Metagenome / Metatranscriptome Family F029871

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences

Select file to download:
Download

Overview

Basic Information
Family ID	F029871
Family Type	Metagenome / Metatranscriptome
Number of Sequences	187
Average Sequence Length	39 residues
Representative Sequence	LTTYFFTEISFAAMIASLAIVGDESESLNPFKLVEAGD
Number of Associated Samples	130
Number of Associated Scaffolds	187

Quality Assessment
Transcriptomic Evidence	Yes
Most common taxonomic group	Bacteria
% of genes with valid RBS motifs	0.00 %
% of genes near scaffold ends (potentially truncated)	100.00 %
% of genes from short scaffolds (< 2000 bps)	81.28 %
Associated GOLD sequencing projects	122
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.28

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign

Most Common Taxonomy
Group	Bacteria (71.658 % of family members)
NCBI Taxonomy ID	2
Taxonomy	All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (21.390 % of family members)
Environment Ontology (ENVO)	Unclassified (25.668 % of family members)
Earth Microbiome Project Ontology (EMPO)	Free-living → Non-saline → Soil (non-saline) (44.920 % of family members)

Multiple Sequence Alignments

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Select alignment to view:

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification:	Globular	Signal Peptide:	No	Secondary Structure distribution:	α-helix: 15.15% β-sheet: 0.00% Coil/Unstructured: 84.85%
Feature Viewer

Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.28
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.28
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

Gene Neighborhood

Neighboring Pfam domains

Pfam ID	Name	% Frequency in 187 Family Scaffolds
PF10098	DUF2336	3.74
PF03401	TctC	2.14
PF04392	ABC_sub_bind	2.14
PF03972	MmgE_PrpD	1.60
PF00535	Glycos_transf_2	1.60
PF13356	Arm-DNA-bind_3	1.07
PF04909	Amidohydro_2	1.07
PF00884	Sulfatase	1.07
PF05598	DUF772	1.07
PF13551	HTH_29	1.07
PF09588	YqaJ	1.07
PF13646	HEAT_2	0.53
PF05050	Methyltransf_21	0.53
PF05088	Bac_GDH	0.53
PF09335	SNARE_assoc	0.53
PF12728	HTH_17	0.53
PF00872	Transposase_mut	0.53
PF13406	SLT_2	0.53
PF01381	HTH_3	0.53
PF09650	PHA_gran_rgn	0.53
PF06863	DUF1254	0.53
PF04325	DUF465	0.53
PF00903	Glyoxalase	0.53
PF05977	MFS_3	0.53
PF13592	HTH_33	0.53
PF00583	Acetyltransf_1	0.53
PF04255	DUF433	0.53
PF16078	2-oxogl_dehyd_N	0.53
PF00300	His_Phos_1	0.53
PF04377	ATE_C	0.53
PF00520	Ion_trans	0.53
PF09351	DUF1993	0.53
PF13817	DDE_Tnp_IS66_C	0.53
PF01609	DDE_Tnp_1	0.53
PF03466	LysR_substrate	0.53
PF14707	Sulfatase_C	0.53
PF13538	UvrD_C_2	0.53
PF04545	Sigma70_r4	0.53
PF05973	Gp49	0.53
PF02738	MoCoBD_1	0.53
PF11742	DUF3302	0.53
PF02826	2-Hacid_dh_C	0.53
PF04191	PEMT	0.53
PF12471	GTP_CH_N	0.53
PF01610	DDE_Tnp_ISL3	0.53
PF13701	DDE_Tnp_1_4	0.53
PF00383	dCMP_cyt_deam_1	0.53
PF01734	Patatin	0.53
PF05016	ParE_toxin	0.53
PF00106	adh_short	0.53
PF13506	Glyco_transf_21	0.53
PF11953	DUF3470	0.53
PF03928	HbpS-like	0.53
PF13557	Phenol_MetA_deg	0.53
PF13442	Cytochrome_CBB3	0.53
PF03572	Peptidase_S41	0.53
PF12762	DDE_Tnp_IS1595	0.53
PF13358	DDE_3	0.53
PF00348	polyprenyl_synt	0.53
PF03331	LpxC	0.53
PF00005	ABC_tran	0.53
PF02195	ParBc	0.53
PF12770	CHAT	0.53
PF13565	HTH_32	0.53
PF02771	Acyl-CoA_dh_N	0.53
PF01593	Amino_oxidase	0.53
PF02817	E3_binding	0.53
PF13586	DDE_Tnp_1_2	0.53
PF13545	HTH_Crp_2	0.53
PF01522	Polysacc_deac_1	0.53
PF13525	YfiO	0.53
PF16658	RF3_C	0.53
PF02775	TPP_enzyme_C	0.53
PF01019	G_glu_transpept	0.53
PF00107	ADH_zinc_N	0.53
PF07221	GlcNAc_2-epim	0.53
PF04041	Glyco_hydro_130	0.53
PF03050	DDE_Tnp_IS66	0.53
PF05284	DUF736	0.53
PF13683	rve_3	0.53
PF08352	oligo_HPY	0.53
PF13533	Biotin_lipoyl_2	0.53
PF17158	MASE4	0.53
PF13384	HTH_23	0.53
PF13546	DDE_5	0.53
PF00885	DMRL_synthase	0.53
PF07592	DDE_Tnp_ISAZ013	0.53
PF12706	Lactamase_B_2	0.53
PF00487	FA_desaturase	0.53
PF12399	BCA_ABC_TP_C	0.53
PF00199	Catalase	0.53
PF05239	PRC	0.53
PF01425	Amidase	0.53
PF00216	Bac_DNA_binding	0.53
PF01527	HTH_Tnp_1	0.53
PF13193	AMP-binding_C	0.53
PF00857	Isochorismatase	0.53
PF01266	DAO	0.53
PF02550	AcetylCoA_hydro	0.53

