| Basic Information | |
|---|---|
| Family ID | F029909 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 187 |
| Average Sequence Length | 44 residues |
| Representative Sequence | MTRRLPPPWRADKFSGGYVVRDANGFAVAYVYGRSTEAEA |
| Number of Associated Samples | 136 |
| Number of Associated Scaffolds | 187 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 85.39 % |
| % of genes near scaffold ends (potentially truncated) | 88.77 % |
| % of genes from short scaffolds (< 2000 bps) | 89.30 % |
| Associated GOLD sequencing projects | 127 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.50 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (83.957 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (28.877 % of family members) |
| Environment Ontology (ENVO) | Unclassified (39.572 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (47.594 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 23.53% Coil/Unstructured: 76.47% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.50 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 187 Family Scaffolds |
|---|---|---|
| PF04392 | ABC_sub_bind | 22.99 |
| PF00589 | Phage_integrase | 5.35 |
| PF07883 | Cupin_2 | 2.67 |
| PF13409 | GST_N_2 | 2.14 |
| PF00043 | GST_C | 1.07 |
| PF02371 | Transposase_20 | 1.07 |
| PF04679 | DNA_ligase_A_C | 1.07 |
| PF11799 | IMS_C | 0.53 |
| PF09913 | DUF2142 | 0.53 |
| PF01471 | PG_binding_1 | 0.53 |
| PF00239 | Resolvase | 0.53 |
| PF02796 | HTH_7 | 0.53 |
| PF08002 | DUF1697 | 0.53 |
| PF13417 | GST_N_3 | 0.53 |
| PF07690 | MFS_1 | 0.53 |
| PF07508 | Recombinase | 0.53 |
| PF01068 | DNA_ligase_A_M | 0.53 |
| PF01494 | FAD_binding_3 | 0.53 |
| PF03480 | DctP | 0.53 |
| PF07811 | TadE | 0.53 |
| PF13439 | Glyco_transf_4 | 0.53 |
| PF02663 | FmdE | 0.53 |
| PF04055 | Radical_SAM | 0.53 |
| PF01979 | Amidohydro_1 | 0.53 |
| PF00582 | Usp | 0.53 |
| PF00190 | Cupin_1 | 0.53 |
| PF03401 | TctC | 0.53 |
| COG ID | Name | Functional Category | % Frequency in 187 Family Scaffolds |
|---|---|---|---|
| COG2984 | ABC-type uncharacterized transport system, periplasmic component | General function prediction only [R] | 22.99 |
| COG1793 | ATP-dependent DNA ligase | Replication, recombination and repair [L] | 1.60 |
| COG0435 | Glutathionyl-hydroquinone reductase | Energy production and conversion [C] | 1.07 |
| COG0625 | Glutathione S-transferase | Posttranslational modification, protein turnover, chaperones [O] | 1.07 |
| COG0654 | 2-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductases | Energy production and conversion [C] | 1.07 |
| COG1961 | Site-specific DNA recombinase SpoIVCA/DNA invertase PinE | Replication, recombination and repair [L] | 1.07 |
| COG3547 | Transposase | Mobilome: prophages, transposons [X] | 1.07 |
| COG0578 | Glycerol-3-phosphate dehydrogenase | Energy production and conversion [C] | 0.53 |
| COG0644 | Dehydrogenase (flavoprotein) | Energy production and conversion [C] | 0.53 |
| COG0665 | Glycine/D-amino acid oxidase (deaminating) | Amino acid transport and metabolism [E] | 0.53 |
| COG1423 | ATP-dependent RNA circularization protein, DNA/RNA ligase (PAB1020) family | Replication, recombination and repair [L] | 0.53 |
| COG2191 | Formylmethanofuran dehydrogenase subunit E | Energy production and conversion [C] | 0.53 |
| COG2452 | Predicted site-specific integrase-resolvase | Mobilome: prophages, transposons [X] | 0.53 |
| COG3181 | Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctC | Energy production and conversion [C] | 0.53 |
| COG3797 | Uncharacterized conserved protein, DUF1697 family | Function unknown [S] | 0.53 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 83.96 % |
| Unclassified | root | N/A | 16.04 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000655|AF_2010_repII_A100DRAFT_1069231 | Not Available | 622 | Open in IMG/M |
| 3300002908|JGI25382J43887_10452820 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 543 | Open in IMG/M |
| 3300004629|Ga0008092_11346811 | Not Available | 719 | Open in IMG/M |
| 3300005332|Ga0066388_100961804 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1423 | Open in IMG/M |
| 3300005332|Ga0066388_102761979 | Not Available | 896 | Open in IMG/M |
| 3300005332|Ga0066388_106628420 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 583 | Open in IMG/M |
| 3300005436|Ga0070713_100634196 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium lablabi | 1017 | Open in IMG/M |
| 3300005446|Ga0066686_10673796 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 701 | Open in IMG/M |
| 3300005447|Ga0066689_10324207 | All Organisms → cellular organisms → Bacteria | 958 | Open in IMG/M |
| 3300005450|Ga0066682_10633203 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 667 | Open in IMG/M |
| 3300005451|Ga0066681_10371927 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 878 | Open in IMG/M |
| 3300005467|Ga0070706_100384266 | All Organisms → cellular organisms → Bacteria | 1307 | Open in IMG/M |
| 3300005468|Ga0070707_100876527 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 862 | Open in IMG/M |
| 3300005518|Ga0070699_100030099 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4684 | Open in IMG/M |
| 3300005518|Ga0070699_100074621 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 2951 | Open in IMG/M |
| 3300005518|Ga0070699_100144937 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2098 | Open in IMG/M |
| 3300005518|Ga0070699_101751953 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 569 | Open in IMG/M |
| 3300005536|Ga0070697_101439586 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 615 | Open in IMG/M |
| 3300005540|Ga0066697_10211355 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium lablabi | 1153 | Open in IMG/M |
| 3300005540|Ga0066697_10216327 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1138 | Open in IMG/M |
| 3300005552|Ga0066701_10360191 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 901 | Open in IMG/M |
| 3300005553|Ga0066695_10386111 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 872 | Open in IMG/M |
| 3300005713|Ga0066905_101048338 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 721 | Open in IMG/M |
