| Basic Information | |
|---|---|
| Family ID | F030015 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 186 |
| Average Sequence Length | 45 residues |
| Representative Sequence | MAQTEAGYRRKWKKWLAIYLAAAAVVYLIVFLVFFNHGGGGGGFGY |
| Number of Associated Samples | 94 |
| Number of Associated Scaffolds | 186 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 69.35 % |
| % of genes near scaffold ends (potentially truncated) | 39.78 % |
| % of genes from short scaffolds (< 2000 bps) | 81.18 % |
| Associated GOLD sequencing projects | 91 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.44 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (59.677 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil (34.946 % of family members) |
| Environment Ontology (ENVO) | Unclassified (46.774 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (66.667 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 45.95% β-sheet: 0.00% Coil/Unstructured: 54.05% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.44 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 186 Family Scaffolds |
|---|---|---|
| PF12900 | Pyridox_ox_2 | 5.38 |
| PF00583 | Acetyltransf_1 | 2.15 |
| PF09286 | Pro-kuma_activ | 1.61 |
| PF08445 | FR47 | 1.08 |
| PF07992 | Pyr_redox_2 | 1.08 |
| PF00111 | Fer2 | 1.08 |
| PF07929 | PRiA4_ORF3 | 1.08 |
| PF13313 | DUF4082 | 1.08 |
| PF03704 | BTAD | 1.08 |
| PF10417 | 1-cysPrx_C | 1.08 |
| PF07883 | Cupin_2 | 0.54 |
| PF13374 | TPR_10 | 0.54 |
| PF08044 | DUF1707 | 0.54 |
| PF13147 | Obsolete Pfam Family | 0.54 |
| PF01872 | RibD_C | 0.54 |
| PF13683 | rve_3 | 0.54 |
| PF11774 | Lsr2 | 0.54 |
| PF12681 | Glyoxalase_2 | 0.54 |
| PF01022 | HTH_5 | 0.54 |
| PF00561 | Abhydrolase_1 | 0.54 |
| PF07676 | PD40 | 0.54 |
| PF13340 | DUF4096 | 0.54 |
| PF12697 | Abhydrolase_6 | 0.54 |
| PF07690 | MFS_1 | 0.54 |
| PF00291 | PALP | 0.54 |
| PF00009 | GTP_EFTU | 0.54 |
| PF00884 | Sulfatase | 0.54 |
| PF04185 | Phosphoesterase | 0.54 |
| PF03625 | DUF302 | 0.54 |
| PF12698 | ABC2_membrane_3 | 0.54 |
| PF00587 | tRNA-synt_2b | 0.54 |
| PF02163 | Peptidase_M50 | 0.54 |
| PF00072 | Response_reg | 0.54 |
| PF06210 | DUF1003 | 0.54 |
| PF00293 | NUDIX | 0.54 |
| PF03551 | PadR | 0.54 |
| PF05016 | ParE_toxin | 0.54 |
| PF01242 | PTPS | 0.54 |
| PF00856 | SET | 0.54 |
| PF13602 | ADH_zinc_N_2 | 0.54 |
| PF00174 | Oxidored_molyb | 0.54 |
| PF05015 | HigB-like_toxin | 0.54 |
| PF08002 | DUF1697 | 0.54 |
| PF01451 | LMWPc | 0.54 |
| PF00027 | cNMP_binding | 0.54 |
| PF13302 | Acetyltransf_3 | 0.54 |
| PF00890 | FAD_binding_2 | 0.54 |
| PF13581 | HATPase_c_2 | 0.54 |
| PF01850 | PIN | 0.54 |
| PF00067 | p450 | 0.54 |
| PF13673 | Acetyltransf_10 | 0.54 |
| PF14023 | DUF4239 | 0.54 |
| COG ID | Name | Functional Category | % Frequency in 186 Family Scaffolds |
|---|---|---|---|
| COG4934 | Serine protease, subtilase family | Posttranslational modification, protein turnover, chaperones [O] | 1.61 |
| COG3947 | Two-component response regulator, SAPR family, consists of REC, wHTH and BTAD domains | Transcription [K] | 1.08 |
| COG3629 | DNA-binding transcriptional regulator DnrI/AfsR/EmbR, SARP family, contains BTAD domain | Transcription [K] | 1.08 |
| COG3439 | Uncharacterized conserved protein, DUF302 family | Function unknown [S] | 0.54 |
| COG4420 | Uncharacterized membrane protein | Function unknown [S] | 0.54 |
| COG3915 | Uncharacterized conserved protein | Function unknown [S] | 0.54 |
| COG3797 | Uncharacterized conserved protein, DUF1697 family | Function unknown [S] | 0.54 |
| COG3549 | Plasmid maintenance system killer protein | Defense mechanisms [V] | 0.54 |
| COG3511 | Phospholipase C | Cell wall/membrane/envelope biogenesis [M] | 0.54 |
| COG0262 | Dihydrofolate reductase | Coenzyme transport and metabolism [H] | 0.54 |
| COG2124 | Cytochrome P450 | Defense mechanisms [V] | 0.54 |
| COG2041 | Molybdopterin-dependent catalytic subunit of periplasmic DMSO/TMAO and protein-methionine-sulfoxide reductases | Energy production and conversion [C] | 0.54 |
| COG1985 | Pyrimidine reductase, riboflavin biosynthesis | Coenzyme transport and metabolism [H] | 0.54 |
| COG1846 | DNA-binding transcriptional regulator, MarR family | Transcription [K] | 0.54 |
| COG1733 | DNA-binding transcriptional regulator, HxlR family | Transcription [K] | 0.54 |
| COG1695 | DNA-binding transcriptional regulator, PadR family | Transcription [K] | 0.54 |
| COG0720 | 6-pyruvoyl-tetrahydropterin synthase | Coenzyme transport and metabolism [H] | 0.54 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 59.68 % |
| All Organisms | root | All Organisms | 40.32 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300004267|Ga0066396_10089367 | Not Available | 555 | Open in IMG/M |
| 3300004268|Ga0066398_10029188 | Not Available | 996 | Open in IMG/M |
| 3300004629|Ga0008092_11128355 | Not Available | 632 | Open in IMG/M |
| 3300005175|Ga0066673_10201298 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → unclassified Streptomyces → Streptomyces sp. 1-11 | 1136 | Open in IMG/M |
| 3300005332|Ga0066388_100081750 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 3607 | Open in IMG/M |
| 3300005332|Ga0066388_100372163 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 2075 | Open in IMG/M |
| 3300005332|Ga0066388_100576203 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1751 | Open in IMG/M |
| 3300005332|Ga0066388_100968685 | Not Available | 1419 | Open in IMG/M |
| 3300005332|Ga0066388_105539425 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Micromonospora → unclassified Micromonospora → Micromonospora sp. CP22 | 639 | Open in IMG/M |
| 3300005332|Ga0066388_106099782 | Not Available | 608 | Open in IMG/M |
| 3300005332|Ga0066388_107893221 | Not Available | 532 | Open in IMG/M |
| 3300005332|Ga0066388_108315628 | Not Available | 517 | Open in IMG/M |
| 3300005434|Ga0070709_10134331 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 1693 | Open in IMG/M |
