| Basic Information | |
|---|---|
| Family ID | F030041 |
| Family Type | Metagenome |
| Number of Sequences | 186 |
| Average Sequence Length | 49 residues |
| Representative Sequence | LGVQELIDHTTISKYELDKNEPPLAILLAYARLAEIPVEQIIDDELELTI |
| Number of Associated Samples | 109 |
| Number of Associated Scaffolds | 186 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 25.27 % |
| % of genes near scaffold ends (potentially truncated) | 67.20 % |
| % of genes from short scaffolds (< 2000 bps) | 87.63 % |
| Associated GOLD sequencing projects | 96 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.40 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (52.688 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil (13.441 % of family members) |
| Environment Ontology (ENVO) | Unclassified (47.849 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (67.204 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 35.90% β-sheet: 5.13% Coil/Unstructured: 58.97% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.40 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 186 Family Scaffolds |
|---|---|---|
| PF12728 | HTH_17 | 7.53 |
| PF04255 | DUF433 | 5.91 |
| PF01381 | HTH_3 | 4.30 |
| PF03793 | PASTA | 2.69 |
| PF02371 | Transposase_20 | 1.08 |
| PF13424 | TPR_12 | 1.08 |
| PF01618 | MotA_ExbB | 0.54 |
| PF06114 | Peptidase_M78 | 0.54 |
| PF00925 | GTP_cyclohydro2 | 0.54 |
| PF05345 | He_PIG | 0.54 |
| PF14082 | DUF4263 | 0.54 |
| PF01548 | DEDD_Tnp_IS110 | 0.54 |
| PF08240 | ADH_N | 0.54 |
| PF12844 | HTH_19 | 0.54 |
| PF04014 | MazE_antitoxin | 0.54 |
| PF02899 | Phage_int_SAM_1 | 0.54 |
| PF00132 | Hexapep | 0.54 |
| PF09720 | Unstab_antitox | 0.54 |
| PF02661 | Fic | 0.54 |
| PF02457 | DAC | 0.54 |
| PF12770 | CHAT | 0.54 |
| PF02566 | OsmC | 0.54 |
| PF04773 | FecR | 0.54 |
| PF01927 | Mut7-C | 0.54 |
| PF13286 | HD_assoc | 0.54 |
| PF00953 | Glycos_transf_4 | 0.54 |
| PF05016 | ParE_toxin | 0.54 |
| PF00072 | Response_reg | 0.54 |
| COG ID | Name | Functional Category | % Frequency in 186 Family Scaffolds |
|---|---|---|---|
| COG2442 | Predicted antitoxin component of a toxin-antitoxin system, DUF433 family | Defense mechanisms [V] | 5.91 |
| COG3547 | Transposase | Mobilome: prophages, transposons [X] | 1.61 |
| COG0472 | UDP-N-acetylmuramyl pentapeptide phosphotransferase/UDP-N-acetylglucosamine-1-phosphate transferase | Cell wall/membrane/envelope biogenesis [M] | 0.54 |
| COG0807 | GTP cyclohydrolase II | Coenzyme transport and metabolism [H] | 0.54 |
| COG1656 | Uncharacterized conserved protein, contains PIN-related Mut7-C RNAse domain | General function prediction only [R] | 0.54 |
| COG1764 | Organic hydroperoxide reductase OsmC/OhrA | Defense mechanisms [V] | 0.54 |
| COG1765 | Uncharacterized OsmC-related protein | General function prediction only [R] | 0.54 |
| COG4973 | Site-specific recombinase XerC | Replication, recombination and repair [L] | 0.54 |
| COG4974 | Site-specific recombinase XerD | Replication, recombination and repair [L] | 0.54 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 52.69 % |
| All Organisms | root | All Organisms | 47.31 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2162886013|SwBSRL2_contig_2993477 | Not Available | 971 | Open in IMG/M |
| 3300005295|Ga0065707_10501808 | Not Available | 753 | Open in IMG/M |
| 3300005330|Ga0070690_100542694 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia | 875 | Open in IMG/M |
| 3300005331|Ga0070670_101097115 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales → Listeriaceae → Brochothrix → Brochothrix thermosphacta | 726 | Open in IMG/M |
| 3300005331|Ga0070670_101496906 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales → Listeriaceae → Brochothrix → Brochothrix thermosphacta | 620 | Open in IMG/M |
| 3300005334|Ga0068869_100128865 | All Organisms → cellular organisms → Bacteria | 1943 | Open in IMG/M |
| 3300005334|Ga0068869_101411206 | All Organisms → cellular organisms → Bacteria | 616 | Open in IMG/M |
| 3300005334|Ga0068869_101562275 | Not Available | 587 | Open in IMG/M |
| 3300005337|Ga0070682_100223029 | All Organisms → cellular organisms → Bacteria | 1343 | Open in IMG/M |
| 3300005345|Ga0070692_10057506 | All Organisms → cellular organisms → Bacteria | 2039 | Open in IMG/M |
| 3300005345|Ga0070692_10058882 | All Organisms → cellular organisms → Bacteria | 2018 | Open in IMG/M |
| 3300005366|Ga0070659_100076595 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium | 2667 | Open in IMG/M |
| 3300005406|Ga0070703_10306572 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales → Listeriaceae → Brochothrix → Brochothrix thermosphacta | 664 | Open in IMG/M |
| 3300005440|Ga0070705_101310737 | All Organisms → cellular organisms → Bacteria → Spirochaetes → Spirochaetia → Leptospirales → Leptospiraceae → Leptospira → Leptospira interrogans | 601 | Open in IMG/M |
| 3300005444|Ga0070694_100002531 | All Organisms → cellular organisms → Bacteria | 10795 | Open in IMG/M |
| 3300005444|Ga0070694_100852968 | Not Available | 750 | Open in IMG/M |
| 3300005444|Ga0070694_101889768 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales → Listeriaceae → Brochothrix → Brochothrix thermosphacta | 509 | Open in IMG/M |
| 3300005455|Ga0070663_101731872 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Eubacteriales incertae sedis → Clostridiales Family XVII. Incertae Sedis → Thermaerobacter → Thermaerobacter marianensis | 559 | Open in IMG/M |
| 3300005457|Ga0070662_100757583 | All Organisms → cellular organisms → Bacteria | 824 | Open in IMG/M |
| 3300005471|Ga0070698_101120345 | Not Available | 736 | Open in IMG/M |
| 3300005539|Ga0068853_101694705 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae | 613 | Open in IMG/M |
| 3300005543|Ga0070672_100770007 | All Organisms → cellular organisms → Bacteria | 845 | Open in IMG/M |
| 3300005545|Ga0070695_100146523 | All Organisms → cellular organisms → Bacteria | 1643 | Open in IMG/M |
| 3300005545|Ga0070695_100605373 | All Organisms → cellular organisms → Bacteria | 861 | Open in IMG/M |
| 3300005545|Ga0070695_101682585 | All Organisms → cellular organisms → Bacteria | 531 | Open in IMG/M |