| 3300005764|Ga0066903_102244118 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1053 | Open in IMG/M |
| 3300005764|Ga0066903_102540063 | All Organisms → cellular organisms → Bacteria | 992 | Open in IMG/M |
| 3300005764|Ga0066903_108470970 | Not Available | 524 | Open in IMG/M |
| 3300005764|Ga0066903_108556103 | All Organisms → cellular organisms → Bacteria | 521 | Open in IMG/M |
| 3300006034|Ga0066656_10903310 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 566 | Open in IMG/M |
| 3300006163|Ga0070715_10775910 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 579 | Open in IMG/M |
| 3300006176|Ga0070765_101939769 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 551 | Open in IMG/M |
| 3300006904|Ga0075424_102403395 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 553 | Open in IMG/M |
| 3300006914|Ga0075436_100286391 | All Organisms → cellular organisms → Bacteria | 1179 | Open in IMG/M |
| 3300007788|Ga0099795_10344083 | All Organisms → cellular organisms → Bacteria | 665 | Open in IMG/M |
| 3300009089|Ga0099828_11481703 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 598 | Open in IMG/M |
| 3300009090|Ga0099827_11020560 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 718 | Open in IMG/M |
| 3300009137|Ga0066709_101120553 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1157 | Open in IMG/M |
| 3300009162|Ga0075423_12284801 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 588 | Open in IMG/M |
| 3300010045|Ga0126311_10679028 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 822 | Open in IMG/M |
| 3300010046|Ga0126384_10439533 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1111 | Open in IMG/M |
| 3300010048|Ga0126373_10201797 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 1928 | Open in IMG/M |
| 3300010321|Ga0134067_10489733 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 508 | Open in IMG/M |
| 3300010358|Ga0126370_11051263 | Not Available | 747 | Open in IMG/M |
| 3300010359|Ga0126376_12903979 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 529 | Open in IMG/M |
| 3300010361|Ga0126378_11038146 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 922 | Open in IMG/M |
| 3300010362|Ga0126377_10539007 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1204 | Open in IMG/M |
| 3300010398|Ga0126383_11083806 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 890 | Open in IMG/M |
| 3300010398|Ga0126383_13378340 | All Organisms → cellular organisms → Bacteria | 521 | Open in IMG/M |
| 3300010398|Ga0126383_13525647 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 511 | Open in IMG/M |
| 3300010400|Ga0134122_11848789 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 637 | Open in IMG/M |
| 3300011269|Ga0137392_11499979 | All Organisms → cellular organisms → Bacteria | 533 | Open in IMG/M |
| 3300011271|Ga0137393_10037691 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 3709 | Open in IMG/M |
| 3300012019|Ga0120139_1135859 | Not Available | 634 | Open in IMG/M |
| 3300012189|Ga0137388_10174343 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1923 | Open in IMG/M |
| 3300012198|Ga0137364_10595354 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 833 | Open in IMG/M |
| 3300012203|Ga0137399_10255583 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1437 | Open in IMG/M |
| 3300012204|Ga0137374_10844992 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 676 | Open in IMG/M |
| 3300012205|Ga0137362_10488039 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1066 | Open in IMG/M |
| 3300012205|Ga0137362_10590419 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 958 | Open in IMG/M |
| 3300012205|Ga0137362_10967640 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 725 | Open in IMG/M |
| 3300012206|Ga0137380_10713176 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 870 | Open in IMG/M |
| 3300012206|Ga0137380_11632093 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 529 | Open in IMG/M |
| 3300012207|Ga0137381_10656234 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 913 | Open in IMG/M |
| 3300012211|Ga0137377_10749546 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 910 | Open in IMG/M |
| 3300012211|Ga0137377_10955534 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 788 | Open in IMG/M |
| 3300012285|Ga0137370_10276729 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 998 | Open in IMG/M |
| 3300012353|Ga0137367_10874290 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 620 | Open in IMG/M |
| 3300012354|Ga0137366_10681168 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 734 | Open in IMG/M |
| 3300012356|Ga0137371_10803378 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 717 | Open in IMG/M |
| 3300012359|Ga0137385_11489811 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 540 | Open in IMG/M |
| 3300012360|Ga0137375_11077895 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 625 | Open in IMG/M |
| 3300012361|Ga0137360_10054828 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2888 | Open in IMG/M |
| 3300012361|Ga0137360_10941178 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 745 | Open in IMG/M |
| 3300012361|Ga0137360_11521286 | Not Available | 574 | Open in IMG/M |
| 3300012362|Ga0137361_10386368 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1285 | Open in IMG/M |
| 3300012362|Ga0137361_11474294 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 603 | Open in IMG/M |
| 3300012371|Ga0134022_1075741 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 574 | Open in IMG/M |
| 3300012582|Ga0137358_10721086 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 666 | Open in IMG/M |
| 3300012923|Ga0137359_10558583 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1006 | Open in IMG/M |
| 3300012923|Ga0137359_10615903 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 951 | Open in IMG/M |
| 3300012923|Ga0137359_10741141 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 854 | Open in IMG/M |
| 3300012924|Ga0137413_11843618 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 500 | Open in IMG/M |