| 3300005434|Ga0070709_10552188 | Not Available | 881 | Open in IMG/M |
| 3300005435|Ga0070714_100165429 | Not Available | 2004 | Open in IMG/M |
| 3300005436|Ga0070713_100185385 | Not Available | 1872 | Open in IMG/M |
| 3300005535|Ga0070684_101606311 | Not Available | 613 | Open in IMG/M |
| 3300005713|Ga0066905_100640983 | Not Available | 904 | Open in IMG/M |
| 3300005713|Ga0066905_102083700 | Not Available | 527 | Open in IMG/M |
| 3300005764|Ga0066903_100237029 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2792 | Open in IMG/M |
| 3300005764|Ga0066903_100587969 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1924 | Open in IMG/M |
| 3300005764|Ga0066903_101564262 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1248 | Open in IMG/M |
| 3300005764|Ga0066903_101597866 | Not Available | 1236 | Open in IMG/M |
| 3300005764|Ga0066903_103774689 | Not Available | 814 | Open in IMG/M |
| 3300005764|Ga0066903_104640503 | Not Available | 732 | Open in IMG/M |
| 3300005764|Ga0066903_106012995 | Not Available | 636 | Open in IMG/M |
| 3300005764|Ga0066903_108223196 | Not Available | 534 | Open in IMG/M |
| 3300005983|Ga0081540_1001360 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 21209 | Open in IMG/M |
| 3300006804|Ga0079221_11541047 | Not Available | 535 | Open in IMG/M |
| 3300006806|Ga0079220_10139292 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1322 | Open in IMG/M |
| 3300006854|Ga0075425_101569519 | Not Available | 742 | Open in IMG/M |
| 3300006954|Ga0079219_10911495 | Not Available | 713 | Open in IMG/M |
| 3300009137|Ga0066709_104013310 | Not Available | 535 | Open in IMG/M |
| 3300009177|Ga0105248_11840361 | Not Available | 687 | Open in IMG/M |
| 3300009792|Ga0126374_10207812 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1244 | Open in IMG/M |
| 3300009792|Ga0126374_10246751 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1163 | Open in IMG/M |
| 3300009792|Ga0126374_10332435 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1034 | Open in IMG/M |
| 3300009792|Ga0126374_10357044 | Not Available | 1005 | Open in IMG/M |
| 3300009792|Ga0126374_11173455 | Not Available | 613 | Open in IMG/M |
| 3300010043|Ga0126380_10975685 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 711 | Open in IMG/M |
| 3300010043|Ga0126380_11079954 | Not Available | 682 | Open in IMG/M |
| 3300010043|Ga0126380_11547879 | Not Available | 589 | Open in IMG/M |
| 3300010043|Ga0126380_11627355 | Not Available | 577 | Open in IMG/M |
| 3300010046|Ga0126384_10070733 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2479 | Open in IMG/M |
| 3300010046|Ga0126384_10753497 | Not Available | 868 | Open in IMG/M |
| 3300010046|Ga0126384_11695253 | Not Available | 597 | Open in IMG/M |
| 3300010046|Ga0126384_11868201 | Not Available | 572 | Open in IMG/M |
| 3300010046|Ga0126384_12034291 | Not Available | 550 | Open in IMG/M |
| 3300010046|Ga0126384_12044628 | Not Available | 549 | Open in IMG/M |
| 3300010047|Ga0126382_10390118 | Not Available | 1082 | Open in IMG/M |
| 3300010047|Ga0126382_10410050 | Not Available | 1060 | Open in IMG/M |
| 3300010048|Ga0126373_10200781 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1932 | Open in IMG/M |
| 3300010048|Ga0126373_10287535 | Not Available | 1634 | Open in IMG/M |
| 3300010048|Ga0126373_10342660 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1504 | Open in IMG/M |
| 3300010048|Ga0126373_10344439 | All Organisms → cellular organisms → Bacteria | 1500 | Open in IMG/M |
| 3300010358|Ga0126370_10077739 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2218 | Open in IMG/M |
| 3300010358|Ga0126370_10740802 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 869 | Open in IMG/M |
| 3300010358|Ga0126370_12110907 | Not Available | 553 | Open in IMG/M |
| 3300010359|Ga0126376_10057151 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2789 | Open in IMG/M |
| 3300010359|Ga0126376_10085598 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2358 | Open in IMG/M |
| 3300010359|Ga0126376_10152950 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 1851 | Open in IMG/M |
| 3300010359|Ga0126376_10513993 | Not Available | 1112 | Open in IMG/M |
| 3300010359|Ga0126376_10792976 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Micrococcaceae → Arthrobacter | 924 | Open in IMG/M |
| 3300010360|Ga0126372_10396157 | Not Available | 1258 | Open in IMG/M |
| 3300010360|Ga0126372_10429188 | Not Available | 1217 | Open in IMG/M |
| 3300010360|Ga0126372_10647289 | Not Available | 1023 | Open in IMG/M |
| 3300010360|Ga0126372_10802322 | Not Available | 933 | Open in IMG/M |
| 3300010360|Ga0126372_11731808 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 667 | Open in IMG/M |
| 3300010360|Ga0126372_12211328 | Not Available | 599 | Open in IMG/M |
| 3300010360|Ga0126372_13135009 | Not Available | 513 | Open in IMG/M |
| 3300010361|Ga0126378_11994014 | Not Available | 661 | Open in IMG/M |
| 3300010362|Ga0126377_10300131 | Not Available | 1583 | Open in IMG/M |
| 3300010366|Ga0126379_10036740 | All Organisms → cellular organisms → Bacteria | 3898 | Open in IMG/M |
| 3300010366|Ga0126379_10517560 | Not Available | 1267 | Open in IMG/M |
| 3300010366|Ga0126379_10587619 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1197 | Open in IMG/M |
| 3300010376|Ga0126381_101208553 | Not Available | 1092 | Open in IMG/M |
| 3300010376|Ga0126381_102601276 | Not Available | 724 | Open in IMG/M |
| 3300010398|Ga0126383_10128550 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2324 | Open in IMG/M |
| 3300010398|Ga0126383_10238534 | Not Available | 1775 | Open in IMG/M |
| 3300010398|Ga0126383_10393129 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1421 | Open in IMG/M |
| 3300010398|Ga0126383_10645435 | Not Available | 1133 | Open in IMG/M |
| 3300010398|Ga0126383_11061199 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Saccharibacteria | 899 | Open in IMG/M |