COG ID	Name	Functional Category	% Frequency in 187 Family Scaffolds
COG2984	ABC-type uncharacterized transport system, periplasmic component	General function prediction only [R]	2.14
COG3181	Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctC	Energy production and conversion [C]	2.14
COG2079	2-methylcitrate dehydratase PrpD	Carbohydrate transport and metabolism [G]	1.60
COG3436	Transposase	Mobilome: prophages, transposons [X]	0.53
COG2902	NAD-specific glutamate dehydrogenase	Amino acid transport and metabolism [E]	0.53
COG2935	Arginyl-tRNA--protein-N-Asp/Glu arginylyltransferase	Posttranslational modification, protein turnover, chaperones [O]	0.53
COG2942	Mannose or cellobiose epimerase, N-acyl-D-glucosamine 2-epimerase family	Carbohydrate transport and metabolism [G]	0.53
COG3039	Transposase and inactivated derivatives, IS5 family	Mobilome: prophages, transposons [X]	0.53
COG3239	Fatty acid desaturase	Lipid transport and metabolism [I]	0.53
COG3293	Transposase	Mobilome: prophages, transposons [X]	0.53
COG3328	Transposase (or an inactivated derivative)	Mobilome: prophages, transposons [X]	0.53
COG3385	IS4 transposase InsG	Mobilome: prophages, transposons [X]	0.53
COG2814	Predicted arabinose efflux permease AraJ, MFS family	Carbohydrate transport and metabolism [G]	0.53
COG3464	Transposase	Mobilome: prophages, transposons [X]	0.53
COG3621	Patatin-like phospholipase/acyl hydrolase, includes sporulation protein CotR	General function prediction only [R]	0.53
COG3657	Putative component of the toxin-antitoxin plasmid stabilization module	Defense mechanisms [V]	0.53
COG4667	Predicted phospholipase, patatin/cPLA2 family	Lipid transport and metabolism [I]	0.53
COG4679	Phage-related protein gp49, toxin component of the Tad-Ata toxin-antitoxin system	Defense mechanisms [V]	0.53
COG5361	Uncharacterized conserved protein	Mobilome: prophages, transposons [X]	0.53
COG5421	Transposase	Mobilome: prophages, transposons [X]	0.53
COG5433	Predicted transposase YbfD/YdcC associated with H repeats	Mobilome: prophages, transposons [X]	0.53
COG5489	Uncharacterized conserved protein, DUF736 family	Function unknown [S]	0.53
COG5659	SRSO17 transposase	Mobilome: prophages, transposons [X]	0.53
COG0776	Bacterial nucleoid DNA-binding protein IHF-alpha	Replication, recombination and repair [L]	0.53
COG0142	Geranylgeranyl pyrophosphate synthase	Coenzyme transport and metabolism [H]	0.53
COG0154	Asp-tRNAAsn/Glu-tRNAGln amidotransferase A subunit or related amidase	Translation, ribosomal structure and biogenesis [J]	0.53
COG0398	Uncharacterized membrane protein YdjX, related to fungal oxalate transporter, TVP38/TMEM64 family	Function unknown [S]	0.53
COG0405	Gamma-glutamyltranspeptidase	Amino acid transport and metabolism [E]	0.53
COG0427	Propionyl CoA:succinate CoA transferase	Energy production and conversion [C]	0.53
COG0508	Pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide acyltransferase (E2) component	Energy production and conversion [C]	0.53
COG0586	Membrane integrity protein DedA, putative transporter, DedA/Tvp38 family	Cell wall/membrane/envelope biogenesis [M]	0.53
COG0726	Peptidoglycan/xylan/chitin deacetylase, PgdA/NodB/CDA1 family	Cell wall/membrane/envelope biogenesis [M]	0.53
COG0753	Catalase	Inorganic ion transport and metabolism [P]	0.53
COG0774	UDP-3-O-acyl-N-acetylglucosamine deacetylase	Cell wall/membrane/envelope biogenesis [M]	0.53
COG0054	6,7-dimethyl-8-ribityllumazine synthase (Riboflavin synthase beta chain)	Coenzyme transport and metabolism [H]	0.53
COG0793	C-terminal processing protease CtpA/Prc, contains a PDZ domain	Posttranslational modification, protein turnover, chaperones [O]	0.53
COG1238	Uncharacterized membrane protein YqaA, VTT domain	Function unknown [S]	0.53
COG1335	Nicotinamidase-related amidase	Coenzyme transport and metabolism [H]	0.53
COG1398	Fatty-acid desaturase	Lipid transport and metabolism [I]	0.53
COG1535	Isochorismate hydrolase	Secondary metabolites biosynthesis, transport and catabolism [Q]	0.53
COG1752	Predicted acylesterase/phospholipase RssA, containd patatin domain	General function prediction only [R]	0.53
COG1960	Acyl-CoA dehydrogenase related to the alkylation response protein AidB	Lipid transport and metabolism [I]	0.53
COG2152	Predicted glycosyl hydrolase, GH43/DUF377 family	Carbohydrate transport and metabolism [G]	0.53
COG2442	Predicted antitoxin component of a toxin-antitoxin system, DUF433 family	Defense mechanisms [V]	0.53