| 3300012929|Ga0137404_10710051 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 910 | Open in IMG/M |
| 3300012948|Ga0126375_12085896 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 503 | Open in IMG/M |
| 3300012957|Ga0164303_11242475 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 548 | Open in IMG/M |
| 3300012975|Ga0134110_10208536 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 822 | Open in IMG/M |
| 3300012984|Ga0164309_10255395 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Dermacoccaceae | 1239 | Open in IMG/M |
| 3300012989|Ga0164305_11871213 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 544 | Open in IMG/M |
| 3300015373|Ga0132257_100600643 | All Organisms → cellular organisms → Bacteria | 1360 | Open in IMG/M |
| 3300015373|Ga0132257_103910730 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium lablabi | 542 | Open in IMG/M |
| 3300015374|Ga0132255_102786305 | All Organisms → cellular organisms → Bacteria | 747 | Open in IMG/M |
| 3300016270|Ga0182036_10262443 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1298 | Open in IMG/M |
| 3300016294|Ga0182041_10536437 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1020 | Open in IMG/M |
| 3300016319|Ga0182033_10213963 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1542 | Open in IMG/M |
| 3300016319|Ga0182033_11023439 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 735 | Open in IMG/M |
| 3300016341|Ga0182035_10303119 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1311 | Open in IMG/M |
| 3300016341|Ga0182035_10900252 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 780 | Open in IMG/M |
| 3300016341|Ga0182035_11042189 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 726 | Open in IMG/M |
| 3300016341|Ga0182035_11089690 | All Organisms → cellular organisms → Bacteria | 710 | Open in IMG/M |
| 3300016357|Ga0182032_10518777 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 982 | Open in IMG/M |
| 3300016357|Ga0182032_11179797 | Not Available | 658 | Open in IMG/M |
| 3300016387|Ga0182040_11823099 | All Organisms → cellular organisms → Bacteria | 521 | Open in IMG/M |
| 3300016422|Ga0182039_10312609 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1306 | Open in IMG/M |
| 3300016445|Ga0182038_10511160 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1026 | Open in IMG/M |
| 3300020581|Ga0210399_11027171 | All Organisms → cellular organisms → Bacteria | 663 | Open in IMG/M |
| 3300021168|Ga0210406_10070549 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 3006 | Open in IMG/M |
| 3300021168|Ga0210406_10454050 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1019 | Open in IMG/M |
| 3300021168|Ga0210406_11097829 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 586 | Open in IMG/M |
| 3300021170|Ga0210400_10509211 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 994 | Open in IMG/M |
| 3300021405|Ga0210387_11255430 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 642 | Open in IMG/M |
| 3300021439|Ga0213879_10015545 | Not Available | 1744 | Open in IMG/M |
| 3300021478|Ga0210402_10790277 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 874 | Open in IMG/M |
| 3300021479|Ga0210410_10919361 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 762 | Open in IMG/M |
| 3300021560|Ga0126371_10191970 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 2133 | Open in IMG/M |
| 3300021560|Ga0126371_10717090 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1148 | Open in IMG/M |
| 3300024288|Ga0179589_10197013 | All Organisms → cellular organisms → Bacteria | 879 | Open in IMG/M |
| 3300025922|Ga0207646_10920433 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 775 | Open in IMG/M |
| 3300026295|Ga0209234_1040174 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1779 | Open in IMG/M |
| 3300026296|Ga0209235_1136828 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1001 | Open in IMG/M |
| 3300026304|Ga0209240_1271806 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 521 | Open in IMG/M |
| 3300031545|Ga0318541_10522939 | Not Available | 664 | Open in IMG/M |
| 3300031561|Ga0318528_10084678 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1648 | Open in IMG/M |
| 3300031561|Ga0318528_10217942 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1022 | Open in IMG/M |
| 3300031564|Ga0318573_10594614 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 596 | Open in IMG/M |
| 3300031572|Ga0318515_10018677 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3244 | Open in IMG/M |
| 3300031573|Ga0310915_10359638 | All Organisms → cellular organisms → Bacteria | 1032 | Open in IMG/M |
| 3300031573|Ga0310915_10443524 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 922 | Open in IMG/M |
| 3300031668|Ga0318542_10156343 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1135 | Open in IMG/M |
| 3300031668|Ga0318542_10170856 | All Organisms → cellular organisms → Bacteria | 1087 | Open in IMG/M |
| 3300031668|Ga0318542_10313512 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 804 | Open in IMG/M |
| 3300031668|Ga0318542_10384976 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 723 | Open in IMG/M |
| 3300031680|Ga0318574_10867529 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 529 | Open in IMG/M |
| 3300031713|Ga0318496_10551756 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 637 | Open in IMG/M |
| 3300031719|Ga0306917_11277229 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 568 | Open in IMG/M |
| 3300031736|Ga0318501_10676146 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 569 | Open in IMG/M |
| 3300031736|Ga0318501_10764963 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 534 | Open in IMG/M |
| 3300031744|Ga0306918_10344657 | Not Available | 1155 | Open in IMG/M |
| 3300031744|Ga0306918_10873399 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 701 | Open in IMG/M |
| 3300031744|Ga0306918_11006021 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 647 | Open in IMG/M |
| 3300031744|Ga0306918_11188742 | Not Available | 589 | Open in IMG/M |
| 3300031768|Ga0318509_10772544 | Not Available | 532 | Open in IMG/M |