| 3300010398|Ga0126383_11493889 | Not Available | 765 | Open in IMG/M |
| 3300010398|Ga0126383_11632712 | Not Available | 734 | Open in IMG/M |
| 3300010398|Ga0126383_12317739 | Not Available | 622 | Open in IMG/M |
| 3300010398|Ga0126383_13589554 | Not Available | 507 | Open in IMG/M |
| 3300012208|Ga0137376_11360044 | Not Available | 601 | Open in IMG/M |
| 3300012350|Ga0137372_10122579 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → unclassified Pseudonocardiales → Pseudonocardiales bacterium | 2153 | Open in IMG/M |
| 3300012971|Ga0126369_10848292 | All Organisms → cellular organisms → Bacteria | 997 | Open in IMG/M |
| 3300012971|Ga0126369_10975212 | Not Available | 935 | Open in IMG/M |
| 3300012971|Ga0126369_11223023 | Not Available | 841 | Open in IMG/M |
| 3300015372|Ga0132256_101534776 | Not Available | 776 | Open in IMG/M |
| 3300015372|Ga0132256_102384845 | Not Available | 632 | Open in IMG/M |
| 3300015372|Ga0132256_103004862 | Not Available | 567 | Open in IMG/M |
| 3300016294|Ga0182041_10069935 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2464 | Open in IMG/M |
| 3300016294|Ga0182041_11755488 | Not Available | 575 | Open in IMG/M |
| 3300016319|Ga0182033_11303128 | Not Available | 652 | Open in IMG/M |
| 3300016357|Ga0182032_10524444 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 977 | Open in IMG/M |
| 3300016357|Ga0182032_10589261 | Not Available | 924 | Open in IMG/M |
| 3300016422|Ga0182039_11110458 | Not Available | 712 | Open in IMG/M |
| 3300016422|Ga0182039_11172412 | Not Available | 693 | Open in IMG/M |
| 3300016445|Ga0182038_10451239 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1088 | Open in IMG/M |
| 3300017947|Ga0187785_10083925 | Not Available | 1249 | Open in IMG/M |
| 3300017947|Ga0187785_10696534 | Not Available | 533 | Open in IMG/M |
| 3300017959|Ga0187779_10312936 | Not Available | 1007 | Open in IMG/M |
| 3300017959|Ga0187779_10453820 | All Organisms → cellular organisms → Bacteria | 843 | Open in IMG/M |
| 3300017961|Ga0187778_11252971 | Not Available | 521 | Open in IMG/M |
| 3300017966|Ga0187776_10205214 | Not Available | 1241 | Open in IMG/M |
| 3300017973|Ga0187780_10498387 | Not Available | 870 | Open in IMG/M |
| 3300017974|Ga0187777_10057730 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2503 | Open in IMG/M |
| 3300017974|Ga0187777_10435013 | Not Available | 911 | Open in IMG/M |
| 3300017999|Ga0187767_10029902 | Not Available | 1243 | Open in IMG/M |
| 3300017999|Ga0187767_10072336 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 904 | Open in IMG/M |
| 3300018058|Ga0187766_10173617 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Geodermatophilales → Geodermatophilaceae → unclassified Geodermatophilaceae → Geodermatophilaceae bacterium | 1350 | Open in IMG/M |
| 3300018058|Ga0187766_10580798 | Not Available | 763 | Open in IMG/M |
| 3300018060|Ga0187765_10028201 | Not Available | 2746 | Open in IMG/M |
| 3300018060|Ga0187765_10029614 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2690 | Open in IMG/M |
| 3300018060|Ga0187765_10052742 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 2098 | Open in IMG/M |
| 3300018060|Ga0187765_10348866 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Herpetosiphonales → Herpetosiphonaceae → unclassified Herpetosiphonaceae → Herpetosiphonaceae bacterium | 900 | Open in IMG/M |
| 3300018064|Ga0187773_10008867 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 4162 | Open in IMG/M |
| 3300018089|Ga0187774_10465246 | Not Available | 787 | Open in IMG/M |
| 3300018433|Ga0066667_11384863 | All Organisms → cellular organisms → Bacteria | 617 | Open in IMG/M |
| 3300018482|Ga0066669_11759028 | Not Available | 571 | Open in IMG/M |
| 3300021560|Ga0126371_10018210 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 6455 | Open in IMG/M |
| 3300021560|Ga0126371_10094469 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2964 | Open in IMG/M |
| 3300021560|Ga0126371_10138546 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae | 2481 | Open in IMG/M |
| 3300021560|Ga0126371_10150065 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2391 | Open in IMG/M |
| 3300021560|Ga0126371_10877155 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1042 | Open in IMG/M |
| 3300021560|Ga0126371_11011241 | Not Available | 973 | Open in IMG/M |
| 3300021560|Ga0126371_11118294 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → Streptomyces violaceusniger group → Streptomyces malaysiensis | 926 | Open in IMG/M |
| 3300021560|Ga0126371_12576359 | Not Available | 616 | Open in IMG/M |
| 3300021560|Ga0126371_12617975 | Not Available | 611 | Open in IMG/M |
| 3300021560|Ga0126371_13583844 | Not Available | 524 | Open in IMG/M |
| 3300025898|Ga0207692_10446113 | Not Available | 814 | Open in IMG/M |
| 3300025898|Ga0207692_11198690 | Not Available | 504 | Open in IMG/M |
| 3300025905|Ga0207685_10053220 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1571 | Open in IMG/M |
| 3300025928|Ga0207700_11218008 | Not Available | 672 | Open in IMG/M |
| 3300027654|Ga0209799_1111443 | Not Available | 622 | Open in IMG/M |
| 3300031543|Ga0318516_10104725 | Not Available | 1601 | Open in IMG/M |
| 3300031543|Ga0318516_10142027 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1377 | Open in IMG/M |
| 3300031543|Ga0318516_10177779 | Not Available | 1225 | Open in IMG/M |
| 3300031543|Ga0318516_10853329 | Not Available | 513 | Open in IMG/M |
| 3300031544|Ga0318534_10049970 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2338 | Open in IMG/M |
| 3300031546|Ga0318538_10766215 | Not Available | 524 | Open in IMG/M |
| 3300031549|Ga0318571_10224497 | Not Available | 681 | Open in IMG/M |
| 3300031561|Ga0318528_10605965 | Not Available | 587 | Open in IMG/M |
| 3300031573|Ga0310915_10148393 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1620 | Open in IMG/M |
| 3300031680|Ga0318574_10879442 | Not Available | 525 | Open in IMG/M |
