGKGRTPPGD |
| Ga0307408_1004214102 | 3300031548 | Rhizosphere | VNDIDWPLAITLAVVFLVMSVFRWRYFRSVARRRAERRERHDTRD |
| Ga0307408_1005691662 | 3300031548 | Rhizosphere | VNDIDWPLAITLAVVFLVMSVLRWRYFRSVARRRAERRERNDTPG |
| Ga0307405_118906352 | 3300031731 | Rhizosphere | VRDIDWPLAITLAIVFVVMSVLRWRYFRSVARRRARRAEGDDTPR |
| Ga0307413_104876732 | 3300031824 | Rhizosphere | MSDVDWPLAITLAVVFVVMSVVRWRYFKSVARRVGRDRPKDEPPPT |
| Ga0307410_112713171 | 3300031852 | Rhizosphere | VRDIDWPLAITLAVVFVVMSVFRWRYFRSVARRRAERRAGDDT |
| Ga0310904_104239122 | 3300031854 | Soil | MRDIDWPLAITLAVVFVVMSVVRWRYFRSVARRRARPPKGDDTPR |
| Ga0307406_115692562 | 3300031901 | Rhizosphere | MSEIDWPLAITLAVVFVVMSVVRWRYFKSVARRVGRDRPKDEPPPT |
| Ga0308175_1000485754 | 3300031938 | Soil | MKDIDWPLAITLAVVFVVMSVVRWRYFKSLARRRSQRPRAPRG |
| Ga0308175_1001006642 | 3300031938 | Soil | MRDVDWPLAITLAVVFVVMSIVRWRYFRSVARRRARRHEGDEPPR |
| Ga0308175_1001951731 | 3300031938 | Soil | MSQVDWPLAILLAVVFVVMSIVRWRYFRSAARRWGRRPPPPDGGSGG |
| Ga0308175_1002312542 | 3300031938 | Soil | VGDIDWPLAILLAVMFVVMSVFRWRYFRSVARRRAGRRDGGGSAP |
| Ga0308175_1008986132 | 3300031938 | Soil | VKNIDWPLAIMLGVMFVVMSVVRWRYFKSLARRRSQRQREGAPPSA |
| Ga0308175_1010615812 | 3300031938 | Soil | MRDVDWPLAITLVIVFVVMSVFRWRYFRSRASRIARKRAEREPPAS |
| Ga0308175_1013362832 | 3300031938 | Soil | VLSNVDWPLAITLAVVFVVMSVVRWRYFRSLARRRARRRELPRD |
| Ga0308175_1017105002 | 3300031938 | Soil | MRDIDWPLAITLAVVFVVMSVFRWRYFRSVARRRAQRRQGDGTPS |
| Ga0308175_1031810712 | 3300031938 | Soil | VKNIDWPLAITLAVVFVVMSVVRWRYFRSLARRRSRREGPPRG |
| Ga0308174_100387384 | 3300031939 | Soil | MRNVDWPLAITLAVVFVVMSVVRWRYFKGLARRRSQRDRKEPPQG |
| Ga0308174_112100542 | 3300031939 | Soil | WPLAIMLAVVFVVMSVVRWRYFRSVARRRARRAEQDPPRD |
| Ga0308174_116463452 | 3300031939 | Soil | MKDVDWPLAITLAVVFVVMSVVRWRYFKSLARRRRRPPPQDPPAA |
| Ga0307409_1025542101 | 3300031995 | Rhizosphere | RSVCSVNDIDWPLAITLAVVFLVMSVFRWRYFRSVARRRAERRERHDTRD |
| Ga0308176_100123383 | 3300031996 | Soil | VSNVDWPLAIMLAVVFVVMSAVRWRYFQSRARRKSRNAERTEPHE |
| Ga0308176_106390032 | 3300031996 | Soil | MRDIDWPLAITLAVVFVVMSVLRWRYFRSVARRRAQRRQGDGTPS |
| Ga0308176_107202912 | 3300031996 | Soil | VKNIDWPLAIMLGVMFVVMSVVRWRYFKSLARRRSQRQREGPPPSA |
| Ga0308176_118707832 | 3300031996 | Soil | VTDIDWPLAITLVIVFVVMSVFRWRYFRSRARRMDRAARDRAEREPPAS |
| Ga0308176_129316251 | 3300031996 | Soil | DRAVIVRDIDWPLAITLAVVFVVMSIVRWRYFRSVARRRARRREGDDTPP |
| Ga0307416_1031518522 | 3300032002 | Rhizosphere | VRDVDWPLAITLAVVFVVMSVVRWRYFRSVARRRERRARGEDGPR |
| Ga0307414_121380122 | 3300032004 | Rhizosphere | VRDIDWPLAITLAVVFVVMSVVRWRYFKSVARRVGRDRPKDEPPPT |
| Ga0308173_100596933 | 3300032074 | Soil | MHDIDWPLAITLVVVFLVTSVLRWRYFRLRARRLDRERARREPPSV |
| Ga0308173_107086342 | 3300032074 | Soil | VSNVDWPLAIMLAVVFVVMSVVRWRYFRSVARRRARRAEQDPPRD |
| Ga0308173_120382872 | 3300032074 | Soil | MRDVDWPLAITLAVVFVVMSLVRWRYFRSVARRRARRLERDDPPR |
| Ga0310890_106297802 | 3300032075 | Soil | DRALAVRDIDWPLAITLAVMFVVISIVRWRYFRSVARRRAQRREGDDAPH |
| Ga0326721_100975762 | 3300032080 | Soil | MKDIDWPLAITLVVVFVVMSVVRWRYFQSLARRRRKPPREGSPPG |
| Ga0307415_1017787432 | 3300032126 | Rhizosphere | VRDIDWPLAITLAIVFVVMSVLRWRYFRAVARRRARRAEGDDTPR |
| Ga0310810_100690865 | 3300033412 | Soil | VRDVDWPLAITLAILFVVMSVVRWRYFRARARRAERRATDDSSR |
| Ga0372943_0248587_688_822 | 3300034268 | Soil | MKNVDWPLAIALVIVFVVMSAVRWRYFRALGRRWDRAKSEKEKR |
| Ga0372946_0077996_1249_1386 | 3300034384 | Soil | MSSIDWPLAILLAVVFVVMSVLRWKYFMSVRKRTKNESPDKRTPG |
| ⦗Top⦘ |