| 3300005545|Ga0070695_101865028 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales → Listeriaceae → Brochothrix → Brochothrix thermosphacta | 505 | Open in IMG/M |
| 3300005546|Ga0070696_100984810 | Not Available | 704 | Open in IMG/M |
| 3300005547|Ga0070693_100201542 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium AA13 | 1293 | Open in IMG/M |
| 3300005549|Ga0070704_100394162 | All Organisms → cellular organisms → Bacteria | 1180 | Open in IMG/M |
| 3300005549|Ga0070704_100554225 | Not Available | 1005 | Open in IMG/M |
| 3300005563|Ga0068855_100187701 | All Organisms → cellular organisms → Bacteria | 2334 | Open in IMG/M |
| 3300005563|Ga0068855_101567599 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales → Listeriaceae → Brochothrix → Brochothrix thermosphacta | 675 | Open in IMG/M |
| 3300005577|Ga0068857_102457663 | Not Available | 512 | Open in IMG/M |
| 3300005578|Ga0068854_100905149 | All Organisms → cellular organisms → Bacteria | 776 | Open in IMG/M |
| 3300005618|Ga0068864_100936726 | Not Available | 857 | Open in IMG/M |
| 3300005841|Ga0068863_100451681 | All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella → Candidatus Entotheonella palauensis | 1261 | Open in IMG/M |
| 3300005841|Ga0068863_100623319 | All Organisms → cellular organisms → Bacteria | 1068 | Open in IMG/M |
| 3300005841|Ga0068863_102120295 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales → Listeriaceae → Brochothrix → Brochothrix thermosphacta | 572 | Open in IMG/M |
| 3300005842|Ga0068858_100483252 | All Organisms → cellular organisms → Bacteria | 1195 | Open in IMG/M |
| 3300005843|Ga0068860_100071837 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium | 3288 | Open in IMG/M |
| 3300005843|Ga0068860_100205557 | All Organisms → cellular organisms → Bacteria | 1909 | Open in IMG/M |
| 3300005843|Ga0068860_100597699 | Not Available | 1108 | Open in IMG/M |
| 3300005844|Ga0068862_101303014 | Not Available | 728 | Open in IMG/M |
| 3300006755|Ga0079222_10981373 | All Organisms → cellular organisms → Bacteria | 723 | Open in IMG/M |
| 3300006806|Ga0079220_10477827 | All Organisms → cellular organisms → Bacteria | 843 | Open in IMG/M |
| 3300006854|Ga0075425_100359270 | All Organisms → cellular organisms → Bacteria | 1677 | Open in IMG/M |
| 3300006881|Ga0068865_101279529 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales → Listeriaceae → Brochothrix → Brochothrix thermosphacta | 651 | Open in IMG/M |
| 3300006904|Ga0075424_102533783 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Clostridiaceae → Sarcina → unclassified Sarcina → Sarcina sp. DSM 11001 | 537 | Open in IMG/M |
| 3300006918|Ga0079216_10318167 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Eubacteriales incertae sedis → Clostridiales Family XVII. Incertae Sedis → Thermaerobacter → Thermaerobacter marianensis | 931 | Open in IMG/M |
| 3300006918|Ga0079216_10952296 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales → Listeriaceae → Brochothrix → Brochothrix thermosphacta | 655 | Open in IMG/M |
| 3300006931|Ga0097620_101094274 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales → Listeriaceae → Brochothrix → Brochothrix thermosphacta | 877 | Open in IMG/M |
| 3300007004|Ga0079218_10551288 | Not Available | 1037 | Open in IMG/M |
| 3300007004|Ga0079218_11092229 | All Organisms → cellular organisms → Bacteria | 812 | Open in IMG/M |
| 3300007076|Ga0075435_101476524 | Not Available | 596 | Open in IMG/M |
| 3300009011|Ga0105251_10369403 | Not Available | 656 | Open in IMG/M |
| 3300009098|Ga0105245_12360158 | Not Available | 585 | Open in IMG/M |
| 3300009098|Ga0105245_12511991 | Not Available | 568 | Open in IMG/M |
| 3300009147|Ga0114129_11424239 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 854 | Open in IMG/M |
| 3300009148|Ga0105243_10020054 | All Organisms → cellular organisms → Bacteria | 5069 | Open in IMG/M |
| 3300009148|Ga0105243_11056460 | Not Available | 818 | Open in IMG/M |
| 3300009148|Ga0105243_12059436 | Not Available | 606 | Open in IMG/M |
| 3300009148|Ga0105243_12089900 | Not Available | 602 | Open in IMG/M |
| 3300009162|Ga0075423_10625550 | Not Available | 1135 | Open in IMG/M |
| 3300009162|Ga0075423_11193065 | Not Available | 812 | Open in IMG/M |
| 3300009162|Ga0075423_12975946 | Not Available | 519 | Open in IMG/M |
| 3300009174|Ga0105241_11104641 | All Organisms → cellular organisms → Bacteria | 747 | Open in IMG/M |
| 3300009174|Ga0105241_11115585 | Not Available | 743 | Open in IMG/M |
| 3300009174|Ga0105241_11243051 | Not Available | 707 | Open in IMG/M |
| 3300009174|Ga0105241_12393502 | Not Available | 527 | Open in IMG/M |
| 3300009174|Ga0105241_12525601 | All Organisms → cellular organisms → Bacteria | 515 | Open in IMG/M |
| 3300009176|Ga0105242_10065856 | Not Available | 2990 | Open in IMG/M |
| 3300009176|Ga0105242_10664416 | All Organisms → cellular organisms → Bacteria | 1015 | Open in IMG/M |
| 3300009177|Ga0105248_10089192 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 3471 | Open in IMG/M |
| 3300009177|Ga0105248_13341207 | Not Available | 510 | Open in IMG/M |
| 3300009545|Ga0105237_10000460 | All Organisms → cellular organisms → Bacteria | 57756 | Open in IMG/M |
| 3300009545|Ga0105237_10836995 | Not Available | 927 | Open in IMG/M |
| 3300009545|Ga0105237_12270991 | Not Available | 552 | Open in IMG/M |
| 3300009551|Ga0105238_10003063 | All Organisms → cellular organisms → Bacteria | 16661 | Open in IMG/M |
| 3300009551|Ga0105238_10021035 | All Organisms → cellular organisms → Bacteria | 6648 | Open in IMG/M |
| 3300009553|Ga0105249_10190479 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 2001 | Open in IMG/M |
| 3300009553|Ga0105249_11467233 | Not Available | 754 | Open in IMG/M |
| 3300009553|Ga0105249_12840279 | Not Available | 556 | Open in IMG/M |
| 3300009840|Ga0126313_10831913 | Not Available | 752 | Open in IMG/M |
| 3300010036|Ga0126305_10240920 | Not Available | 1160 | Open in IMG/M |
| 3300010037|Ga0126304_11008379 | Not Available | 568 | Open in IMG/M |
| 3300010037|Ga0126304_11275204 | Not Available | 504 | Open in IMG/M |
| 3300010038|Ga0126315_10071310 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium | 1936 | Open in IMG/M |