| 3300031719|Ga0306917_10896982 | Not Available | 694 | Open in IMG/M |
| 3300031724|Ga0318500_10132404 | Not Available | 1161 | Open in IMG/M |
| 3300031724|Ga0318500_10700911 | Not Available | 516 | Open in IMG/M |
| 3300031771|Ga0318546_10335936 | Not Available | 1050 | Open in IMG/M |
| 3300031780|Ga0318508_1256041 | Not Available | 503 | Open in IMG/M |
| 3300031781|Ga0318547_10014498 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3729 | Open in IMG/M |
| 3300031781|Ga0318547_10291586 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales | 990 | Open in IMG/M |
| 3300031782|Ga0318552_10022180 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2831 | Open in IMG/M |
| 3300031792|Ga0318529_10007760 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3862 | Open in IMG/M |
| 3300031793|Ga0318548_10032554 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2297 | Open in IMG/M |
| 3300031805|Ga0318497_10746963 | Not Available | 548 | Open in IMG/M |
| 3300031831|Ga0318564_10306610 | Not Available | 700 | Open in IMG/M |
| 3300031859|Ga0318527_10220473 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Geodermatophilales → Geodermatophilaceae → unclassified Geodermatophilaceae → Geodermatophilaceae bacterium | 804 | Open in IMG/M |
| 3300031893|Ga0318536_10104427 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Geodermatophilales → Geodermatophilaceae → unclassified Geodermatophilaceae → Geodermatophilaceae bacterium | 1423 | Open in IMG/M |
| 3300031912|Ga0306921_10431012 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1538 | Open in IMG/M |
| 3300031942|Ga0310916_11033330 | Not Available | 685 | Open in IMG/M |
| 3300031946|Ga0310910_10326949 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1209 | Open in IMG/M |
| 3300032054|Ga0318570_10157403 | Not Available | 1018 | Open in IMG/M |
| 3300032055|Ga0318575_10711185 | Not Available | 508 | Open in IMG/M |
| 3300032064|Ga0318510_10016461 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2281 | Open in IMG/M |
| 3300032064|Ga0318510_10099196 | Not Available | 1106 | Open in IMG/M |
| 3300032089|Ga0318525_10539091 | Not Available | 597 | Open in IMG/M |
| 3300032090|Ga0318518_10581109 | Not Available | 572 | Open in IMG/M |
| 3300032091|Ga0318577_10601423 | Not Available | 522 | Open in IMG/M |
| 3300032261|Ga0306920_102095963 | Not Available | 789 | Open in IMG/M |
| 3300032770|Ga0335085_10004158 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 24207 | Open in IMG/M |
| 3300032770|Ga0335085_10011776 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 12942 | Open in IMG/M |
| 3300032770|Ga0335085_10089826 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 4006 | Open in IMG/M |
| 3300032783|Ga0335079_11006808 | Not Available | 850 | Open in IMG/M |
| 3300032805|Ga0335078_10000701 | All Organisms → cellular organisms → Bacteria | 51675 | Open in IMG/M |
| 3300032805|Ga0335078_10004573 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 20493 | Open in IMG/M |
| 3300032805|Ga0335078_10199877 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2776 | Open in IMG/M |
| 3300032805|Ga0335078_10274322 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 2284 | Open in IMG/M |
| 3300032805|Ga0335078_11974085 | Not Available | 626 | Open in IMG/M |
| 3300032828|Ga0335080_10323507 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1669 | Open in IMG/M |
| 3300033134|Ga0335073_10946734 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides → unclassified Nocardioides → Nocardioides sp. URHA0020 | 900 | Open in IMG/M |
| 3300033158|Ga0335077_12233778 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 502 | Open in IMG/M |
| 3300033803|Ga0314862_0033303 | Not Available | 1064 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 34.95% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 17.20% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 11.29% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 10.22% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 6.45% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 5.91% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.76% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.61% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.61% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 1.61% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 1.08% |
| Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland | 0.54% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.54% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.54% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.54% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.54% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.54% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.54% |
| Tropical Rainforest Soil | Environmental → Terrestrial → Soil → Unclassified → Tropical Rainforest → Tropical Rainforest Soil | 0.54% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300004267 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 6 MoBio | Environmental | Open in IMG/M |
| 3300004268 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 MoBio | Environmental | Open in IMG/M |
| 3300004629 | Tropical rainforest soil microbial communities from the Amazon Forest, Brazil, analyzing deforestation - Metatranscriptome P72I A01 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005175 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
| 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
| 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
| 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Environmental | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Host-Associated | Open in IMG/M |
| 3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
| 3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012350 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
| 3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
| 3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