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
All Organisms	root	All Organisms	71.66 %
Unclassified	root	N/A	28.34 %

Name	Rank	Taxonomy	Distribution
cellular organisms	root	All Organisms → cellular organisms	71.66 %
Unclassified	root	N/A	28.34 %

Name	Rank	Taxonomy	Distribution
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	71.66 %
Unclassified	root	N/A	28.34 %

Name	Rank	Taxonomy	Distribution
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	56.68 %
Unclassified	root	N/A	28.34 %
unclassified Bacteria	no rank	All Organisms → cellular organisms → Bacteria → unclassified Bacteria	0.53 %
Elusimicrobia	phylum	All Organisms → cellular organisms → Bacteria → Elusimicrobia	0.53 %

Name	Rank	Taxonomy	Distribution
Alphaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	43.85 %
Unclassified	root	N/A	28.34 %
Betaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	2.14 %
bacterium ADurb.Bin429	species	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium ADurb.Bin429	0.53 %
unclassified Elusimicrobiota	no rank	All Organisms → cellular organisms → Bacteria → Elusimicrobia → unclassified Elusimicrobiota	0.53 %
Gammaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	0.53 %
unclassified Proteobacteria	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria	0.53 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	28.34 %
Hyphomicrobiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	27.27 %
unclassified Alphaproteobacteria	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria	5.88 %
unclassified Betaproteobacteria	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria	1.60 %
Elusimicrobia bacterium RIFOXYB2_FULL_49_7	species	All Organisms → cellular organisms → Bacteria → Elusimicrobia → unclassified Elusimicrobiota → Elusimicrobia bacterium RIFOXYB2_FULL_49_7	0.53 %
Proteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium	0.53 %
Burkholderiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	0.53 %
Enterobacterales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales	0.53 %
bacterium ADurb.Bin429	species	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium ADurb.Bin429	0.53 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	28.34 %
Bradyrhizobiaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae	13.37 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	5.88 %
Betaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	1.60 %
Parvibaculaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Parvibaculaceae	1.07 %
unclassified Hyphomicrobiales	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales	1.07 %
Rhizobiaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae	1.07 %
Enterobacteriaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae	0.53 %
Hyphomicrobiaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae	0.53 %
Phyllobacteriaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae	0.53 %
Burkholderiaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae	0.53 %
Elusimicrobia bacterium RIFOXYB2_FULL_49_7	species	All Organisms → cellular organisms → Bacteria → Elusimicrobia → unclassified Elusimicrobiota → Elusimicrobia bacterium RIFOXYB2_FULL_49_7	0.53 %
Proteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium	0.53 %
bacterium ADurb.Bin429	species	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium ADurb.Bin429	0.53 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	28.34 %
Bradyrhizobium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	8.02 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	5.88 %
Betaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	1.60 %
Rhodoligotrophos	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Parvibaculaceae → Rhodoligotrophos	1.07 %
Rhizobiales bacterium 32-66-8	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Rhizobiales bacterium 32-66-8	1.07 %
Klebsiella/Raoultella group	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Klebsiella/Raoultella group	0.53 %
Rhodoplanes	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes	0.53 %
Mesorhizobium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium	0.53 %
Rhizobium/Agrobacterium group	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Rhizobium/Agrobacterium group	0.53 %
Burkholderiaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae	0.53 %
Elusimicrobia bacterium RIFOXYB2_FULL_49_7	species	All Organisms → cellular organisms → Bacteria → Elusimicrobia → unclassified Elusimicrobiota → Elusimicrobia bacterium RIFOXYB2_FULL_49_7	0.53 %
Proteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium	0.53 %
bacterium ADurb.Bin429	species	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium ADurb.Bin429	0.53 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	28.34 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	5.88 %