| 3300010038|Ga0126315_10560967 | Not Available | 734 | Open in IMG/M |
| 3300010040|Ga0126308_10838253 | Not Available | 638 | Open in IMG/M |
| 3300010041|Ga0126312_10877402 | Not Available | 653 | Open in IMG/M |
| 3300010041|Ga0126312_10922141 | Not Available | 637 | Open in IMG/M |
| 3300010045|Ga0126311_10015453 | All Organisms → cellular organisms → Bacteria | 4399 | Open in IMG/M |
| 3300010045|Ga0126311_10142053 | Not Available | 1701 | Open in IMG/M |
| 3300010045|Ga0126311_10194744 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae → Lysobacter → unclassified Lysobacter → Lysobacter sp. | 1475 | Open in IMG/M |
| 3300010045|Ga0126311_10916085 | Not Available | 712 | Open in IMG/M |
| 3300010045|Ga0126311_11075439 | Not Available | 661 | Open in IMG/M |
| 3300010047|Ga0126382_11620088 | Not Available | 601 | Open in IMG/M |
| 3300010047|Ga0126382_11746280 | Not Available | 583 | Open in IMG/M |
| 3300010047|Ga0126382_12423550 | Not Available | 510 | Open in IMG/M |
| 3300010166|Ga0126306_11521476 | Not Available | 556 | Open in IMG/M |
| 3300010359|Ga0126376_10005208 | Not Available | 7763 | Open in IMG/M |
| 3300010359|Ga0126376_10062385 | All Organisms → cellular organisms → Bacteria | 2689 | Open in IMG/M |
| 3300010359|Ga0126376_11284510 | Not Available | 751 | Open in IMG/M |
| 3300010360|Ga0126372_11280884 | Not Available | 761 | Open in IMG/M |
| 3300010362|Ga0126377_11897253 | Not Available | 671 | Open in IMG/M |
| 3300010373|Ga0134128_10019258 | All Organisms → cellular organisms → Bacteria | 8100 | Open in IMG/M |
| 3300010373|Ga0134128_13169499 | Not Available | 505 | Open in IMG/M |
| 3300010375|Ga0105239_10600347 | Not Available | 1255 | Open in IMG/M |
| 3300010396|Ga0134126_12553685 | Not Available | 555 | Open in IMG/M |
| 3300010397|Ga0134124_10720208 | Not Available | 989 | Open in IMG/M |
| 3300010397|Ga0134124_10932895 | Not Available | 876 | Open in IMG/M |
| 3300010397|Ga0134124_11055877 | All Organisms → cellular organisms → Bacteria | 827 | Open in IMG/M |
| 3300010397|Ga0134124_11687623 | Not Available | 665 | Open in IMG/M |
| 3300010397|Ga0134124_12188378 | Not Available | 592 | Open in IMG/M |
| 3300010399|Ga0134127_10040129 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium | 3807 | Open in IMG/M |
| 3300010399|Ga0134127_10356456 | Not Available | 1431 | Open in IMG/M |
| 3300010399|Ga0134127_10562768 | Not Available | 1163 | Open in IMG/M |
| 3300010399|Ga0134127_10630077 | Not Available | 1104 | Open in IMG/M |
| 3300010399|Ga0134127_11354511 | Not Available | 782 | Open in IMG/M |
| 3300010399|Ga0134127_12252039 | Not Available | 624 | Open in IMG/M |
| 3300010399|Ga0134127_12432374 | Not Available | 603 | Open in IMG/M |
| 3300010399|Ga0134127_13166116 | Not Available | 537 | Open in IMG/M |
| 3300010400|Ga0134122_10785535 | All Organisms → cellular organisms → Bacteria | 907 | Open in IMG/M |
| 3300010400|Ga0134122_12837502 | All Organisms → cellular organisms → Bacteria | 538 | Open in IMG/M |
| 3300010401|Ga0134121_10028301 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia | 4525 | Open in IMG/M |
| 3300010401|Ga0134121_11429549 | Not Available | 703 | Open in IMG/M |
| 3300010401|Ga0134121_12342868 | All Organisms → cellular organisms → Bacteria | 573 | Open in IMG/M |
| 3300010401|Ga0134121_12941688 | Not Available | 523 | Open in IMG/M |
| 3300010403|Ga0134123_10272189 | All Organisms → cellular organisms → Bacteria | 1486 | Open in IMG/M |
| 3300010403|Ga0134123_12349901 | Not Available | 597 | Open in IMG/M |
| 3300010403|Ga0134123_12445203 | Not Available | 588 | Open in IMG/M |
| 3300011119|Ga0105246_12339558 | Not Available | 523 | Open in IMG/M |
| 3300011993|Ga0120182_1000271 | Not Available | 1725 | Open in IMG/M |
| 3300012022|Ga0120191_10113090 | Not Available | 577 | Open in IMG/M |
| 3300013102|Ga0157371_10891153 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → unclassified Verrucomicrobiales → Verrucomicrobiales bacterium | 674 | Open in IMG/M |
| 3300013297|Ga0157378_12899650 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Roseobacteraceae → Thalassobius → Thalassobius aquimarinus | 532 | Open in IMG/M |
| 3300013306|Ga0163162_10089347 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium | 3161 | Open in IMG/M |
| 3300013306|Ga0163162_10228800 | All Organisms → cellular organisms → Bacteria | 1990 | Open in IMG/M |
| 3300013306|Ga0163162_11338791 | Not Available | 814 | Open in IMG/M |
| 3300013500|Ga0120195_1007690 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 726 | Open in IMG/M |
| 3300014326|Ga0157380_10693551 | All Organisms → cellular organisms → Bacteria | 1022 | Open in IMG/M |
| 3300014487|Ga0182000_10556921 | Not Available | 545 | Open in IMG/M |
| 3300014745|Ga0157377_11072602 | Not Available | 615 | Open in IMG/M |
| 3300014968|Ga0157379_10982609 | All Organisms → cellular organisms → Bacteria | 804 | Open in IMG/M |
| 3300014968|Ga0157379_11267266 | Not Available | 711 | Open in IMG/M |
| 3300014968|Ga0157379_11632935 | Not Available | 630 | Open in IMG/M |
| 3300015262|Ga0182007_10153231 | Not Available | 785 | Open in IMG/M |
| 3300015372|Ga0132256_103578773 | All Organisms → cellular organisms → Bacteria | 522 | Open in IMG/M |
| 3300015373|Ga0132257_102643620 | Not Available | 653 | Open in IMG/M |
| 3300015374|Ga0132255_102342088 | Not Available | 815 | Open in IMG/M |
| 3300015374|Ga0132255_103398207 | Not Available | 678 | Open in IMG/M |
| 3300018469|Ga0190270_13034049 | Not Available | 531 | Open in IMG/M |
| 3300025559|Ga0210087_1090607 | Not Available | 602 | Open in IMG/M |
| 3300025904|Ga0207647_10094054 | All Organisms → cellular organisms → Bacteria | 1786 | Open in IMG/M |
| 3300025904|Ga0207647_10548207 | Not Available | 641 | Open in IMG/M |
| 3300025911|Ga0207654_10630503 | All Organisms → cellular organisms → Bacteria | 767 | Open in IMG/M |
| 3300025911|Ga0207654_11033614 | Not Available | 598 | Open in IMG/M |
| 3300025912|Ga0207707_10774532 | Not Available | 801 | Open in IMG/M |
| 3300025913|Ga0207695_11227618 | Not Available | 630 | Open in IMG/M |
| 3300025918|Ga0207662_10462074 | Not Available | 869 | Open in IMG/M |
| 3300025923|Ga0207681_11485316 | Not Available | 568 | Open in IMG/M |