| 3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
| 3300017947 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_4_20_MG | Environmental | Open in IMG/M |
| 3300017959 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MG | Environmental | Open in IMG/M |
| 3300017961 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_20_MG | Environmental | Open in IMG/M |
| 3300017966 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MG | Environmental | Open in IMG/M |
| 3300017973 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MG | Environmental | Open in IMG/M |
| 3300017974 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MG | Environmental | Open in IMG/M |
| 3300017999 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP10_10_MG | Environmental | Open in IMG/M |
| 3300018058 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MG | Environmental | Open in IMG/M |
| 3300018060 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MG | Environmental | Open in IMG/M |
| 3300018064 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_10_MG | Environmental | Open in IMG/M |
| 3300018089 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_20_MG | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027654 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 MoBio (SPAdes) | Environmental | Open in IMG/M |
| 3300031543 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20 | Environmental | Open in IMG/M |
| 3300031544 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26 | Environmental | Open in IMG/M |
| 3300031546 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23 | Environmental | Open in IMG/M |
| 3300031549 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f24 | Environmental | Open in IMG/M |
| 3300031561 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26 | Environmental | Open in IMG/M |
| 3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
| 3300031680 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22 | Environmental | Open in IMG/M |
| 3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
| 3300031724 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f20 | Environmental | Open in IMG/M |
| 3300031771 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19 | Environmental | Open in IMG/M |
| 3300031780 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f21 | Environmental | Open in IMG/M |
| 3300031781 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20 | Environmental | Open in IMG/M |
| 3300031782 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f20 | Environmental | Open in IMG/M |
| 3300031792 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f23 | Environmental | Open in IMG/M |
| 3300031793 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f21 | Environmental | Open in IMG/M |
| 3300031805 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f23 | Environmental | Open in IMG/M |
| 3300031831 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f20 | Environmental | Open in IMG/M |
| 3300031859 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f25 | Environmental | Open in IMG/M |
| 3300031893 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f28 | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
| 3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
| 3300032054 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f23 | Environmental | Open in IMG/M |
| 3300032055 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f23 | Environmental | Open in IMG/M |
| 3300032064 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f17 | Environmental | Open in IMG/M |
| 3300032089 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f23 | Environmental | Open in IMG/M |
| 3300032090 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f22 | Environmental | Open in IMG/M |
| 3300032091 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f25 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
| 3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
| 3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
| 3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
| 3300033134 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.2 | Environmental | Open in IMG/M |
| 3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
| 3300033803 | Tropical peat soil microbial communities from peatlands in Loreto, Peru - MAQ_0_10 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| Ga0066396_100893671 | 3300004267 | Tropical Forest Soil | PIRTKERAMAQTEAGYRRKWKKWLAIYLAAAAVVYLIVFLVFFNHGGGGGSFGY* |
| Ga0066398_100291881 | 3300004268 | Tropical Forest Soil | AMAQTEAGYRRKWKKWLAIYLAAAAVVYLIVFLVFFNHGGGGGSFGY* |
| Ga0008092_111283552 | 3300004629 | Tropical Rainforest Soil | MAQTDAGYRRKWKKWLAIYLAVAAVVYLIVFLVFFSHGGGGGGLGY* |
| Ga0066673_102012983 | 3300005175 | Soil | MAQTEAGHRRKWKKWLAIYLAAAAVVYLIVFLVFFKHGGGGGGYGY* |
| Ga0066388_1000817508 | 3300005332 | Tropical Forest Soil | MAQTEAGHRRKWKKWLAIYLAAAAVVYLIVFLVFFTHGGGGG |
| Ga0066388_1003721633 | 3300005332 | Tropical Forest Soil | QTEAGHRRKWKKWLAIYLAAAAVVYLIVFLVFFTHGGGGGGYGY* |
| Ga0066388_1005762032 | 3300005332 | Tropical Forest Soil | MAQTGVGYRRKWKKWLAIYLAAAAVVYLIVFLVFFKHGGGGGGLYG* |
| Ga0066388_1009686853 | 3300005332 | Tropical Forest Soil | MAQTEAGYRRKWKKWLAIYLAVAVVVYLIVFLVFFNHAGGGAGFGY* |
| Ga0066388_1055394251 | 3300005332 | Tropical Forest Soil | MAQTEAGHRRKWKKWLAIYLAAAAVVYLIVFLVFFNHGGGGGDFGY* |
| Ga0066388_1060997822 | 3300005332 | Tropical Forest Soil | RRRRAMAQTEAGHRRKWKKWLAVYLAAAAVVYLIVFLVFFNHGGGGGGFGY* |
| Ga0066388_1078932212 | 3300005332 | Tropical Forest Soil | MAHTEAGHRHKWKKWLAIYLAAAAVVYLIVFLVFFNHGGGG |
| Ga0066388_1083156281 | 3300005332 | Tropical Forest Soil | MAQTEAGYRRKWKKWLAIYLAAAAVVYLIVFLVFFNHGGGGGSFGY* |
| Ga0070709_101343311 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | MAQTGAGYRRKWKKWLAIYLAAAAVVYLIVFLVFFRHGGGASGYGY* |
| Ga0070709_105521881 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | MAQTAAGHRRNWKKWLAIYLAAAAVVYLIVFLVFFKHGGGGGGYGY* |