| 3300031771|Ga0318546_10458898 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Microvirga | 892 | Open in IMG/M |
| 3300031781|Ga0318547_10948349 | All Organisms → cellular organisms → Bacteria | 537 | Open in IMG/M |
| 3300031793|Ga0318548_10264989 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 844 | Open in IMG/M |
| 3300031793|Ga0318548_10319544 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 762 | Open in IMG/M |
| 3300031795|Ga0318557_10143734 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1076 | Open in IMG/M |
| 3300031833|Ga0310917_10900418 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 595 | Open in IMG/M |
| 3300031846|Ga0318512_10297304 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 802 | Open in IMG/M |
| 3300031879|Ga0306919_10008297 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 5723 | Open in IMG/M |
| 3300031879|Ga0306919_10160777 | Not Available | 1645 | Open in IMG/M |
| 3300031880|Ga0318544_10259098 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 674 | Open in IMG/M |
| 3300031890|Ga0306925_10442704 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1389 | Open in IMG/M |
| 3300031890|Ga0306925_11168097 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 773 | Open in IMG/M |
| 3300031894|Ga0318522_10068701 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1279 | Open in IMG/M |
| 3300031894|Ga0318522_10283928 | Not Available | 627 | Open in IMG/M |
| 3300031897|Ga0318520_10866687 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 568 | Open in IMG/M |
| 3300031912|Ga0306921_10130247 | Not Available | 2937 | Open in IMG/M |
| 3300031946|Ga0310910_11228962 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 580 | Open in IMG/M |
| 3300031947|Ga0310909_11280121 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 590 | Open in IMG/M |
| 3300031947|Ga0310909_11575019 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 521 | Open in IMG/M |
| 3300031954|Ga0306926_12227044 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 609 | Open in IMG/M |
| 3300032001|Ga0306922_10495511 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 1302 | Open in IMG/M |
| 3300032042|Ga0318545_10175276 | All Organisms → cellular organisms → Bacteria | 765 | Open in IMG/M |
| 3300032052|Ga0318506_10055051 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1616 | Open in IMG/M |
| 3300032055|Ga0318575_10425778 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 674 | Open in IMG/M |
| 3300032059|Ga0318533_10679699 | Not Available | 755 | Open in IMG/M |
| 3300032059|Ga0318533_10784479 | Not Available | 699 | Open in IMG/M |
| 3300032060|Ga0318505_10160556 | All Organisms → cellular organisms → Bacteria | 1044 | Open in IMG/M |
| 3300032060|Ga0318505_10484721 | Not Available | 584 | Open in IMG/M |
| 3300032060|Ga0318505_10535516 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 552 | Open in IMG/M |
| 3300032063|Ga0318504_10034773 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 2030 | Open in IMG/M |
| 3300032066|Ga0318514_10174651 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1120 | Open in IMG/M |
| 3300032066|Ga0318514_10292133 | All Organisms → cellular organisms → Bacteria | 861 | Open in IMG/M |
| 3300032067|Ga0318524_10601029 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 579 | Open in IMG/M |
| 3300032076|Ga0306924_10399520 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1573 | Open in IMG/M |
| 3300032261|Ga0306920_100430666 | Not Available | 1960 | Open in IMG/M |
| 3300032261|Ga0306920_101761546 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae → unclassified Oxalobacteraceae → Oxalobacteraceae bacterium CAVE-383 | 875 | Open in IMG/M |
| 3300032261|Ga0306920_102757936 | All Organisms → cellular organisms → Bacteria | 670 | Open in IMG/M |
| 3300033289|Ga0310914_10605740 | Not Available | 987 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 28.88% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 19.25% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 16.04% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 6.95% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 5.35% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 4.81% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 4.28% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 2.67% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 2.14% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.60% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.60% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.60% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 1.07% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 0.53% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.53% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 0.53% |
| Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Bulk Soil | 0.53% |
| Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 0.53% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.53% |
| Tropical Rainforest Soil | Environmental → Terrestrial → Soil → Unclassified → Tropical Rainforest → Tropical Rainforest Soil | 0.53% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000655 | Forest soil microbial communities from Amazon forest - 2010 replicate II A100 | Environmental | Open in IMG/M |
| 3300002908 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_40cm | Environmental | Open in IMG/M |
| 3300004629 | Tropical rainforest soil microbial communities from the Amazon Forest, Brazil, analyzing deforestation - Metatranscriptome P72I A01 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
| 3300005446 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 | Environmental | Open in IMG/M |
| 3300005447 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 | Environmental | Open in IMG/M |
| 3300005450 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131 | Environmental | Open in IMG/M |
| 3300005451 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 | Environmental | Open in IMG/M |
| 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