| 3300025924|Ga0207694_10402314 | All Organisms → cellular organisms → Bacteria | 1138 | Open in IMG/M |
| 3300025934|Ga0207686_10644810 | Not Available | 837 | Open in IMG/M |
| 3300025935|Ga0207709_10169435 | All Organisms → cellular organisms → Bacteria | 1531 | Open in IMG/M |
| 3300025936|Ga0207670_11701612 | Not Available | 536 | Open in IMG/M |
| 3300025938|Ga0207704_11512666 | All Organisms → cellular organisms → Bacteria | 576 | Open in IMG/M |
| 3300025941|Ga0207711_11106856 | Not Available | 733 | Open in IMG/M |
| 3300025941|Ga0207711_11867211 | All Organisms → cellular organisms → Bacteria | 544 | Open in IMG/M |
| 3300025942|Ga0207689_10505413 | All Organisms → cellular organisms → Bacteria | 1013 | Open in IMG/M |
| 3300025942|Ga0207689_10553308 | Not Available | 966 | Open in IMG/M |
| 3300025942|Ga0207689_10723173 | Not Available | 840 | Open in IMG/M |
| 3300025942|Ga0207689_10832362 | Not Available | 779 | Open in IMG/M |
| 3300025960|Ga0207651_10552062 | All Organisms → cellular organisms → Bacteria | 1002 | Open in IMG/M |
| 3300025981|Ga0207640_10742753 | Not Available | 845 | Open in IMG/M |
| 3300025981|Ga0207640_11554652 | Not Available | 595 | Open in IMG/M |
| 3300026035|Ga0207703_10728335 | All Organisms → cellular organisms → Bacteria | 944 | Open in IMG/M |
| 3300026041|Ga0207639_10776706 | All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella → Candidatus Entotheonella palauensis | 892 | Open in IMG/M |
| 3300026088|Ga0207641_10713039 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 988 | Open in IMG/M |
| 3300026095|Ga0207676_11072015 | All Organisms → cellular organisms → Bacteria | 796 | Open in IMG/M |
| 3300026118|Ga0207675_100103132 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2688 | Open in IMG/M |
| 3300026118|Ga0207675_101297638 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 748 | Open in IMG/M |
| 3300026142|Ga0207698_12654147 | Not Available | 510 | Open in IMG/M |
| 3300027718|Ga0209795_10016555 | All Organisms → cellular organisms → Bacteria | 2724 | Open in IMG/M |
| 3300028381|Ga0268264_10010991 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium | 7474 | Open in IMG/M |
| 3300028381|Ga0268264_10506380 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1178 | Open in IMG/M |
| 3300032421|Ga0310812_10359265 | Not Available | 653 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 13.44% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 9.14% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 8.60% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 8.06% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 8.06% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 5.91% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 5.91% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 4.84% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 4.30% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 4.30% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 3.76% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 3.23% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 2.15% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 2.15% |
| Terrestrial | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial | 1.61% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 1.61% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.61% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.61% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 1.61% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.08% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.08% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 1.08% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.08% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 0.54% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.54% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.54% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.54% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.54% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.54% |
| Agave | Host-Associated → Plants → Phylloplane → Unclassified → Unclassified → Agave | 0.54% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2162886013 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk Soil | Environmental | Open in IMG/M |
| 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 | Environmental | Open in IMG/M |
| 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Environmental | Open in IMG/M |
| 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Host-Associated | Open in IMG/M |
| 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Host-Associated | Open in IMG/M |
| 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Environmental | Open in IMG/M |
| 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Environmental | Open in IMG/M |
| 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Environmental | Open in IMG/M |
| 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Environmental | Open in IMG/M |
| 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Environmental | Open in IMG/M |
| 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Host-Associated | Open in IMG/M |
| 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
| 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Host-Associated | Open in IMG/M |
| 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Environmental | Open in IMG/M |
| 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Environmental | Open in IMG/M |
| 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Environmental | Open in IMG/M |
| 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Environmental | Open in IMG/M |
| 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Host-Associated | Open in IMG/M |
| 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Host-Associated | Open in IMG/M |
| 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Host-Associated | Open in IMG/M |
| 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Host-Associated | Open in IMG/M |
| 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
| 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Host-Associated | Open in IMG/M |