| Ga0070714_1001654292 | 3300005435 | Agricultural Soil | MAQTAAGHRRKWKKWLAIYLAAAAVVYLIVFLVFFKHGGGGGGYGY* |
| Ga0070713_1001853852 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | MAETQAGHRRKWKKWLAIYLAAAAVVYLIVFLVFFNHGGGGGGFSY* |
| Ga0070684_1016063111 | 3300005535 | Corn Rhizosphere | TKEAGMAETQAGHRRKWKKWLAIYLAAAAVVYLIVFLVFFKHGGGGGGYGY* |
| Ga0066905_1006409832 | 3300005713 | Tropical Forest Soil | WKKWLAIYLAAAAVVYLIVFLVFFNHGGGGGYGY* |
| Ga0066905_1020837002 | 3300005713 | Tropical Forest Soil | MAQTEAGHRRKWKKWLAIYLAAAAVVYLIVFLVFFNHGGGGGGFGY* |
| Ga0066903_1002370294 | 3300005764 | Tropical Forest Soil | MAQTEAGYRRKWKKWLAIYLAAAAVVYLIVFLVFFNHGGGGGGFGY* |
| Ga0066903_1005879691 | 3300005764 | Tropical Forest Soil | MAQTEAGYRRKWKKWLAIYLAAAAVVYLIVFLVFFSHGGGGGGYGY* |
| Ga0066903_1015642624 | 3300005764 | Tropical Forest Soil | MAQTAAGHRKWKKWLAIYLAAAAVVYLIVFLVFFRHGGGGGGYGY* |
| Ga0066903_1015978661 | 3300005764 | Tropical Forest Soil | MAQTEAGHRRKWKKWLAIYLAAAAVVYLIVFLVFFSHGGGGGGYGY* |
| Ga0066903_1037746892 | 3300005764 | Tropical Forest Soil | TKEAGMAQTEAGHRRKWKKWLAIYLAAAAVVYLIVFLVFFNHGGGGGGFGY* |
| Ga0066903_1046405033 | 3300005764 | Tropical Forest Soil | EAGYRRKWKKWLAIYLAVAVVVYLIVFLVFFNHGGGGAGFGY* |
| Ga0066903_1060129952 | 3300005764 | Tropical Forest Soil | KVAGYGRKWKKWVWIYLAAAAVVYFIVFLVFFHHGGGGGFGY* |
| Ga0066903_1082231962 | 3300005764 | Tropical Forest Soil | MAQTEAGYRRKWKKWLAIYLVAGAVVYLIVFLVFFNHGGGGGGFSY* |
| Ga0081540_100136023 | 3300005983 | Tabebuia Heterophylla Rhizosphere | MAQTQAGRRRKWKKWLAIYLAVAAVIYLIVFLVFFTHGGGAGGGY* |
| Ga0079221_115410471 | 3300006804 | Agricultural Soil | MAQTAAGHRRKWKKWLAIYLAAAAIVYLIVFLVFFKHGGGGGGYGY* |
| Ga0079220_101392921 | 3300006806 | Agricultural Soil | MAQTEAGHRRKWKKWLAIYLATAAVVYLIVFLVFFKHGGGSGGYGY* |
| Ga0075425_1015695191 | 3300006854 | Populus Rhizosphere | MAQTAAGHRRKWKKWLAIYLAAAAVVYLIVFLVFFNHGGGGGGFGY* |
| Ga0079219_109114952 | 3300006954 | Agricultural Soil | MAQIEAGHRRKWKKWLAIYLATAAVVYLIVFLVFFKHGGGSGGYGY* |
| Ga0066709_1040133101 | 3300009137 | Grasslands Soil | MAQTAAGHRRKWKRWLAIYLAAAAVVYLIVFLVFFKHGGGGGGYGY* |
| Ga0105248_118403611 | 3300009177 | Switchgrass Rhizosphere | RRKWKKWLAIYLAAAAVVYLIVFLVFFKHGGGGGGYGY* |
| Ga0126374_102078121 | 3300009792 | Tropical Forest Soil | MAQTEAGYRRKWKKWLAIYLAAALVIYLIVFLVFFNHGGGGGGFGY* |
| Ga0126374_102467513 | 3300009792 | Tropical Forest Soil | RKWKKWLAIYLAAAAVVYLIVFLVFFNHGGGGGGFGY* |
| Ga0126374_103324351 | 3300009792 | Tropical Forest Soil | RRRAMAQTQAGYRRKWKKWLAIYLAVAAVVYLIVFLVFFNHGGGGGGLGY* |
| Ga0126374_103570441 | 3300009792 | Tropical Forest Soil | MAQTEAGHRRKWKKWLAIYLAVAVVVYLIVFLVFFNHGGGGAGFGY* |
| Ga0126374_111734551 | 3300009792 | Tropical Forest Soil | EAGHRRKWKKWLAIYLAAAAVVYLIVFLVFFNHGGGGGGFGY* |
| Ga0126380_109756852 | 3300010043 | Tropical Forest Soil | MAQTEAGHRRKWKKWLAIYLAAAAVVYLIVFLVFFRHGGGAGGYGY* |
| Ga0126380_110799541 | 3300010043 | Tropical Forest Soil | MAQTHAGYRRKWKKWLAIYLAVAAVVYLIVFLVFFSHGGGGGGLGY* |
| Ga0126380_115478791 | 3300010043 | Tropical Forest Soil | MAHAEAGYRRKWKKWLAIYLAVAVVVYLIVFLVFFNHGGGGAGFGY* |
| Ga0126380_116273551 | 3300010043 | Tropical Forest Soil | MAQTEAGYRHKWKKWLAIYLAVAVVIYLIVFLVFFNHGGGGGGLGY* |
| Ga0126384_100707331 | 3300010046 | Tropical Forest Soil | MAQTEAGYRRKWKKWLAIYLAAAVVIYLIVFLVFFNHGGGGGGFGY* |
| Ga0126384_107534972 | 3300010046 | Tropical Forest Soil | MAQTEAGYRRKWKKWLAIYLAAAAVIYLIVFLVFFNHGGGGGGFGY* |
| Ga0126384_116952531 | 3300010046 | Tropical Forest Soil | MAQTDAGYRRKWKKWLAIYLAVAVVVYLIVFLVFFNHGGGGAGFGY* |
| Ga0126384_118682011 | 3300010046 | Tropical Forest Soil | MAQTEAGHRRKWKKWLAIYLAVAVVVYLIVFLVFFNHAGGGAGFGY* |
| Ga0126384_120342911 | 3300010046 | Tropical Forest Soil | MAQTQAGYRRKWKKWLAIYLAVAAVVYLIVFLVFFNHGGGGGSFGY* |
| Ga0126384_120446281 | 3300010046 | Tropical Forest Soil | RRRAMAQTEAGYRRKWKKWLAIYLAAALVIYLIVFLVFFNHGGGGGGFGY* |
| Ga0126382_103901182 | 3300010047 | Tropical Forest Soil | MAQTQAGHRRKWKKRLAICLAVAAVVYLIVFLVFFSHGGGGGGLGY* |
| Ga0126382_104100501 | 3300010047 | Tropical Forest Soil | MAQTEAGYRRKWKKWLAIYLAVAAVVYLIVFLVFFNHGGGGGSFGY* |
| Ga0126373_102007812 | 3300010048 | Tropical Forest Soil | MAQTEAGYRRKWKKWLAIYLAAAAVVYLIVFLVFFNHGGGVGGYGY* |
| Ga0126373_102875352 | 3300010048 | Tropical Forest Soil | MAHSEAGYRRKWKKWLAIYLAIAVVVYLIVFLVFFNHGGGGGGVGY* |
| Ga0126373_103426603 | 3300010048 | Tropical Forest Soil | MAQTEAGYRHKWKKWLAIYLAVAVVVYLIVFLVFFNHGGGGGGLGY* |
| Ga0126373_103444393 | 3300010048 | Tropical Forest Soil | MAQTEAGHRRKWKKWLAIYLAVAVVVYLIVFLVFFNHGGGGGGFGY* |
| Ga0126370_100777392 | 3300010358 | Tropical Forest Soil | MAQTEAGYRRKWKKWLAIYLAAAAVVYLIVFLVFFNHGGGGGGLGY* |
| Ga0126370_107408021 | 3300010358 | Tropical Forest Soil | MAQTEAGHRRKWKKWLAIYLAAAAVVYLIVFLVFYKHGGGGGYGY* |
| Ga0126370_121109072 | 3300010358 | Tropical Forest Soil | RRAMAQTEAGYRRKWKKWLAIYLAAAAVVYLIVFLVFFNHGGGVGGYGY* |
| Ga0126376_100571515 | 3300010359 | Tropical Forest Soil | RRKWKKWLAIYLAAAAVVYLIVFLVFFNHGGGGGFGY* |
| Ga0126376_100855981 | 3300010359 | Tropical Forest Soil | MAQTEAGYRRKWKKWLAIYLAAAAVVYLIVFLVFFNHAGGGGGFGY* |
| Ga0126376_101529502 | 3300010359 | Tropical Forest Soil | MAQTEAGHRRKWKKWLAIYLAAAAVIYLIVFLVFFRHGGGAGGYGY* |
| Ga0126376_105139931 | 3300010359 | Tropical Forest Soil | MAQTEAGHRRKWKKWLAIYLAAAAVVYLIVFLVFFNHGGGGAGFGY* |
| Ga0126376_107929762 | 3300010359 | Tropical Forest Soil | RAMAQTEAGHRRKWKKWLAIYLAVAVVVYLIVFLVFFNHGGGGAGFGY* |
| Ga0126372_103961572 | 3300010360 | Tropical Forest Soil | MAHTEAGHRRKWKKWLAIYLAAAAVVYLIVFLVFFNHGGGGGGFG* |
| Ga0126372_104291882 | 3300010360 | Tropical Forest Soil | MAQTEAGHRRKWKKWLAIYLAAAAVVYLIVFLVFFNHGGGGGGFG |
| Ga0126372_106472891 | 3300010360 | Tropical Forest Soil | MAQTEAGYRHKWKKWLAIYLAVALVVYLIVFLVFFSHGGGGGGLGY* |
| Ga0126372_108023221 | 3300010360 | Tropical Forest Soil | RRKWKKWLAIYLAAAAVVYLIVFLVFFTHGGGGGGYGY* |
| Ga0126372_117318081 | 3300010360 | Tropical Forest Soil | KKWLAIYLAAAAVVYLIVFLVFFNHGGGGGGFGY* |