| 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
| 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
| 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
| 3300005540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 | Environmental | Open in IMG/M |
| 3300005552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 | Environmental | Open in IMG/M |
| 3300005553 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 | Environmental | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300006034 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105 | Environmental | Open in IMG/M |
| 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
| 3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
| 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300010045 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot61 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010321 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09212015 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300012019 | Permafrost microbial communities from Nunavut, Canada - A7_5cm_12M | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012204 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012285 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012353 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012354 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012360 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_113_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012371 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_2_0_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300012924 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300012975 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_11112015 | Environmental | Open in IMG/M |
| 3300012984 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MG | Environmental | Open in IMG/M |
| 3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
| 3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
| 3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
| 3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
| 3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
| 3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
| 3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
| 3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
| 3300021439 | Vellozia epidendroides bulk soil microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - BS_R03 | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300024288 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026295 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026296 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026304 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_80cm (SPAdes) | Environmental | Open in IMG/M |
| 3300027783 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300029636 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031545 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26 | Environmental | Open in IMG/M |
| 3300031561 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26 | Environmental | Open in IMG/M |
| 3300031564 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21 | Environmental | Open in IMG/M |
| 3300031572 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19 | Environmental | Open in IMG/M |
| 3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
| 3300031668 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f23 | Environmental | Open in IMG/M |
| 3300031680 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22 | Environmental | Open in IMG/M |
| 3300031713 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f22 | Environmental | Open in IMG/M |
| 3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
| 3300031736 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f21 | Environmental | Open in IMG/M |
| 3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
| 3300031768 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f22 | Environmental | Open in IMG/M |
| 3300031771 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19 | Environmental | Open in IMG/M |
| 3300031781 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20 | Environmental | Open in IMG/M |
| 3300031793 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f21 | Environmental | Open in IMG/M |
| 3300031795 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f19 | Environmental | Open in IMG/M |
| 3300031833 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178 | Environmental | Open in IMG/M |
| 3300031846 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f19 | Environmental | Open in IMG/M |
| 3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
| 3300031880 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f25 | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031894 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f18 | Environmental | Open in IMG/M |
| 3300031897 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16 | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
| 3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
| 3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
| 3300032042 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f26 | Environmental | Open in IMG/M |
| 3300032052 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f19 | Environmental | Open in IMG/M |
| 3300032055 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f23 | Environmental | Open in IMG/M |
| 3300032059 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27 | Environmental | Open in IMG/M |
| 3300032060 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f18 | Environmental | Open in IMG/M |
| 3300032063 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f17 | Environmental | Open in IMG/M |
| 3300032066 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f18 | Environmental | Open in IMG/M |
| 3300032067 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f22 | Environmental | Open in IMG/M |
| 3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| AF_2010_repII_A100DRAFT_10692311 | 3300000655 | Forest Soil | MARRFPTPWREEKFSGGYVVRDATGQALAYLYARSTESEAVEAKQLTF |