| 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
| 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Host-Associated | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Host-Associated | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300006918 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS100 | Environmental | Open in IMG/M |
| 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) | Host-Associated | Open in IMG/M |
| 3300007004 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost | Environmental | Open in IMG/M |
| 3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
| 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Host-Associated | Open in IMG/M |
| 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Host-Associated | Open in IMG/M |
| 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
| 3300009840 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105A | Environmental | Open in IMG/M |
| 3300010036 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot26 | Environmental | Open in IMG/M |
| 3300010037 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot25 | Environmental | Open in IMG/M |
| 3300010038 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot106 | Environmental | Open in IMG/M |
| 3300010040 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot55 | Environmental | Open in IMG/M |
| 3300010041 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot104A | Environmental | Open in IMG/M |
| 3300010045 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot61 | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010166 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot27 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
| 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
| 3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
| 3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
| 3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
| 3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
| 3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
| 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Host-Associated | Open in IMG/M |
| 3300011993 | Terrestrial microbial communites from a soil warming plot in Okalahoma, USA - C1.rep1 | Environmental | Open in IMG/M |
| 3300012022 | Terrestrial microbial communites from a soil warming plot in Okalahoma, USA - C6 | Environmental | Open in IMG/M |
| 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Host-Associated | Open in IMG/M |
| 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
| 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
| 3300013500 | Terrestrial microbial communites from a soil warming plot in Okalahoma, USA - T4.rep2 | Environmental | Open in IMG/M |
| 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014487 | Bulk soil microbial communities from Mexico - Magueyal (Ma) metaG | Environmental | Open in IMG/M |
| 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Host-Associated | Open in IMG/M |
| 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Host-Associated | Open in IMG/M |
| 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Host-Associated | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300018469 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T | Environmental | Open in IMG/M |
| 3300025559 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailB_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027718 | Agave microbial communities from Guanajuato, Mexico - Or.Ma.rz (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300032421 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NN3 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| SwBSRL2_0483.00006960 | 2162886013 | Switchgrass Rhizosphere | YPNISKYELDKNEPPLGILLAYARLAEIPVEYLIDDRLDLPL |
| Ga0065707_105018081 | 3300005295 | Switchgrass Rhizosphere | MVKQLGVQDLIHYTNISKYELDKNEPPLAIVLAYARLVGIPVEQIIDD |
| Ga0070690_1005426942 | 3300005330 | Switchgrass Rhizosphere | SKYELDKNEPPLAILLAYARLVEIPVEQIIDDEIELTI*FP* |
| Ga0070670_1010971151 | 3300005331 | Switchgrass Rhizosphere | GVQALIEHTTISKYELDKNEPPLAILLAYARLVEIPVEQIIDDEIELTI* |
| Ga0070670_1014969061 | 3300005331 | Switchgrass Rhizosphere | LIDHTTISKYELDKNEPPLAILIAYARLVGIPVEQIIDDEIELTI* |
| Ga0068869_1001288651 | 3300005334 | Miscanthus Rhizosphere | IHYTNISKYELDKNEPPLTILLAYARLKGIPVEQIIDDELELTI* |
| Ga0068869_1014112062 | 3300005334 | Miscanthus Rhizosphere | IDHTTISKYELDKNEPPLAILLAYARLAEIPVEQLIDDEFELTI* |
| Ga0068869_1015622752 | 3300005334 | Miscanthus Rhizosphere | MSQGELVKQLGVQALIHYTNISKYELDKNEPPLAILLAYARLVGLPVEQIIDDEIELTI* |
| Ga0070682_1002230292 | 3300005337 | Corn Rhizosphere | MVRRLGVQKLIDHTTISKYELDKNEPPLAILLAYARLAEIPVEQLIDDEFELTI* |
| Ga0070692_100575063 | 3300005345 | Corn, Switchgrass And Miscanthus Rhizosphere | MSQGELIRQLGVQALIDHTTISKYELDKNEPPLAILLAYARLAEIPVEQIIDDEIELTIDFRKTTAIFSYR* |
| Ga0070692_100588823 | 3300005345 | Corn, Switchgrass And Miscanthus Rhizosphere | ISKYELDKNEPPLVILLAYARLIGIPVEQIIDDEIELTI* |
| Ga0070659_1000765951 | 3300005366 | Corn Rhizosphere | LVRQLGVQALIDHTTISKYELDKNEPPLAILLAYARLAGIPVEQIIDDELDLTF* |
| Ga0070703_103065721 | 3300005406 | Corn, Switchgrass And Miscanthus Rhizosphere | LIDHTTISKYELDKNEPPLVILLAYARLVEIPVEQIIDDALDLSI* |
| Ga0070705_1013107371 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | LGLSQHGLVKRLLVQDQIHYTNVSKYELDKNEPPLAILLAYSRVARIPVERIIDDDLDLFD* |
| Ga0070694_10000253113 | 3300005444 | Corn, Switchgrass And Miscanthus Rhizosphere | MVRRLGVHNLIDHTTISKYELDKNEPPLAILLAYARLVEIPVEEIIDDEIELTI* |
| Ga0070694_1008529682 | 3300005444 | Corn, Switchgrass And Miscanthus Rhizosphere | MVKRLGVQGLIHYTNISKYELDKNEPPLTILLAYARLTGIPVERIKNSCGAER* |
| Ga0070694_1018897681 | 3300005444 | Corn, Switchgrass And Miscanthus Rhizosphere | MVKQLGVQDLIHYTNISKYELDKNEPPLAILLAYARLAGIPVEQIIDDEFELTI |
| Ga0070663_1017318721 | 3300005455 | Corn Rhizosphere | RLGVQDLIHYTTISKYELDKNEPPLAILLAYARLVEIPVEQIIDDEIELTI* |
| Ga0070662_1007575831 | 3300005457 | Corn Rhizosphere | MVRRLGVQKLIDHTTISKYELDKNEPPLAILLAYARLAEIPVEQIIDDEFELTI* |
| Ga0070698_1011203452 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | MVKRLGVQELIDHTTISKYELDKNEPPPAILLAYARLAEIPVEQIIDDELDLIF* |