| Ga0126372_122113281 | 3300010360 | Tropical Forest Soil | MAQTEAGHRRKWKKWLAIYLAAAAVVYLIVFLVFFTHGGGGGGYGY* |
| Ga0126372_131350091 | 3300010360 | Tropical Forest Soil | VAQTEAGYRRKWKKWLAIYLAVAVVVYLIVFLVFFNHGGGGGGFGY* |
| Ga0126378_119940141 | 3300010361 | Tropical Forest Soil | TEAGYRRKWKKWLAIYLAAAAVVYLIVFLVFFSHGGGGGGYGY* |
| Ga0126377_103001312 | 3300010362 | Tropical Forest Soil | ARTYYRESDPTRTKEAGMAQTEAGHRRKWKKWLAIYLAAAAVVYLIVFLVFFNHGGGGGGFGY* |
| Ga0126379_100367404 | 3300010366 | Tropical Forest Soil | MAQTEAGYRRKWKKWLAIYLAVAVVVYLIVFLVFFNHGGGGAGFGY* |
| Ga0126379_105175602 | 3300010366 | Tropical Forest Soil | MAQTEAGYRRKWKKWLAISLAVAAVGYLIVFLVFFNHGGGGAGFGY* |
| Ga0126379_105876192 | 3300010366 | Tropical Forest Soil | MAQTEAGYRRKWKKWLAIYLAVAVVVYLIVFLVFFNHGGGGGGYGY* |
| Ga0126381_1012085532 | 3300010376 | Tropical Forest Soil | MAQSEAGYRRKWKKWLAIYLAIAVVVYLIVILVFFNHGGGGGGVGY* |
| Ga0126381_1026012761 | 3300010376 | Tropical Forest Soil | RRKWKKWLAIYLAAAAVVYLIVFLVFFNHGGGGGGYGY* |
| Ga0126383_101285504 | 3300010398 | Tropical Forest Soil | MAQTEAGYRRKWKKWLAISLAVAAVGYLIMFLVFFNHGGGGAGFGY* |
| Ga0126383_102385341 | 3300010398 | Tropical Forest Soil | MAQTEAGYRRKWKKWLAIYLAVAVVVYLIVFLVFFNHGGGGAGVGY* |
| Ga0126383_103931293 | 3300010398 | Tropical Forest Soil | RTKERAMAQTEAGYRRKWKKWLAIYLAAAAVIYLIVFLVFFNHGGGGGGFGY* |
| Ga0126383_106454352 | 3300010398 | Tropical Forest Soil | MAQTEAGYRRKWKKWLAIYLAAAVVVYLIVFLVFFNHGGGGGGYGY* |
| Ga0126383_110611992 | 3300010398 | Tropical Forest Soil | MAEKEAGYRRKWKKWLAIYLAVAVVVYLIVFLVFFNHGGGGGGFSY* |
| Ga0126383_114938892 | 3300010398 | Tropical Forest Soil | MAQTEAGHRRKWKKWLAIYLAAAAVVYLIVFLVFF |
| Ga0126383_116327121 | 3300010398 | Tropical Forest Soil | MAQTEAGYRHKWKKWLAIYLAAAVVIYLIVFLVFFNHGGGGGGLGY* |
| Ga0126383_123177392 | 3300010398 | Tropical Forest Soil | MAQTDAGYRRKWKKWLAIYLAAAVVIYLIVFLVFFNHGGGGGGFGY* |
| Ga0126383_135895541 | 3300010398 | Tropical Forest Soil | KWKKWLAIYLAAAAVVYLIVFLVFFRHGGGGGGYGY* |
| Ga0137376_113600442 | 3300012208 | Vadose Zone Soil | MAQREAGYRRKWKKWLAIYLVVAAVVYLIVFLVFFNHGGGGGGFGY* |
| Ga0137372_101225793 | 3300012350 | Vadose Zone Soil | MAQTEAGYRRKWKKWLAIYLAVAAVVYLIVFLVFFSHGGGGTGYGY* |
| Ga0126369_108482922 | 3300012971 | Tropical Forest Soil | YRRKWKKWLAIYLAIAVVVYLIVILVFFNHGGGGGGVGY* |
| Ga0126369_109752121 | 3300012971 | Tropical Forest Soil | ERRRRAMAQTEAGYRRKWKKWLAIYLAAAAVVYLIVFLVFFSHGGGGGGYGY* |
| Ga0126369_112230232 | 3300012971 | Tropical Forest Soil | MAQTEAGYRRKWKKWLAIYLAVAVVVYLIVFLVFFNHGGGGGG |
| Ga0132256_1015347761 | 3300015372 | Arabidopsis Rhizosphere | AGHRRKWKKWLAIYLATAAVVYLIVFLVFFKHGGGGGGYGY* |
| Ga0132256_1023848451 | 3300015372 | Arabidopsis Rhizosphere | MAQTEAGHRRKWKKWLAIYLATAAVVYLIVFLVFFKHGGG |
| Ga0132256_1030048622 | 3300015372 | Arabidopsis Rhizosphere | MAQTAAGHRRKWKKWLAIYLATAAVVYLIVFLVFFKHGG |
| Ga0182041_100699351 | 3300016294 | Soil | EAGYRRKWKKWLAIYLAVAVVVYLIVFLVFFNHGGGGAGLGY |
| Ga0182041_117554881 | 3300016294 | Soil | MALREAGYRRKWKKWLPICLAIAAVVYLIVFLVFFSHGGGGGYG |
| Ga0182033_113031281 | 3300016319 | Soil | MAQREAGYRRKWKKWLAIAAMVYLIVFLVVFNHGG |
| Ga0182032_105244441 | 3300016357 | Soil | MAQIEAGYRHKWKKWRYPAIYLAVAAVVYLIVFLVFFNHGGGGGGLGY |
| Ga0182032_105892611 | 3300016357 | Soil | KGIHHERRGRVMAQTEAGHRRKWKKWLAISLAVAVVVYLIVFLVFFNHGGGGAGFGY |
| Ga0182039_111104581 | 3300016422 | Soil | MAQTQAGHRRKWKKWLAIYLTAAAVVYLIVFLVFFSHGGGGGGYGY |
| Ga0182039_111724121 | 3300016422 | Soil | REAGYRRKWKKWLAIYLAIAVVVYLIVFLVFFSHGGGGGYGY |
| Ga0182038_104512391 | 3300016445 | Soil | QAGHRRKWKKWLAIYLAAAAVVYLIVFLVFFSHGGGGGGYGY |
| Ga0187785_100839252 | 3300017947 | Tropical Peatland | VAQTEAGYRRKWKKWLAIYLAVAVVVYLIVFLVFFNHGGAGAGYGY |
| Ga0187785_106965341 | 3300017947 | Tropical Peatland | AQTEAGYRRKWKKWLAIYLAVAVVVYLIVFLVFFNHGGGGAGYGY |
| Ga0187779_103129362 | 3300017959 | Tropical Peatland | MAQTDAGYRRKWKKWLAIYLAAAAVVYLIVFLVFFNHGGGGGGLGY |
| Ga0187779_104538203 | 3300017959 | Tropical Peatland | MARTEAGYRRKWKKWLAIYLAAAAVVYLIVFLVFFNHGGGGGGL |
| Ga0187778_112529712 | 3300017961 | Tropical Peatland | MVQREAGYRRKWKKWLAIYLAIAVVVYLIVFLVFFKHAGGGGGYGY |
| Ga0187776_102052142 | 3300017966 | Tropical Peatland | MAQAEAGYRRKWKKWLAIYLAVAVIVYLIVFLVFFNHGGGGGGLGY |
| Ga0187780_104983872 | 3300017973 | Tropical Peatland | MAQTEAGYRRKWKKWLAICLAVAVVVYLIVFLVFFNHGGGGGGLGY |
| Ga0187777_100577303 | 3300017974 | Tropical Peatland | MVQREAGYRRKWKKWLAIYLAIAVVVYLIVFLVVFNHGGGGGAAGY |
| Ga0187777_104350132 | 3300017974 | Tropical Peatland | MAQTEAGYRRKWKRWLAIYLVVAVVVYLIVFLVFFNHGGGG |
| Ga0187767_100299022 | 3300017999 | Tropical Peatland | MAQTEAGHRRKWKKWLAIYLAAAAVVYLIVFLVFFKHGGGGGYGY |
| Ga0187767_100723361 | 3300017999 | Tropical Peatland | MAQTEAGYRRKWKKWLAIYLAVAVIVYLIVFLVFFSHGGGGGGLGY |
| Ga0187766_101736171 | 3300018058 | Tropical Peatland | MAQTEAGYRRKWKRWLAIYLAVAVVVYLIVFLVFFNHGGGGGGLGY |
| Ga0187766_105807982 | 3300018058 | Tropical Peatland | MAKTETGYRRKWKKWLAIYLAVAVVVYLIVFLVFLNHGGGGGVGY |
| Ga0187765_100282012 | 3300018060 | Tropical Peatland | MAKTETGYRRKWKKWLAIYLAVAVVVYLIVFLVFLNHGGGGGGVGY |
| Ga0187765_100296144 | 3300018060 | Tropical Peatland | MAQTEAGYRRKWKRWLAIYLVVAVVVYLIVFLVFFNHGGGGGGLGY |
| Ga0187765_100527423 | 3300018060 | Tropical Peatland | MAQAEVGYRRKWKKWLAISLAVAVVVYLIVFLVFFNHGGGGGGLGY |
| Ga0187765_103488662 | 3300018060 | Tropical Peatland | YERRGRAMAQTEAGYRRKWKKWLAIYLAVAVIVYLIVFLVFFSHGGGGGGLGY |
| Ga0187773_100088676 | 3300018064 | Tropical Peatland | MAQTEAGYRRKWKKWLAIYLAVAVIVYLIVFLVFFNHGGGGGGLGY |
| Ga0187774_104652461 | 3300018089 | Tropical Peatland | MAQTEAGYRRKWKKWLAIYLAVAVVVYLIVFLVFFNHGGGGAGFGY |
| Ga0066667_113848632 | 3300018433 | Grasslands Soil | MAENAKGYGRKWKKWLGIYLAVGAVVYLIVFAVFFHHGGGAGGGFGY |
| Ga0066669_117590281 | 3300018482 | Grasslands Soil | MAQTEAGHRRKWKKWLAIYLAAAAVVYLIVFLVFFKHGGGGGGYGY |
| Ga0126371_100182101 | 3300021560 | Tropical Forest Soil | MAQTEAGHRRKWKKWLAIYLAAAAVVYLIVFLVFFSHGGGGGGYGY |
| Ga0126371_100944691 | 3300021560 | Tropical Forest Soil | MAQSEAGYRRKWKKWLAIYLAIAVVVYLVVFLVFFNHGGGGGGVGY |