| JGI25382J43887_104528201 | 3300002908 | Grasslands Soil | MTRRLPPPWRAAKFSGGYVVRDANGFPLAYVYGRSTEAEAIEAKQMTM |
| Ga0008092_113468112 | 3300004629 | Tropical Rainforest Soil | MTRHLPPPWRADKFSGGYVVRDANGFAVAYVYGRSTEAEAMEAKQMTMDEAR |
| Ga0066388_1009618043 | 3300005332 | Tropical Forest Soil | MTRRLPPPWHADKFSGGYVVRDANGFAVAYVYGRSTEAEAIEA |
| Ga0066388_1027619793 | 3300005332 | Tropical Forest Soil | MANGSTLSRRFPAPWRAEKIPGGYVVRDETGQALAHVYAR |
| Ga0066388_1066284201 | 3300005332 | Tropical Forest Soil | VKRHLPPPWRADKFSGGYVVRDANGFAVAYVYGRSTEAEAM |
| Ga0070713_1006341961 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | MTRRLPPPWHADKFSGGYLVRDANGFAVAYVYGRSTEAEAME |
| Ga0066686_106737963 | 3300005446 | Soil | MTRRLPAPWHADKFSGGYVVRDADGFAVAYVYGRLTETEAIEAKQMTMDEA |
| Ga0066689_103242073 | 3300005447 | Soil | MSRRFPAPWREEKFSGGYVVRDATGQALAYLYARSTESEAIEAKQLTFDEA |
| Ga0066682_106332032 | 3300005450 | Soil | MTRRLPAPWHADKFSGGYVVRDANGFAVAYVYGRSTEAEAMEA |
| Ga0066681_103719273 | 3300005451 | Soil | MEVNEMTRRLPSPWRAEKFSGGYVVRDANGFAVAYVYGRSTE |
| Ga0070706_1003842664 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | MTRRLPPPWRAEKFSGGYVVRDANGFAVAYVYGRSTEDEAITAKQMT |
| Ga0070707_1008765273 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | MTRRLPPPWRADKFSGGYVVRDANGFAVAYVYGRSTEAEA |
| Ga0070699_1000300994 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | MTRRLPPPWHADKFSGGYVVRDANGFAVAYVYGRSTEAEAME |
| Ga0070699_1000746211 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | MTRHLSPPWHADKFSGGYVVRDANGFAVAYVYGRSTEAEAMEAKQMTMDEA |
| Ga0070699_1001449375 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | VTRRLPPPWHADKFSGGYVVRDANGFAVAYVYGRSTEAEAME |
| Ga0070699_1017519532 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | MARRFPTPWREEKFSGGYVVRDATGQALAYLYARSTESEA |
| Ga0070697_1014395863 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | MTRRLPPPWRAEKFSGGYVVRDANGFAVAYVYGRSTEDEAITA |
| Ga0066697_102113551 | 3300005540 | Soil | MTRRLPPPWRAENFSGGYVVRDANGFAVAYVYGRSTEAEALEAKQMTMDEAR |
| Ga0066697_102163271 | 3300005540 | Soil | MTRRLPAPWHADKFSGGYVVRDANGFAVAYVYGRSTEAEAMEAKQMT |
| Ga0066701_103601911 | 3300005552 | Soil | MTRRLPAPWHADKFSGGYVVRDANGFAVAYVYGRLTETEAIEAKQMTMDEARR |
| Ga0066695_103861111 | 3300005553 | Soil | MTRRLPAPWHADNSGGYVVRDANGFAVAYVYGRSTEAEAMEAKQMTMDEARRVA |
| Ga0066905_1010483382 | 3300005713 | Tropical Forest Soil | MTRRLPPPWHADKFSGGYVVRDANGFAVAYVYGRSTEAEAIEAK |
| Ga0066903_1022441181 | 3300005764 | Tropical Forest Soil | MTRRLPPPWHADKFSGGYVVRDANGFAVAYVYGRSTEAEALEAKQMTM |
| Ga0066903_1025400631 | 3300005764 | Tropical Forest Soil | MKRRLPPPWHADKFSGGYVVRDANGFAVAYVYGRSTEAEA |
| Ga0066903_1084709701 | 3300005764 | Tropical Forest Soil | MARRFPTPWREEKFSGGYVVRDATGQALAYLYARSTE |
| Ga0066903_1085561032 | 3300005764 | Tropical Forest Soil | MTRRLPPPWHADKFSGGYVVRDANGFAVAYVYGRSTEAEAIEAKQM |
| Ga0066656_109033101 | 3300006034 | Soil | VTRRLPPPWHADKFSGGYVVRDANGFAVAYVYGRSTEAEAMEAKQM |
| Ga0070715_107759102 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | MGVNEMTRRLPSPWRAEKFSGGYVVRDANGFAVAYVYGRSTEDEAMAAKQMTMD |
| Ga0070765_1019397691 | 3300006176 | Soil | MARRFPTPWREEKFSGGYVVRDATGQAIAYLYARSTESEAVEAKQLTFDEARRI |
| Ga0075424_1024033951 | 3300006904 | Populus Rhizosphere | MTRRLPPPWRAEKFSGGYVVRDANGFPLAYVYGRSTEAEAIEAKQMT |
| Ga0075436_1002863914 | 3300006914 | Populus Rhizosphere | MTRRLPPPWRAEKFSGGYVVRDANGFAVAYVYGRSTEDEAITAKQMTMDE |
| Ga0075435_1020283102 | 3300007076 | Populus Rhizosphere | MARRFPLPWTAEEIAGGYVVRDANKQALAYVYCREPEHA |
| Ga0099795_103440831 | 3300007788 | Vadose Zone Soil | MESATMARRFPAPWREEKFSGGYVIRDATGQALAYLYA |
| Ga0099828_114817032 | 3300009089 | Vadose Zone Soil | VTRHFPPPWRAEKFSGGYVVRDANGFAVAYVYGRSTEDEAM |
| Ga0099827_110205601 | 3300009090 | Vadose Zone Soil | MTRRLPPPWRAAKFSGGYVVRDANGFPLAYVYGRSTEAEAIEAKQMTMDEARR |
| Ga0066709_1011205533 | 3300009137 | Grasslands Soil | MGVNEMTRRLPPPWRAEKFSGGYVVRDANGFAVAYVYGRSTED |
| Ga0075423_122848011 | 3300009162 | Populus Rhizosphere | MTRRLPPPWRAEKFSGGYVVRDVNGFAVAYVYGRSTEDEAITAKQ |
| Ga0126311_106790281 | 3300010045 | Serpentine Soil | MIRRLPPPWHADKFSGGYVVRDANGFAVAYVYGRSTEA |
| Ga0126384_104395334 | 3300010046 | Tropical Forest Soil | MTRHLPPPWCAEKFSGGYVVRDANGFAVAYVYGRSTEAEALEAKQMTMDEARRVAS |
| Ga0126373_102017976 | 3300010048 | Tropical Forest Soil | MTRHLPPPWRADKFSGGYLVRDANGFAVAYVYGRSTEAEAMEAKQMTMDEAR |
| Ga0134067_104897332 | 3300010321 | Grasslands Soil | VSDGANEMTRRLPPPWRAEKFSGGYVVRDANGFAVAYVYGRSTEDEATAAK |
| Ga0126370_110512631 | 3300010358 | Tropical Forest Soil | MARRFPTPWREEKFSGGYVVRDATGQALAYLYARSTESEAV |
| Ga0126376_129039791 | 3300010359 | Tropical Forest Soil | MSRRFPAPWREEKFSGGYVVRDATGQALAYLYARS |
| Ga0126378_110381463 | 3300010361 | Tropical Forest Soil | MMGRLPPPWRAEKFSGGYVVRDANGFAVAYVYGRSTEVE |
| Ga0126377_105390072 | 3300010362 | Tropical Forest Soil | MTRRLPPPWHAEKFSGGYVVRDANGFAVAYVYGRSTEAEAIEAK |
| Ga0126383_110838061 | 3300010398 | Tropical Forest Soil | MSRRFPAPWREEKFSGGYVVRDATGQAIAYLYARSTENEAIEAKQLTMDEA |
| Ga0126383_133783402 | 3300010398 | Tropical Forest Soil | MKRHLPPPWRADKFSGGYVVRDANGFAVAYVYGRSTE |
| Ga0126383_135256472 | 3300010398 | Tropical Forest Soil | MTRHFPPPWRAEKFSGGYVVRDANGFAVAYVYGRSTEVEAME |
| Ga0134122_118487892 | 3300010400 | Terrestrial Soil | MTRRLPPPWRAEKFSGGYVVRDANGFPLAYVYGRSTEAEAIE |
| Ga0137392_114999791 | 3300011269 | Vadose Zone Soil | MQSAGMELAKMSRRFPPPWREEKFSGGYVVRDATGFAVAYIYGRSTEAE |
| Ga0137393_100376911 | 3300011271 | Vadose Zone Soil | MTRRLPPPWRAEKFSGGYVVRDATDFAVAYVYGRSTEDE |
| Ga0120139_11358592 | 3300012019 | Permafrost | MRRFPPPWTVETIPGGYVVRDATGQSLAYLYARENV |
| Ga0137388_101743431 | 3300012189 | Vadose Zone Soil | MTRRLPPPWRAEKFSGGYVVRDANGFAVAYVYGRAKVRV |
| Ga0137364_105953542 | 3300012198 | Vadose Zone Soil | MTRRLPPPWRAEKFSGGYVVRDANGFAVAYVYGRSTEDE |
| Ga0137399_102555834 | 3300012203 | Vadose Zone Soil | MTRRMPPPRRAEKFSGGYVVRDANGFAVAYVYGRSTEDEATAA |
| Ga0137374_108449923 | 3300012204 | Vadose Zone Soil | LNTRRLPPPWRAEKFSGGYVVRDATGFAVAYVYGRSTEAEAMEAKQMTM |
| Ga0137362_104880391 | 3300012205 | Vadose Zone Soil | MTRRLPPPWRAEKFSGGYVVRDATGFAVAYVYGRSTEAEALEAKQMTMDEARR* |