| Ga0068853_1016947052 | 3300005539 | Corn Rhizosphere | ISKYELNKNEPPLNILLAYARLIGIPVEQIIDDELELTI* |
| Ga0070672_1007700072 | 3300005543 | Miscanthus Rhizosphere | QRLIDHTTISKYELDKNEPPLAILLAYARLAEIPVEQIIDDEFELTI* |
| Ga0070695_1001465232 | 3300005545 | Corn, Switchgrass And Miscanthus Rhizosphere | DHTTISKYELDKNEPPLAILLAYARLVGIPVEQIIDDELELTIEFHESTAGN* |
| Ga0070695_1006053731 | 3300005545 | Corn, Switchgrass And Miscanthus Rhizosphere | LRLGLSQHGLVKRLLVQDQIHYTNVSKYELDKNEPPLAILLAYSRVARIPVERIIDDDLDLFD* |
| Ga0070695_1016825852 | 3300005545 | Corn, Switchgrass And Miscanthus Rhizosphere | DLIHYTNISKYELDKNEPPLTILLAYARLAGIPIERIIDDELELTI* |
| Ga0070695_1018650281 | 3300005545 | Corn, Switchgrass And Miscanthus Rhizosphere | TISKYELDKNEPPLAIVLAYARLVGIPVEQIIDDEIELTI* |
| Ga0070696_1009848101 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | MVRRLGVQRLIDHTTISKYELDKNEPPLAILLAYARIAGIPVEQIIDDELDLIF* |
| Ga0070693_1002015422 | 3300005547 | Corn, Switchgrass And Miscanthus Rhizosphere | VSKYELDKNEPPLAILLAYSRVARIPVERIIDDDLDLFD* |
| Ga0070704_1003941622 | 3300005549 | Corn, Switchgrass And Miscanthus Rhizosphere | LVRQLGVQALIEHTTISKYELNKNEPPLTILLAYARLVEIPVEQIIDDELELTI* |
| Ga0070704_1005542251 | 3300005549 | Corn, Switchgrass And Miscanthus Rhizosphere | MSQGEMVRRLGVQDLIDHTTISNYELDKNEPPLAILLAYARLIEIPVEQIIDDEIKLTI*FP* |
| Ga0068855_1001877016 | 3300005563 | Corn Rhizosphere | KYELDKNEPPLAILLAYARLVEIPVEQIIDDELELTI* |
| Ga0068855_1015675991 | 3300005563 | Corn Rhizosphere | TTISKYELDKNEPPLAILLAYARLAGIPVEQIIDDELDLIF* |
| Ga0068857_1024576631 | 3300005577 | Corn Rhizosphere | MVRRLGVHDLIQHTTISKYELDKNEPPLTILLAYARLAGIPVEQIIDDEVELTI* |
| Ga0068854_1009051492 | 3300005578 | Corn Rhizosphere | QALIDHTTISKYELDKNEPPLAILLAYARLVEIPVEQIIDDEIELTI* |
| Ga0068864_1009367261 | 3300005618 | Switchgrass Rhizosphere | LAALKQPDDEPPLIILLAYARLAGIPVEQIIDDELELAV* |
| Ga0068863_1004516812 | 3300005841 | Switchgrass Rhizosphere | MVRRLGVQRLIDHTTISKYELDKNEPPLAILLAYARLAGIPVEQIIDDELDLIF* |
| Ga0068863_1006233191 | 3300005841 | Switchgrass Rhizosphere | QKLIDHTTISKYELDKNEPPLAILLAYARLAEIPVEQLIDDEFEFTI* |
| Ga0068863_1021202951 | 3300005841 | Switchgrass Rhizosphere | QDQIHYTNISKYELDKNEPPLGILLAYSQLTGIPVETLIDDRKDLPEVWTNR* |
| Ga0068858_1004832522 | 3300005842 | Switchgrass Rhizosphere | MVRRLGVQKLIDHTTISKYELDKNEPPLTILLAYARLAEIPVEQIIDDEFELTI* |
| Ga0068860_1000718371 | 3300005843 | Switchgrass Rhizosphere | IEHTTISKYELNKNEPPLAILLAYARLAGIPVERIIDDEFELTI* |
| Ga0068860_1002055571 | 3300005843 | Switchgrass Rhizosphere | IEHTTISKYELNKNEPPLAILLAYARLAGIPVEQIIDDELELTI* |
| Ga0068860_1005976993 | 3300005843 | Switchgrass Rhizosphere | MVKRLGVQELIDHTTISKYELDKNEPPLAILLAYARLAEIPVEQIIDDEFELT |
| Ga0068862_1013030142 | 3300005844 | Switchgrass Rhizosphere | LGVQALIEHTTISKYELNKNEPPLAILLAYARLAGIPVERIIDDEFELTI* |
| Ga0079222_109813732 | 3300006755 | Agricultural Soil | IDHTTISKYELDKNEPPLAILLAYARLAEIPVEQIIDDELELTI* |
| Ga0079220_104778271 | 3300006806 | Agricultural Soil | LGVSQGELVRQLSVQALIDHTTISKYELDKNEPPLAILLAYSHLAAVPLEQIVDDELELTI* |
| Ga0075425_1003592702 | 3300006854 | Populus Rhizosphere | QLGVQALIDHTTISKYELDKNEPPLAILLAYARLVGNPAEQIIDDELELTIEFHGN* |
| Ga0068865_1012795291 | 3300006881 | Miscanthus Rhizosphere | QLGVQALIDHTTISKYELDKNEPPLAILLAYARLAGIPVEQIIDDELDLIF* |
| Ga0075424_1025337831 | 3300006904 | Populus Rhizosphere | TISKYELDKNEPPLTILLAYARLVEIPVEKIIDDEIELTI* |
| Ga0079216_103181671 | 3300006918 | Agricultural Soil | MVKRLGVQDLIHYTTISKYELDKNEPPLAILLAYARLVEIPVEQIIDDEIELTI* |
| Ga0079216_109522961 | 3300006918 | Agricultural Soil | QGELVKQLGVKDLIHYTNISKYELDKNEPPLAIVLAYARLVGIRVEQLIDDEIELSI* |
| Ga0097620_1010942741 | 3300006931 | Switchgrass Rhizosphere | IDHTTISKYELDKNEPPLAILLAYARLVEIPVEQIIDDEIELTI* |
| Ga0079218_105512881 | 3300007004 | Agricultural Soil | LIHYTTISKYELDKNEPPLAILLAYARLVEIPVEQIIDDEIELTI* |
| Ga0079218_110922292 | 3300007004 | Agricultural Soil | MVKRLGVQALIDHTTISKYELDKNEPTLTILLAYARLAEIPVEQIIDDEFELTI* |
| Ga0075435_1014765241 | 3300007076 | Populus Rhizosphere | MVKRLGVQELIDHTTISKYELDRNEPPLAILLAHARLAEIPVEQIID |
| Ga0105251_103694031 | 3300009011 | Switchgrass Rhizosphere | RQLGVQALIDHTTISKYELDKNEPPLAILLAYARLVEIPVEQIIDDEIELTI* |
| Ga0105245_123601581 | 3300009098 | Miscanthus Rhizosphere | KYELDKNEPPLAILLAYARLAEIPVEQIIDDELDLIF* |
| Ga0105245_125119912 | 3300009098 | Miscanthus Rhizosphere | FPSTNSTKNNPPLTILLAYARLAGIPAEQIIDDELELTI* |
| Ga0114129_114242391 | 3300009147 | Populus Rhizosphere | QLGVQALIEHTTISKYELNKNEPPLAILLAYARLAGIRVEQIIDDELKLTIEFD* |
| Ga0105243_100200541 | 3300009148 | Miscanthus Rhizosphere | NLIDHTTISKYELDKNEPPLAILLAYARLTGIPVERIKKQRIKKQIIDDEIELTM* |
| Ga0105243_110564601 | 3300009148 | Miscanthus Rhizosphere | LDKNEPPLAILLAYSRLAGIPVEQIIDDEIEPTI* |
| Ga0105243_120594361 | 3300009148 | Miscanthus Rhizosphere | YTNVSKYEHDVNEPTLMIVLAYAQLAEIPVEYLIDDALDLPL* |
| Ga0105243_120899001 | 3300009148 | Miscanthus Rhizosphere | VQGLIHYTNISKYELDKNEPPLAILLAYARLAGIPVEQIIDDELELTI* |
| Ga0075423_106255501 | 3300009162 | Populus Rhizosphere | KYELDKNEPPLAILLAYARLAEIPVEQIIDDEFELTI* |
| Ga0075423_111930652 | 3300009162 | Populus Rhizosphere | VSQGELVRQLGVQALIEHTTISKYELDKNEPPLAILIAYARLVEIPVEQIIDDEIELTI* |
| Ga0075423_129759461 | 3300009162 | Populus Rhizosphere | LDKNEPPLVILLAYARLIGIPVEQIIDDELELTI* |
| Ga0105241_111046411 | 3300009174 | Corn Rhizosphere | LGAQDLIHYTTISKYELDKNEPPLTILLAYARLAGIHVEQIIDDELDPIF* |
| Ga0105241_111155851 | 3300009174 | Corn Rhizosphere | MVRRLGVQKLIDHTTISKYELDKNEPPLAILLAYARLAGIPVEQIIDDEFDLTI* |
| Ga0105241_112430511 | 3300009174 | Corn Rhizosphere | ALIDHTTISKYELDKNEPPLAILLAYARLIEIPVEQIIDDELELTI* |
| Ga0105241_123935021 | 3300009174 | Corn Rhizosphere | VQKLIDHTTISKYELDKNEPPLTVLLAYARLVEIPVEQIIDDEIELTI* |
| Ga0105241_125256012 | 3300009174 | Corn Rhizosphere | MFQGEMVRQLGVQDLIHYTNISKYELDKNEPPLAIVLAYARLVGIPVEQIIDDKLELTI* |
| Ga0105242_100658564 | 3300009176 | Miscanthus Rhizosphere | ELDKNEPPLAILLAYARLAGIPVEQIIDDEVELTI* |
| Ga0105242_106644161 | 3300009176 | Miscanthus Rhizosphere | SLGVSQGEMVRRLGVQKLIDHTTISKYELDKNEPPLAILLAYARLAEIPVEQIIDDEFELTI* |
| Ga0105248_100891921 | 3300009177 | Switchgrass Rhizosphere | KYELDKNEPPLAILLAYARLVEIPVEQIIDDEIELTI* |
| Ga0105248_133412071 | 3300009177 | Switchgrass Rhizosphere | KYELDKNEPPLAILLAYARLAEIPVEQIIDDELELTI* |