| Ga0126371_101385462 | 3300021560 | Tropical Forest Soil | MAQTEAGYRHKWKKWLAIYLAVAVVVYLIVFLVFFNHGGGGGGLGY |
| Ga0126371_101500652 | 3300021560 | Tropical Forest Soil | MAQTEAGYRRKWKKWLAIYLAAAAVVYLIVFLVFFNHGGGGGGFGY |
| Ga0126371_108771552 | 3300021560 | Tropical Forest Soil | MAQTGVGYRRKWKKWLAIYLAAAAVVYLIVFLVVFKHGGGGGGLYG |
| Ga0126371_110112412 | 3300021560 | Tropical Forest Soil | MAQTEAGYRRKWKKWLAIYLAAAAVVYLIVFLVFFNHGGGGSGFGY |
| Ga0126371_111182941 | 3300021560 | Tropical Forest Soil | MAQTDAGYRRKWKKWLAIYLAVAAVVYLIVFLVFFSHGGGGGGLGY |
| Ga0126371_125763592 | 3300021560 | Tropical Forest Soil | AQTEAGHRRNWKKWLTIYLAAAAVVYLIVFLVFFNHGGGGGSFGY |
| Ga0126371_126179751 | 3300021560 | Tropical Forest Soil | MAQTEAGYRRKWKKWLAIYLAVAVVVYLIVFLVFFNHGGGGGGFGY |
| Ga0126371_135838441 | 3300021560 | Tropical Forest Soil | EAGYRRKWKKWLAIYLAVAVVVYLIVFLVFFNHGGGGAGFGY |
| Ga0207692_104461131 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | MAETQAGHRRKWKKWLAIYLAAAAVVYLIVFLVFFNHGGGGGGFSY |
| Ga0207692_111986901 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | RRKWKKWLAIYLAAAAVVYLIVFLVFFKHGGGGGGYGY |
| Ga0207685_100532202 | 3300025905 | Corn, Switchgrass And Miscanthus Rhizosphere | MAQTAAGHRRNWKKWLAIYLAAAAVVYLIVFLVFFRHGGGASGYGY |
| Ga0207700_112180082 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | MAQTAAGHRRKWKKWLAIYLAAAAIVYLIVFLVFFKHGGGGGGYGY |
| Ga0209799_11114431 | 3300027654 | Tropical Forest Soil | MAQTEAGYRRKWKKWLAIYLAAAAVVYLIVFLVFFNHGGGGGSFGY |
| Ga0318516_101047253 | 3300031543 | Soil | MAQTEAGHRRKWKKWLAIYLAAAAVIYLIVFLAFFNHGGGGGGLGY |
| Ga0318516_101420272 | 3300031543 | Soil | MAQREAGYRRKWKKWLAIAAMVYLIVFLVVFNHGGGGGGYGY |
| Ga0318516_101777792 | 3300031543 | Soil | MAQTQAGHRRKWKKWLAIYLAAAAVVYLIVFLVFFSHGGGGGGYGY |
| Ga0318516_108533292 | 3300031543 | Soil | MALRQAGHRRKWKKWLPICLAIAAVVYLIVFLVFFSHGGGGGYGY |
| Ga0318534_100499701 | 3300031544 | Soil | MALREAGYRRKWKKWLPICLAIAAVVYLIVFLVFFSHGGGGGYGY |
| Ga0318538_107662152 | 3300031546 | Soil | MAQKEAGYRRKWKKWLAIYLAIAVVVYLIVFLVFFSHGGGGGYGY |
| Ga0318571_102244971 | 3300031549 | Soil | TNEGGGHMALRQAGHRRKWKKWLPICLAIAAVVYLIVFLVFFSHGGGGGYGY |
| Ga0318528_106059651 | 3300031561 | Soil | MAQTQAGHRRKWKKWLAIYLAAAAVVYLIVFLVFFSHGGGGGGYG |
| Ga0310915_101483933 | 3300031573 | Soil | MAQTEAGHRRKWKKWLAIYLAAAAVVYLIVFLVFFSHGGGGGYGY |
| Ga0318574_108794421 | 3300031680 | Soil | MAQTEAGHRRKWKKWLTIYLAAAAVIYLIVFLVFFN |
| Ga0306917_108969822 | 3300031719 | Soil | MAQTQAGHRRKWKKWLAIYLAAAAVVYLIVFLVFFSHGGGGGYGY |
| Ga0318500_101324041 | 3300031724 | Soil | MAQTEAGHRRKWKKWLAIYLAAAAVIYLIVLLAFFNHGGGGGGLGY |
| Ga0318500_107009111 | 3300031724 | Soil | MAQTEAGHRRKWKKWLTIYLAAAAVIYLIVFLVFFNHGGGGGGLGY |
| Ga0318546_103359361 | 3300031771 | Soil | SKLPGFLQPFVRSTGKGIRYERRRRAMAQREAGYRRKWKKWLAIAAMVYLIVFLVVFNHGGGGGGYGY |
| Ga0318508_12560411 | 3300031780 | Soil | NEGGGHMAQKEAGYRRKWKKWLAIYLAIAVVVYLIVFLVFFSHGGGGGYGY |
| Ga0318547_100144985 | 3300031781 | Soil | AGYRRKWKKWLPICLAIAAVVYLIVFLVFFSHGGGGGYGY |
| Ga0318547_102915863 | 3300031781 | Soil | MAQTEAGYRRKWKKWLAIYLAVAVVVYLIVFLVFFNHGGGGAGLGY |
| Ga0318552_100221801 | 3300031782 | Soil | YRRKWKKWLPICLAIAAVVYLIVFLVFFSHGGGGGYGY |
| Ga0318529_100077601 | 3300031792 | Soil | LREAGYRRKWKKWLPICLAIAAVVYLIVFLVFFSHGGGGGYGY |
| Ga0318548_100325541 | 3300031793 | Soil | GHMALREAGYRRKWKKWLPICLAIAAVVYLIVFLVFFSHGGGGGYGY |
| Ga0318497_107469631 | 3300031805 | Soil | VMAQTEAGHRRKWKKWLAISLAVAVVVYLIVFLVFFNHGGGGAGFGY |
| Ga0318564_103066101 | 3300031831 | Soil | AMAQTEAGHRRKWKKWLAIYLAAAAVVYLIVFLVFFSHGGGGGGYGY |
| Ga0318527_102204732 | 3300031859 | Soil | MAQTEAGHRRKWKKWLAIYLAAAAVIYLIVLLAFF |
| Ga0318536_101044272 | 3300031893 | Soil | MAQTKAGHRRKWKKWLAIYLAAAAVIYLIVFLAFFNHGGGGGGLGY |
| Ga0306921_104310122 | 3300031912 | Soil | MAQTEAGHRRKWKKWLAISLAVAVVVYLIVFLVFFNHGGGGAGFGY |
| Ga0310916_110333301 | 3300031942 | Soil | KWKKWLAIYLAAAAVVYLIVFLVFFNHGGGGGGLGY |
| Ga0310910_103269493 | 3300031946 | Soil | TNEGGGHMALREAGYRRKWKKWLPICLAIAAVVYLIVFLVFFSHGGGGGYGY |
| Ga0318570_101574031 | 3300032054 | Soil | MAQTEAGHRRKWKKWLAIYLAAAAVIYLIVFLVFFK |
| Ga0318575_107111851 | 3300032055 | Soil | MAQTEAGHRRKWKKWLTIYLAAAAVIYLIVFLVFFNHGGGGG |
| Ga0318510_100164611 | 3300032064 | Soil | AGHRRKWKKWLPICLAIAAVVYLIVFLVFFSHGGGGGYGY |
| Ga0318510_100991961 | 3300032064 | Soil | RTMAQTEAGHRRKWKKWLAIYLAAAAVIYLIVFLAFFNHGGGGGGLGY |
| Ga0318525_105390911 | 3300032089 | Soil | MAQTQAGHRRKWKKWLAIYLAAAAVVYLIVFLVFFSHGGGGGGY |
| Ga0318518_105811091 | 3300032090 | Soil | TGKGIRYERRRRAMAQREAGYRRKWKKWLAIAAMVYLIVFLVVFNHGGGGGGYGY |
| Ga0318577_106014231 | 3300032091 | Soil | EGGGHMALRQAGHRRKWKKWLPICLAIAAVVYLIVFLVFFSHGGGGGYGY |
| Ga0306920_1020959631 | 3300032261 | Soil | MAQREAGYRRKWKKWLAIYLAIAVVVYLIVFLVFFSHGGGGGYGY |
| Ga0335085_100041588 | 3300032770 | Soil | MAETDAGYRRKWKKWLAIYLAAAAVVYLIVFLVFFNHGGGGGGLGY |
| Ga0335085_100117769 | 3300032770 | Soil | MAQTEAGHRRNWKKWLAISLAVAAVVYLIMFLVFFSHGGGGGGLGY |
| Ga0335085_100898263 | 3300032770 | Soil | MAQTAAGHRRKWKKWLAIYLAAAAVVYLIVFLVFFRHGGGGGGYGY |
| Ga0335079_110068082 | 3300032783 | Soil | MALTEAGYRRKWKKWLAIYLAAAAVVYLIVFLVFFRHGGGGGGYGY |
| Ga0335078_1000070129 | 3300032805 | Soil | MAQTAAGHRRKWKKWLAIYLAAAVVVYLIVFLVFFSHGGGAGYGY |
| Ga0335078_100045733 | 3300032805 | Soil | MAQTEAGYRRKWKKWLAIYLAAAAVAYLIVFLVFFSHGGGGAGYGY |
| Ga0335078_101998772 | 3300032805 | Soil | MAQTAAGHRRKWKKWLAIYLTAAAVGYLIVFLVFFSHGGGAGYGY |
| Ga0335078_102743223 | 3300032805 | Soil | MAQTEAGYRRKWKKWLAIYLGAAAVVYLIVFLVFFRHGGGGGGYGY |
| Ga0335078_119740851 | 3300032805 | Soil | RGEGKGIQYERRGRAMAETDAGYRRKWKKWLAIYLAAAAVVYLIVFLVFFNHGGGGGGLG |
| Ga0335080_103235071 | 3300032828 | Soil | MAQTEVGYRRKWKKWLAISLAVAVVVYLIVFLVFFNHGGGGGGLGY |
| Ga0335073_109467342 | 3300033134 | Soil | MAQTAAGHRRKWKKWLAIYLTVAAVGYLIVFLVFFSHGGGAGYGY |
| Ga0335077_122337782 | 3300033158 | Soil | MAQTEAGHRRNWKKWLAISLAVAAVVYLIMFLVFFSHGGGGGGLG |
| Ga0314862_0033303_699_839 | 3300033803 | Peatland | MAETEAGYRRKWKKWLAIYLAAAAVIYLIVFLVFFNHGGGGGGLGY |
| ⦗Top⦘ |