| Ga0137362_105904192 | 3300012205 | Vadose Zone Soil | MTRRLPPPWRADKFSGGYVVRDANGFAVAYVYGRSTEAEAMEAKQMTMDE |
| Ga0137362_109676403 | 3300012205 | Vadose Zone Soil | RLPSPWHAEKFSGGYVVRDANGFAVAYVYGRSTEADLIASEDS* |
| Ga0137380_107131762 | 3300012206 | Vadose Zone Soil | MTRRLPAPWHADKFSGGYVVRDADGFAVAYVYGRLT |
| Ga0137380_116320932 | 3300012206 | Vadose Zone Soil | MTRRLPPPWRAEKFSGGYIVRDANGFAVAYVYGRSTEDEAVEAKQMTM |
| Ga0137381_106562342 | 3300012207 | Vadose Zone Soil | MTRRLPPPWRAEKFSGGYVVRDANGFAVAYVYGRSTEDEAVEAKQ |
| Ga0137377_107495462 | 3300012211 | Vadose Zone Soil | MTRRLPPPWRAEKFSGGYVVRDATGFAVAYVYGRSTEVEAME |
| Ga0137377_109555341 | 3300012211 | Vadose Zone Soil | MTRRLPPPWHADKFSGGYVVRDANGFAVAYVYGRSTEAEALEAKQMT |
| Ga0137370_102767291 | 3300012285 | Vadose Zone Soil | MTRRLPAPWHADKFSGGYVVRDANGFAVAYVYGRSTEAEAMEAK |
| Ga0137367_108742901 | 3300012353 | Vadose Zone Soil | MTRRLPPPWRAEKFSGGYVVRDATGFAVAYVYGRSTEAEAIEAKQMTMDEARR |
| Ga0137366_106811682 | 3300012354 | Vadose Zone Soil | MTRRLPSPWRAEKFSGGYVERDANGLAVAYVYGRST |
| Ga0137371_108033781 | 3300012356 | Vadose Zone Soil | MARRFPTPWREEKFSGGYVVRDATGQALAYLYARSTESEAVEAKQ |
| Ga0137385_114898112 | 3300012359 | Vadose Zone Soil | MTRRLPPPWRAEKFSGGYIVRDANGFAVAYVYGRSTEDEAVE |
| Ga0137375_110778951 | 3300012360 | Vadose Zone Soil | PWHADKFSGGYVVRDANGFAVAYVYGRSTEDEAMEAKQMTMDEARRVASTPC* |
| Ga0137360_100548283 | 3300012361 | Vadose Zone Soil | MTRHLPPPWRADKFSGGYVVRDANGFAVAYVYGRSTEAEAME |
| Ga0137360_109411782 | 3300012361 | Vadose Zone Soil | MTRRLPPPWHADKFSGGYVVRDANGFAVAYVYGRSTEA |
| Ga0137360_115212861 | 3300012361 | Vadose Zone Soil | MESATMARRFPAPWREEKFSGGYVVRDATGQALAY |
| Ga0137361_103863681 | 3300012362 | Vadose Zone Soil | MESATMARRFPAPWREEKFSGGYVVRDATGQALAYLYARSTESEAIEAKQLTF |
| Ga0137361_114742941 | 3300012362 | Vadose Zone Soil | MTRYLPPPWRAEKFSGGYVVRDANGFAVAYVYGRSTEVEAMEAKQMTMDEA |
| Ga0134022_10757411 | 3300012371 | Grasslands Soil | MSQRFPAPWREEKFSGEFSGGYIVRDAIGQALAYLYARSTESEAVAAKQLTM |
| Ga0137358_107210862 | 3300012582 | Vadose Zone Soil | MDRRFPTPWREEKFSGGYVVRDATGQALAYLYARSTE |
| Ga0137359_105585832 | 3300012923 | Vadose Zone Soil | MARRFPAPWREEKFSGGYVVRDATGQALAYLYARSTESEAV |
| Ga0137359_106159031 | 3300012923 | Vadose Zone Soil | MVRHFPAPWREEKFSGGYVVRDATGQALAYLYARSTESEA |
| Ga0137359_107411413 | 3300012923 | Vadose Zone Soil | MTRRLPPPWRAEKFSGGYVVRDANGFAVAYVYGRSTEDEAVEAKQMTMDE |
| Ga0137413_118436182 | 3300012924 | Vadose Zone Soil | VSDGANEMTRRLPPPWRAEKFSGGYVVRDANGFAVAYVYGRSTE |
| Ga0137404_107100511 | 3300012929 | Vadose Zone Soil | MTRCLPPPWRAEKFSGGYIVRDANGFAVAYVYGRSTEDEAMEAKQMTMDE |
| Ga0126375_120858962 | 3300012948 | Tropical Forest Soil | MTRRLPPPWRAEKFSGGYVVRDATGFAVAYVYGRSTEDEAV |
| Ga0164303_112424752 | 3300012957 | Soil | MRRERWANEMTRRMPSPWRAEKFFGGYVVRDANGFAVAYVYGRSTEDEATAAKQM |
| Ga0126369_120704141 | 3300012971 | Tropical Forest Soil | RRFQPPWTAEEIAGGYVVRDANKQALAYVYCREP* |
| Ga0134110_102085362 | 3300012975 | Grasslands Soil | MTRRLPAPWHADKFSGGYVVRDANGFAVAYVYGRSTEAEAMEAKQMTMDE |
| Ga0164309_102553952 | 3300012984 | Soil | MTEARRFPAPWYADKISGGYVVRDANGQALAYVHARATMAEAT |
| Ga0164305_118712131 | 3300012989 | Soil | MTPRLPPPWRAEKFSGGYVVRDANGFPLAYVYGRSTEAEAIEAKQMTM |
| Ga0132257_1006006431 | 3300015373 | Arabidopsis Rhizosphere | MTRRLPPPWYADKFSGGYVVRDANGFAVAYVYGRSTEAEALEAKQM |
| Ga0132257_1039107302 | 3300015373 | Arabidopsis Rhizosphere | MTRRLPPPWHAEKFSGGYVVRDANGFAVAYVYGRSTEAE |
| Ga0132255_1027863052 | 3300015374 | Arabidopsis Rhizosphere | MTRRLPPPWHAEKFSGGYVVRDANGFAVAYVYGRSTEAEAIEAKQ |
| Ga0182036_102624433 | 3300016270 | Soil | MARRFPTPWREEKFSGGYVVRDATGQALAYLYARST |
| Ga0182041_105364372 | 3300016294 | Soil | MSRRFPAPWREEKFSGGYVVRDATGQALAYLYARSTESEA |
| Ga0182033_102139634 | 3300016319 | Soil | MTRHLSPPWRADKFSGGYLVRDANGFAVAYVYGRSTEAEQFDDRSCHL |
| Ga0182033_110234392 | 3300016319 | Soil | MTRRLPPAWRAEKFSGGYVVRDATGFAVAYLYGRSTEAEAIEAKQMTMDEASGPRLYS |
| Ga0182035_103031191 | 3300016341 | Soil | MTRRLPPPWHADKFSGGYVVRDANGFAVAYVYGRSTEAEA |
| Ga0182035_109002522 | 3300016341 | Soil | MARRFPTPWREEKFSGGYVVRDATGQALAYLYARS |
| Ga0182035_110421892 | 3300016341 | Soil | MTRRLPPPWRAEKFSGGYVVRDATGFAVAYVYGRSTEAEAIEAKQMTMDEA |
| Ga0182035_110896902 | 3300016341 | Soil | MKRHLPPPWRADKFSGGYVVRDANCFAVAYVYGRSTEAEAMEAKQM |
| Ga0182032_105187771 | 3300016357 | Soil | MSRRFPAPWREERFSGGYVVRDATGQALAYLYARSTE |
| Ga0182032_111797973 | 3300016357 | Soil | VSDGANEMMGRLPPPWRAEKFSGRYVIRDANGFAVAKSR |
| Ga0182040_118230991 | 3300016387 | Soil | MTRHLPPPWRADKFSGGYVVRAANGFAVAYVYGRSTEAEAMEANDDG |
| Ga0182039_103126093 | 3300016422 | Soil | MSRRFPAPWREEKFSGGYVVRDATGQAIAYVYARSTENEAIEA |
| Ga0182038_105111602 | 3300016445 | Soil | MEWATMARRFPTPWREEKFSGGYVVRDATGQALAYLYARSTES |
| Ga0210399_110271712 | 3300020581 | Soil | HKTMSRRFPAPWREEKIAVGYVVRDANGQALVHIYQRRKG |
| Ga0210406_100705495 | 3300021168 | Soil | MTRRLPPPWHADKFSGGYVVRDANGFAVAYVYGRSTEAEAMEAKQ |
| Ga0210406_104540504 | 3300021168 | Soil | MARRLPPQRAEKFSGGYVVRDANGFAVAYVYGRSTEDEAITAKQMTMDE |
| Ga0210406_110978293 | 3300021168 | Soil | MTRRLLPPWHADKFSGGYVVRDANGFAVAYVYGRST |
| Ga0210400_105092113 | 3300021170 | Soil | MTRRLPPPWRAEKFSGGYVVRDANGFPLAYVYGRSTEAEAI |
| Ga0210387_112554301 | 3300021405 | Soil | MTRRLPPPWHADKFSGGYVVRDANDFAVAYVYGRSTEAEAMEAKQMTMDEARRVASNIA |
| Ga0213879_100155451 | 3300021439 | Bulk Soil | MTRHLPPPWRADKFSGGYVVRDANGFAVAYVYGRSTEA |
| Ga0210402_107493482 | 3300021478 | Soil | MPSRRFPAPWRADKIPGGYVVRDANGQALAYIYSFSW |
| Ga0210402_107902773 | 3300021478 | Soil | VSDGANEMTRRLPPPWRAEKFSGGYVVRDANGFAVAYV |
| Ga0210410_109193612 | 3300021479 | Soil | MSRRFPAPWREEKIAVGYVVRDANGQALVHIYQRRKG |
| Ga0126371_101919703 | 3300021560 | Tropical Forest Soil | MTRHLPPPWRADKFSGGYVVRDANGFAVAYVYGRSTEAEA |
| Ga0126371_107170902 | 3300021560 | Tropical Forest Soil | MTRHFPPPWRAEKFSGGYVVRDANGFAVAYVYGRSTEV |
| Ga0179589_101970132 | 3300024288 | Vadose Zone Soil | MTRRLPPPWHADKFSGGYVVRDANGFAVAYVYGRSTEAEAMEAKQMTMDEAR |
| Ga0207646_109204331 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | MTRRLPPPWRADKFSGGYVVRDANGFAVAYVYGRSTEAEALEAKQM |
| Ga0209234_10401744 | 3300026295 | Grasslands Soil | VSDGANEMTRRLPPPWRAEKFSGGYVVRDANGFAVAYVYGRRRSHGG |