| Ga0105237_100004602 | 3300009545 | Corn Rhizosphere | MVRRLGVQNLIDHTTISKYELDKNEPPLVILLAYARLIGIPVEQIIDDEIELTI* |
| Ga0105237_108369952 | 3300009545 | Corn Rhizosphere | VSQGELVRQLGVQALIEHTTISKYELNKNEPPLAILLAYARLVEIPVEQIIDDEIELTI* |
| Ga0105237_122709911 | 3300009545 | Corn Rhizosphere | TTISKYELNKNEPPLAILVAYARLAGIPVERIIDDELELTI* |
| Ga0105238_1000306314 | 3300009551 | Corn Rhizosphere | LVKRLGVQALIHYTNISKYELDKNEPPLAILLAYARLAEIPVEQIIDDEIELKI* |
| Ga0105238_100210357 | 3300009551 | Corn Rhizosphere | MVRRLGVQKLVDHTTISKYELNKNEPPLAILLAYARLAEIPVEQIIDDEFELTI* |
| Ga0105249_101904792 | 3300009553 | Switchgrass Rhizosphere | MKVQDYIHYTNISKYELDKNEPPLAVLLAYSRVSGIPLEQIVDDDIEITSG* |
| Ga0105249_114672332 | 3300009553 | Switchgrass Rhizosphere | TISKYELDKNEPPLAILLAYARLVEIPVEQIIDDELELAV* |
| Ga0105249_128402791 | 3300009553 | Switchgrass Rhizosphere | YELDKNEPPLAILLAYARLAGIPVEQIIDDELDLIF* |
| Ga0126313_108319131 | 3300009840 | Serpentine Soil | VFKIIHYTTISKYELDKNEPPLVILLSYARLAVIPVEQIIDDEFDLTI* |
| Ga0126305_102409202 | 3300010036 | Serpentine Soil | MIKRLGVQDLIHYTTISKYELDKNEPPLAILLAYARLVEIPVEQIIDDEIELTI* |
| Ga0126304_110083792 | 3300010037 | Serpentine Soil | VSQGELVKQLGVKDLIHYTNISKYELDKNEPPLAIVLAYARLVGIRVEQLIDDEIELTI* |
| Ga0126304_112752041 | 3300010037 | Serpentine Soil | MVKRLGVQDLIDHTTISKYELDKNEPPLAILLAYARLVEIPVEQIINDELQLTI* |
| Ga0126315_100713101 | 3300010038 | Serpentine Soil | MVRRLGVQKLIDHTTISKYELDKNEPPLAILLAYARLAEIPVEQIIDDEVELTI* |
| Ga0126315_105609672 | 3300010038 | Serpentine Soil | HTTISKYELDKNEPPLVILLAYARLIGIPVEQIINDELELTI* |
| Ga0126308_108382531 | 3300010040 | Serpentine Soil | MVQRLGVQDLIHYTTISKYELDKNEPPLAILLAYARLAEIPVEQIIDDEIELTI* |
| Ga0126312_108774022 | 3300010041 | Serpentine Soil | SKYELDKNEPPLTILLAYAHLVGIPVEQIIDDELELTI* |
| Ga0126312_109221412 | 3300010041 | Serpentine Soil | MVKRLGVQDLIDHTTISKYELDKNEPPLTILLAYARLAGIPVEQIMDDGLELTI* |
| Ga0126311_100154535 | 3300010045 | Serpentine Soil | MVRQLGVQALIEHTTISKYELNKNEPPLTMLLAYARLVEIPVEQIIDDELELMI* |
| Ga0126311_101420531 | 3300010045 | Serpentine Soil | YTNISKYELDKNEPPLAILLAYARLAGIPVEQIIDDELELTI* |
| Ga0126311_101947442 | 3300010045 | Serpentine Soil | TISKYELNKNEPPLAILLAYARLVEIPVEQIIDDEIELTI* |
| Ga0126311_109160852 | 3300010045 | Serpentine Soil | MVQRLGVQELIHYTNISKYELGKNEPPLAILLAYARLAGIPVEQIIDDEIELTI* |
| Ga0126311_110754391 | 3300010045 | Serpentine Soil | MVRRLGVQQLIDHTTISKYELEKNEPPLAIPLAYARLAGIPAEQIIDDEIELTN* |
| Ga0126382_116200881 | 3300010047 | Tropical Forest Soil | GELVRQLGVQALIEHTTISKYELNKNEPPLAILLAYARLVEIPVEQIIDDEIELTI* |
| Ga0126382_117462802 | 3300010047 | Tropical Forest Soil | TNVSKYELDKNEPPLAILLAYSRVARIPVERIIDDDLDLFD* |
| Ga0126382_124235502 | 3300010047 | Tropical Forest Soil | ELDKNEPPLAILLAYARLAEIPVERIIDDELELTI* |
| Ga0126306_115214762 | 3300010166 | Serpentine Soil | RQLGVQALIEHTTISKYELNKNEPPLTILLAYARLVRIPVEQIIDDELELTI* |
| Ga0126376_100052083 | 3300010359 | Tropical Forest Soil | MVRRLGVQELIDHTTVSKYELDKNEPPLAILLAYARLAGIPVEQIIDDEFELTI* |
| Ga0126376_100623851 | 3300010359 | Tropical Forest Soil | YELDKNEPPLAILLAYARLAGIPVEQIIDDEIELTI* |
| Ga0126376_112845101 | 3300010359 | Tropical Forest Soil | LVRQLGVQALIEHTTISKYELNKNEPPLAILLAYARLTGIPVEQIIDDEIELTI* |
| Ga0126372_112808842 | 3300010360 | Tropical Forest Soil | VSQGELVRQLGVQALIEHTTISKYELNKNEPPLVILLAYARRAGIPVEQIIDDEFELTI* |
| Ga0126377_118972531 | 3300010362 | Tropical Forest Soil | LGVQALIDHTTLSKYELNKNEPPLAILLAYARLVGIPVEQIIDDEFDLTI* |
| Ga0134128_100192583 | 3300010373 | Terrestrial Soil | MVKRLGLQDLIDHTTISKYELDKNEPPLAILLAYARLVEILAEQIIDDELVLTI* |
| Ga0134128_131694991 | 3300010373 | Terrestrial Soil | VSQGDIVKRLGVRDLIHYTNISKYELDKNEPPLAILLAYARLVGIPVEQIIDDEIELTI* |
| Ga0105239_106003473 | 3300010375 | Corn Rhizosphere | VSQGELVRQLGVQALIDPTTISKYELDKNEPPLAILLAYARVAEIPVEQIIDDEFELTI* |
| Ga0134126_125536851 | 3300010396 | Terrestrial Soil | MVRRLGVQKLIDHTTISKYELAKNEPPLAILLAYARLAEIPVEQIIDDEFELTI* |
| Ga0134124_107202081 | 3300010397 | Terrestrial Soil | MVRRLGVQKLIDHTTTSKYELDKNEPPLAILLAYARLAEIPVEQIID |
| Ga0134124_109328951 | 3300010397 | Terrestrial Soil | EHTTISKYELNKNEPPLTILLAYARLVEIPVEQIIDDELELTI* |
| Ga0134124_110558772 | 3300010397 | Terrestrial Soil | QKLIDHTTTSKYELDKNEPPLAILLAYARLAEIPVEQIIDDELELTI* |
| Ga0134124_116876231 | 3300010397 | Terrestrial Soil | QKLIDHTTTSKYELDKNEPPLAILLAYARLAEIPVEQIIDDEFELTI* |
| Ga0134124_121883782 | 3300010397 | Terrestrial Soil | LVKRLGVQALIHYTNISKYELDKNELPLAILLAYARLAGIPIEEIIDDDLELTI* |
| Ga0134127_100401295 | 3300010399 | Terrestrial Soil | YELDKNEPPLAILLAYARLVKIPVEQIIDDEIELTI* |
| Ga0134127_103564561 | 3300010399 | Terrestrial Soil | VSQGELVRQLSVQALIDHTTISKYELDKNEPPLVILLAYARLTGIAVEQIIDDELDLTI* |
| Ga0134127_105627683 | 3300010399 | Terrestrial Soil | MVRRLGVQRLIDHTTISKYELDKNEPPIAILLAYARLAGIPVEQIIDDEFDLT |
| Ga0134127_106300771 | 3300010399 | Terrestrial Soil | MVQQLGVQDLIHYTNISKYELDKNEPPLAILLAYARLVEIPVEQVIDDELELTI* |
| Ga0134127_113545111 | 3300010399 | Terrestrial Soil | MSQGEMVRQLGVQDLIHYTNISKYELDKNEPPLAIVLAYARLVGIPVEQIIDDETDLTI* |
| Ga0134127_122520392 | 3300010399 | Terrestrial Soil | DHTTISKYELDKNEPPLAILLAYARLVKIPIEQIIDDEIEITI* |
| Ga0134127_124323741 | 3300010399 | Terrestrial Soil | LIHYTNISKYELDKNEPPLTILLAYARLAGIPIERIIDDELELTI* |
| Ga0134127_131661163 | 3300010399 | Terrestrial Soil | KYELDKNEPPLAILLAYARLVGIPVETLMDDKLDLPPEVRRPRI* |
| Ga0134122_107855351 | 3300010400 | Terrestrial Soil | MSQGEMVKQLGVQDLIHYTNISKYELDKNEPPLAIVLAYARLVGIPVEQIIDDEIVLAI* |
| Ga0134122_128375021 | 3300010400 | Terrestrial Soil | LIDHTTISKYELDKNEPPLAILLAYARLAEIPVEQIIDDEFELTI* |
| Ga0134121_100283017 | 3300010401 | Terrestrial Soil | MVRRLGVQELIDHTTISKYELDKNEPPLAILLAYARLAEIPVEQIIDDEFDLTI* |
| Ga0134121_114295491 | 3300010401 | Terrestrial Soil | VSQGEMVRRLGVQKLIDHTTISKYELDKNEPPLAILLAYARLAKIPVEQIIDDELDLTI* |
| Ga0134121_123428681 | 3300010401 | Terrestrial Soil | LLDHTTISKYELDKNEPPLAILLAYARLIEIPVEQIIDDELELTI* |
| Ga0134121_129416881 | 3300010401 | Terrestrial Soil | HTTISKYELDKNEPPLAILLAYARLAEIPVEQIIDDEFDLTI* |
| Ga0134123_102721891 | 3300010403 | Terrestrial Soil | MEVQDQIHYTNISKYELDKNEPPLGILLAYSRVAGIPVERIIDDDLD |
| Ga0134123_123499011 | 3300010403 | Terrestrial Soil | RSLGVSQGEMVRRLGVQKLIDHTTISKYELDKNEPPLAILLAYARLAEIPVEQIIDDEFELTI* |
| Ga0134123_124452031 | 3300010403 | Terrestrial Soil | SKYELDKNEPPLAILLAYARLAEIPVERIIDDHLELTI* |
| Ga0105246_123395581 | 3300011119 | Miscanthus Rhizosphere | MSQGEMVKQLGVQDLIHYTNISKYELDKNEPPLAIVLAYARLVGIPVEQIIDDEIELTI* |
| Ga0120182_10002711 | 3300011993 | Terrestrial | LVQDLIHYTTISKYELDKNEPPLAILLAYARLAGIPVEQIIDDEFELTI* |
| Ga0120191_101130901 | 3300012022 | Terrestrial | ELDKNEPPLTILLAYARLAGIPVEQIIDDELELTI* |
| Ga0157371_108911532 | 3300013102 | Corn Rhizosphere | ELDKNEPLLVILLAYARLMGIPVEQIIDDELELTI* |
| Ga0157378_128996501 | 3300013297 | Miscanthus Rhizosphere | RLGVQDQIHYPNISKYELDKNEPPLGILLAYARLAEISVEYLIDDNLDLPL* |
| Ga0163162_100893474 | 3300013306 | Switchgrass Rhizosphere | MSQGELVKRLGVQALIHYTNMSKYELNKNEPPLAILLAYARLAEIPVEQIIDDEVELTI* |
| Ga0163162_102288003 | 3300013306 | Switchgrass Rhizosphere | MSQGEMVRQLGVQNLIHYTNISKYELDKNEPPLAIVLAYARLVGIPFEQITDDEIELTI* |
| Ga0163162_113387911 | 3300013306 | Switchgrass Rhizosphere | GVQALIDHTTISKYELDKNEPPLAILLAYARLVGIPVEQIIDDEFELTI* |
| Ga0120195_10076903 | 3300013500 | Terrestrial | YMIVSKYEPDKNEPPLIILLALCSPRRNSVEQIIDDELELTI* |
| Ga0157380_106935511 | 3300014326 | Switchgrass Rhizosphere | MSQGEMVKQLGVQDLIHYTNISKYELDKNEPPLAIVLAYAGLVGIPVEQIIDDEIELII* |
| Ga0182000_105569211 | 3300014487 | Soil | MVKRLGVQDLIDHTTISKYELNKNEPPLAILLAYARLVEVPVEQIIDDGLELTI* |
| Ga0157377_110726021 | 3300014745 | Miscanthus Rhizosphere | SISKYELDKNEPPLAVLLAYARLAGIPVERIIDDELELTI* |
| Ga0157379_109826092 | 3300014968 | Switchgrass Rhizosphere | TISKYELDKNEPPLAILLAYARLAEIPVEQIIDDEFELTI* |
| Ga0157379_112672661 | 3300014968 | Switchgrass Rhizosphere | MKVQDYIHYTNISKYELDKNEPPLGILLAYARLAEIPVEYLIDDKLDLPL* |
| Ga0157379_116329351 | 3300014968 | Switchgrass Rhizosphere | LVRQLGVQALIEHTTISKYELDKNEPPLAILLAYARLAGIPVEQIVDDELELTI* |
| Ga0182007_101532312 | 3300015262 | Rhizosphere | VSQGELVRRLGVQNLIDHTTISKYELDKNEPPLAIVLAYARLVGIPVEQIIDDEIELTI* |
| Ga0132256_1035787732 | 3300015372 | Arabidopsis Rhizosphere | LGVQELIDHTTISKYELDKNEPPLAILLAYARLAEIPVEQIIDDELELTI* |
| Ga0132257_1026436201 | 3300015373 | Arabidopsis Rhizosphere | TTISKYELDKNEPPLAILLAYARLTGFPVEQIIDDELELTI* |
| Ga0132255_1023420882 | 3300015374 | Arabidopsis Rhizosphere | MSQGELVKRLGVQALIHYTNISKYELDKNEPPLAILLAYARLAEIPVEQIIDDEFELTI* |
| Ga0132255_1033982071 | 3300015374 | Arabidopsis Rhizosphere | GEMVKRLGVQDLIHYTTISKYELDKNEPPLTVLLAYARLVEIPVEQIIDDEIELTI* |
| Ga0190270_130340491 | 3300018469 | Soil | GVSQGELVRQLGVQALIEHTTISKYELDKNEPPLAILLAYARLVEIPVEQIIDDEIELTI |
| Ga0210087_10906071 | 3300025559 | Natural And Restored Wetlands | LGVQALIDHTTISKYELDKNEPPLAILLAYARLTGFPVEQIIDDELELTI |
| Ga0207647_100940541 | 3300025904 | Corn Rhizosphere | ELDKNEPPLAILLAYARLAEIPVEQIIDDEFELTI |
| Ga0207647_105482071 | 3300025904 | Corn Rhizosphere | SQPQLVRRLGVQDQIHYPNISKYELDKLEPPLSILLAYARVAEIPVEYLIDDKLDLPL |
| Ga0207654_106305033 | 3300025911 | Corn Rhizosphere | VQALIDHTTISKYELDKNEPPLAILLAYARLAGIPVEQIVDDELELTI |
| Ga0207654_110336141 | 3300025911 | Corn Rhizosphere | YELDKNEPPLAILLAYARLAEIPVEQIIDDEIELKI |
| Ga0207707_107745322 | 3300025912 | Corn Rhizosphere | VSQGELVRQLGVQALIEHTTISKYELNKNEPPLAILLAYARLIGIPVEQIIDDEFDLTI |
| Ga0207695_112276181 | 3300025913 | Corn Rhizosphere | GVEALIDHTTISKYELDKNEPPLAILLAYARLIEIPVEKIIDDEIELTV |
| Ga0207662_104620743 | 3300025918 | Switchgrass Rhizosphere | QALIDHTTISKYELDKNEPPLTILLSYARLVGVPVEQFIDDELELTI |
| Ga0207681_114853161 | 3300025923 | Switchgrass Rhizosphere | HYTNISKYELDKNEPPLAILLAYARLAEIPVEQIIDDELELTN |
| Ga0207694_104023141 | 3300025924 | Corn Rhizosphere | ELNKNEPPLIILLAYARLAGIPVEQIIDDELELAV |
| Ga0207686_106448101 | 3300025934 | Miscanthus Rhizosphere | RQLGVQALIDHTTISKYELDKNEPPLAILLAYARLAEIPVEHIIDDALELTI |
| Ga0207709_101694351 | 3300025935 | Miscanthus Rhizosphere | GEMVRRLGVQNLIDHTTISKYELDKNEPPLAILLAYARLTGIPVERIKKQRIKKQIIDDEIELTM |
| Ga0207670_117016121 | 3300025936 | Switchgrass Rhizosphere | LVFKKLIDHTTISKYELDKNEPPLAILLAYARLAEIPVEQIIDDEFELTI |
| Ga0207704_115126661 | 3300025938 | Miscanthus Rhizosphere | EHTTISKYELDKNEPPLAILLAYARLAGIPVEQIIDDELELTI |
| Ga0207711_111068561 | 3300025941 | Switchgrass Rhizosphere | SKYELDKNEPPLAILLAYARLVQIPVEQIIDDEIELTI |
| Ga0207711_118672111 | 3300025941 | Switchgrass Rhizosphere | ELDKNEPPLTILLAYARLAGIPVEQIIDDELELTI |
| Ga0207689_105054131 | 3300025942 | Miscanthus Rhizosphere | QALIEHTTISKYELNKNEPPLTILLAYARLVGIPVEQIIDDEIELTI |
| Ga0207689_105533081 | 3300025942 | Miscanthus Rhizosphere | LVRQLGVQALIDHTTISKYELDKNEPPLTILLAYARLAKIPVEQIIDDELELTI |
| Ga0207689_107231732 | 3300025942 | Miscanthus Rhizosphere | DHTTISKYELDKNEPPLAILLAYARLAEIPVEQIIDDEFELTI |
| Ga0207689_108323622 | 3300025942 | Miscanthus Rhizosphere | DHTTISKYELDKNEPPLAILLAYARLAEIPVEQLIDDEFELTI |
| Ga0207651_105520623 | 3300025960 | Switchgrass Rhizosphere | EHTTISKYELDKNEPPLAILLAYARLAGIPVEQIIDDEIELTI |
| Ga0207640_107427531 | 3300025981 | Corn Rhizosphere | MIRRLGVQALIDHTTISKYELDKNEPPLAILLAYARLVEIPVEQIIDDEIELTI |
| Ga0207640_115546522 | 3300025981 | Corn Rhizosphere | MVRQLGVQKLIHYTNISKYELDKNEPPLAIVLAYARLVGIPVEQIIDDEIELNVXF |
| Ga0207703_107283351 | 3300026035 | Switchgrass Rhizosphere | QGEMVRRLGVQKLIDHTTISKYELDKNEPPLTILLAYARLAEIPVEQIIDDEFELTI |
| Ga0207639_107767062 | 3300026041 | Corn Rhizosphere | TTISKYELDKNEPPLAILLAYARLAGIPVEQIIDDEIELTI |
| Ga0207641_107130392 | 3300026088 | Switchgrass Rhizosphere | NISKYELDKNEPPLAILLAYARLAEIPVEYLIDDMLDLPL |
| Ga0207676_110720152 | 3300026095 | Switchgrass Rhizosphere | TISKYELDKNEPPLAILLAYARLAEIPVEQLIDDEFELTI |
| Ga0207675_1001031324 | 3300026118 | Switchgrass Rhizosphere | MVKQLGVQDLIHYTNISKYELDKNEPPLAIVLAYARLVGIPVEQIIDDEIKLTI |
| Ga0207675_1012976381 | 3300026118 | Switchgrass Rhizosphere | TTISKYELDKNEPPLAILLAYARLAGIPVEQIIDDELDLIF |
| Ga0207698_126541471 | 3300026142 | Corn Rhizosphere | ELDKNEPPLAILLAYARLLRISVEQIIDDELELTI |
| Ga0209795_100165551 | 3300027718 | Agave | RRLGVQKLIDHTTISKYELDKNEPPLAILLAYARLAGIPVEQIIDDEFELNLIFRKEQGDRLQPY |
| Ga0268264_100109915 | 3300028381 | Switchgrass Rhizosphere | IEHTTISKYELNKNEPPLAILLAYARLAGIPVERIIDDEFELTI |
| Ga0268264_105063803 | 3300028381 | Switchgrass Rhizosphere | RLGVQAHTNISKYELDKNEPPLAILLAYARLAEIPVEQIIDDEVELTI |
| Ga0310812_103592652 | 3300032421 | Soil | VSQGELVRQLGVQALIEHTTISKYELDKNEPPLAILLAYARLVEIPVEQIIDDEIELTI |
| ⦗Top⦘ |