| Ga0209235_11368284 | 3300026296 | Grasslands Soil | VSDGANEMTRRLPPPWRAEKFSGGYVVRDANGFAVAYVYGRSTEDE |
| Ga0209240_12718061 | 3300026304 | Grasslands Soil | MTHRLPPPWHADKFSGGYVVRDANGFAVAYVYGRSTEAEA |
| Ga0209448_101804161 | 3300027783 | Bog Forest Soil | ALCHHAASPPPWCADKGGYVVRYANGQALAYVYSRDSEPEAL |
| Ga0209488_107288481 | 3300027903 | Vadose Zone Soil | MPRRLPAPWRAEKIPGGYVVRDANGQALAYVYSRATEADAMQ |
| Ga0308309_117655571 | 3300028906 | Soil | MTTRRLPAPWHAEKIPGGYVVRDANGQALAYVYSRPTETDALQ |
| Ga0222749_101241102 | 3300029636 | Soil | MSRRFPAPWREEKIAGGYVVRDANGQALVHIYQRRKG |
| Ga0318541_105229392 | 3300031545 | Soil | MSRRFPAPWREEKVAGGYVVRDANGQALVHIFARSNESEAM |
| Ga0318528_100846783 | 3300031561 | Soil | MTRHLPPPWRADKFSGGYLVRDANGFAVAYVYGRSTEAEANGG |
| Ga0318528_102179421 | 3300031561 | Soil | MTRRLPPPWHADKFSGGYVVRDANGFAVAYVYGRST |
| Ga0318573_105946142 | 3300031564 | Soil | MTRRLPPPWHADKFSGGYVVRDANGFAVAYVYGRSTEAEALEAKQM |
| Ga0318515_100186771 | 3300031572 | Soil | MTRHLPPPWRADKFSGGYVVRDANGFAVAYVYGRSTEAEANGGKANDDG |
| Ga0310915_103596382 | 3300031573 | Soil | MTRHLPPPWRADKFSGGYVVRDANGFAVAYVYGRSTEAEAMEANDDG |
| Ga0310915_104435242 | 3300031573 | Soil | MTRHLPPPWRAEKFSGGYVVRDANGFAVAYVYGRSTEV |
| Ga0318542_101563432 | 3300031668 | Soil | MARRFPTPWREEKFSGGYVVRDATGQALAYLYARSTESEAVEAK |
| Ga0318542_101708561 | 3300031668 | Soil | MTRRLPPPWHADKFSGGYVVRDANGFAVAYVYGRSTEAEAIE |
| Ga0318542_103135122 | 3300031668 | Soil | MARRFPTPWREEKFSGGYVVRDATGQALAYLYVRSTESEAVEAKQL |
| Ga0318542_103849762 | 3300031668 | Soil | MTRRLPPAWRAEKFSGGYVVRDATGFAVAYVYGRSTEAEAIEAKQMT |
| Ga0318574_108675291 | 3300031680 | Soil | MTRRLPPPWRAEKFSGGYVVRDATGFAVAYVYGRSTEAEAIEAKQMTMD |
| Ga0318496_105517562 | 3300031713 | Soil | MTRRLPPAWRAEKFSGGYVVRDATGFAVAYVYGRSTEAEAIEAKQMTMDEASG |
| Ga0306917_112772292 | 3300031719 | Soil | MARRFPTPWREEKFSGGYVVRDATGQALAYLYARSTEREAVEA |
| Ga0318501_106761461 | 3300031736 | Soil | MTRRLPPAWRAEKFSGGYVVRDATGFAVAYVYGRSTEAEAIEAKQMTMDEA |
| Ga0318501_107649631 | 3300031736 | Soil | MTRRLPPPWRAEKFSGGYVVRDANGFAVAYVYGRSTED |
| Ga0306918_103446571 | 3300031744 | Soil | PWREEKFSGGYVVRDATRSTESEAVEAKQLTSRRIAVSIARLPELLRE |
| Ga0306918_108733991 | 3300031744 | Soil | MTRRLPPPWHADKFSGGYVVRDANGFAVAYVYGRLTEAEALEAKQMTMDE |
| Ga0306918_110060212 | 3300031744 | Soil | MTRRLPPPWRAEKFSGGYVVRDATGFAVAYVYGRSTEAEAIEA |
| Ga0306918_111887421 | 3300031744 | Soil | MAGRFPTPWREEKFSGGYVVRDATGQALAYLYARSTESEAVEAK |
| Ga0318509_107725443 | 3300031768 | Soil | MSRRFPAPWREEKVAGGYVVRDANGQALVHIFARSNESEAMQAKMLTM |
| Ga0318546_104588982 | 3300031771 | Soil | MTRHFPPPWRAEEFSGGYVVRDANGFAVAYVYGRSTEVE |
| Ga0318547_109483491 | 3300031781 | Soil | MARRFPTPWRQEKFSGGYVVRDATGQALAYLYARST |
| Ga0318548_102649891 | 3300031793 | Soil | MARRFPTPWREEKFSGGYVVRDATGQALAYLYARSTESEAVEAKQLTFD |
| Ga0318548_103195441 | 3300031793 | Soil | MTRRLPPPWHADKFSGGYVVRDANGFAVAYVYGRSTEAEALEAKQMTMDE |
| Ga0318557_101437341 | 3300031795 | Soil | MTRRLPPPWHADKFSGGYVVRDANGFAVAYVYGRSTEAEAIEAKQMTMDEARR |
| Ga0310917_109004181 | 3300031833 | Soil | MTRRLPPAWRAEKFSGGYVVRDATGFAVAYVYGRSTEAEA |
| Ga0318512_102973041 | 3300031846 | Soil | MTRHFPPPWRAEKFSGGYVVRDANGFAVAYVYGRS |
| Ga0306919_100082978 | 3300031879 | Soil | MARRFPTPWRQEKFSGGYVVRDATGQALAYLYARSTESEAARPSN |
| Ga0306919_101607773 | 3300031879 | Soil | MTRHLPPPWRADKFSGGYLVRDANGFAVAYVYGRSTEAEANG |
| Ga0318544_102590981 | 3300031880 | Soil | MARRFPTPWREEKFSGGYVVRDATGQALAYLYARSTESEAVGAQQV |
| Ga0306925_104427042 | 3300031890 | Soil | MARRFPTPWREEKFSGGYVVRDATRSTESEAVEAKQLTSRRIAVSIARLPELLRE |
| Ga0306925_109923702 | 3300031890 | Soil | MVSDRRFPVSWRADKIPGGYVVRDANGQALVYVYS |
| Ga0306925_111680972 | 3300031890 | Soil | MTRHLPPPWRAEKFSGGYVVRDANGFAVAYVYGRSTEVEAMEAKQMTMDEARR |
| Ga0318522_100687011 | 3300031894 | Soil | MTRRLPPPWHADKFSGGYVVRDANGFAVAYVYGRSTEAE |
| Ga0318522_102839282 | 3300031894 | Soil | MTRHLPPPWRADKFSGGYLVRDANGFAVAYVYGRSTE |
| Ga0318520_108666871 | 3300031897 | Soil | MSRRFPAPWREEKFSGGYVVRDATGQAIAYLYARSTESEAI |
| Ga0306921_101302475 | 3300031912 | Soil | MSRRFPAPWREEKVAGGYVVRDANGQALVHIFARSNESEAMQA |
| Ga0310912_109321661 | 3300031941 | Soil | MVNDRRFPAPWRADRIPGGYVVRDANGQALVYVYSRDN |
| Ga0310910_112289622 | 3300031946 | Soil | MTRHLPPPWRAEKFSGGYVVRDANGFAVAYVYGRSTEVEAMEAKQMTMDEAR |
| Ga0310909_112801211 | 3300031947 | Soil | MTRRLPPPWRAEKFSGGYVVRDATGFAVAYVYGRSTEAEA |
| Ga0310909_115750192 | 3300031947 | Soil | MTRHFPPPWRAEKFSGGYVVRDANGFAVAYVYGRSTEVEA |
| Ga0306926_122270442 | 3300031954 | Soil | GTGMEWATMARRFPTPWREEKFSGGYVVRDATRSTESEAVEAKQLTSRRIAVSIARLPELLRE |
| Ga0306922_104955113 | 3300032001 | Soil | DKFSGGYVVRDANGFAVAYVYGRSTEAEAMEANDDG |
| Ga0318545_101752762 | 3300032042 | Soil | MTRRLPPPWHADKFSGGYVVRDANGFAVAYVYGRSTEAEAIEAKQMTMDEA |
| Ga0318506_100550513 | 3300032052 | Soil | MTRRLPPPWHADKFSGGYVVRDANGFAVAYVYGRSTEAEAIEAKQMTMDKA |
| Ga0318575_104257781 | 3300032055 | Soil | MARRLPPLWRAEKFSGGYVVRDANGFAVAYVYGRSTEDEAITAKTNDDG |
| Ga0318533_106796991 | 3300032059 | Soil | MTRHLPPPWRADKFSGGYVVRDANGFAVAYVYGRSTE |
| Ga0318533_107844791 | 3300032059 | Soil | MSRRFPAPWREEKVAGGYVVRDANGQALVHIFARSNESEAMQAKMLTMDEAYRRQCGEAA |
| Ga0318505_101605564 | 3300032060 | Soil | MARRFPTPWREEKFSGGYVVRDATGQALAYLYARSTESEAVEA |
| Ga0318505_104847212 | 3300032060 | Soil | MSRRFPAPWREEKVAGGYIVRDANGQALVHIFARSNESE |
| Ga0318505_105355161 | 3300032060 | Soil | MTRHLPPPWRAEKFSGGYVVRDANGFAVAYVYGRSTEAEAIE |
| Ga0318504_100347734 | 3300032063 | Soil | MTRRLPPPWHADKFSGGYVVRDANGFAVAYVYGRSTEAEAIEAKQMTMD |
| Ga0318514_101746512 | 3300032066 | Soil | MTRRLPPPWHADKFSGGYVVRDANGFAVAYVYGRSTEAEAIEAKQMTMDKAR |
| Ga0318514_102921331 | 3300032066 | Soil | LPPPWRADKFSGGYVVRDANGFAVAYVYGRSTEAEAMEANDDG |
| Ga0318524_106010291 | 3300032067 | Soil | MTRRLPPPWRAEKFSGGYVVRDATGFAVAYVYGRSTEDEAVEAKQMTM |
| Ga0306924_103995204 | 3300032076 | Soil | MARRFPTPWREEKFSGGYVVRDATGQALAYLYARSTES |
| Ga0306920_1004306662 | 3300032261 | Soil | MTRHFPPPWRAEKFSGGYVVRDANGFAVAYVYGRSTE |
| Ga0306920_1017615462 | 3300032261 | Soil | MTRHLPPPWRADKFSGGYVVRDANGFAVAYVYGRSTEAEAMEAKQEARSVAH |
| Ga0306920_1027579361 | 3300032261 | Soil | MTRRLPPPWHADKFSGGYVVRDANGFAVAYVYGRS |
| Ga0310914_106057401 | 3300033289 | Soil | MTRHLPPPWRADKFSGGYLVRDANGFAVAYVYGRSTEAEA |
| ⦗Top⦘ |