Bradyrhizobium erythrophlei	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei	1.60 %
Betaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	1.60 %
Rhodoligotrophos appendicifer	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Parvibaculaceae → Rhodoligotrophos → Rhodoligotrophos appendicifer	1.07 %
Rhizobiales bacterium 32-66-8	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Rhizobiales bacterium 32-66-8	1.07 %
Bradyrhizobium arachidis	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium arachidis	0.53 %
Bradyrhizobium icense	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium icense	0.53 %
unclassified Bradyrhizobium	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium	0.53 %
unclassified Rhodoplanes	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes	0.53 %
Rhizobium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Rhizobium/Agrobacterium group → Rhizobium	0.53 %
Klebsiella	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Klebsiella/Raoultella group → Klebsiella	0.53 %
Bradyrhizobium elkanii	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii	0.53 %
unclassified Mesorhizobium	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium → unclassified Mesorhizobium	0.53 %
Burkholderiaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae	0.53 %
Elusimicrobia bacterium RIFOXYB2_FULL_49_7	species	All Organisms → cellular organisms → Bacteria → Elusimicrobia → unclassified Elusimicrobiota → Elusimicrobia bacterium RIFOXYB2_FULL_49_7	0.53 %
Proteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium	0.53 %
bacterium ADurb.Bin429	species	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium ADurb.Bin429	0.53 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	28.34 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	5.88 %
Bradyrhizobium erythrophlei	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei	1.60 %
Betaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	1.60 %
Rhodoligotrophos appendicifer	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Parvibaculaceae → Rhodoligotrophos → Rhodoligotrophos appendicifer	1.07 %
Rhizobiales bacterium 32-66-8	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Rhizobiales bacterium 32-66-8	1.07 %
Rhodoplanes sp. Z2-YC6860	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860	0.53 %
Mesorhizobium sp.	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium → unclassified Mesorhizobium → Mesorhizobium sp.	0.53 %
Bradyrhizobium sp.	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp.	0.53 %
Klebsiella pneumoniae	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Klebsiella/Raoultella group → Klebsiella → Klebsiella pneumoniae	0.53 %
Bradyrhizobium arachidis	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium arachidis	0.53 %
Bradyrhizobium icense	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium icense	0.53 %
Rhizobium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Rhizobium/Agrobacterium group → Rhizobium	0.53 %
Bradyrhizobium elkanii	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii	0.53 %
Burkholderiaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae	0.53 %
Elusimicrobia bacterium RIFOXYB2_FULL_49_7	species	All Organisms → cellular organisms → Bacteria → Elusimicrobia → unclassified Elusimicrobiota → Elusimicrobia bacterium RIFOXYB2_FULL_49_7	0.53 %
Proteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium	0.53 %
bacterium ADurb.Bin429	species	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium ADurb.Bin429	0.53 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
2170459003\|FZ032L002JA8ZW	All Organisms → cellular organisms → Bacteria	500	Open in IMG/M
3300005171\|Ga0066677_10635526	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	602	Open in IMG/M
3300005178\|Ga0066688_10809058	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	585	Open in IMG/M
3300005439\|Ga0070711_100482338	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1019	Open in IMG/M
3300005467\|Ga0070706_100022293	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	5831	Open in IMG/M
3300005471\|Ga0070698_100434012	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1248	Open in IMG/M
3300005554\|Ga0066661_10458363	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	777	Open in IMG/M
3300005554\|Ga0066661_10561874	Not Available	681	Open in IMG/M
3300005557\|Ga0066704_10211436	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	1313	Open in IMG/M
3300005764\|Ga0066903_100506471	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae	2048	Open in IMG/M
3300005764\|Ga0066903_101597831	Not Available	1236	Open in IMG/M
3300005764\|Ga0066903_102262463	All Organisms → cellular organisms → Bacteria	1049	Open in IMG/M
3300005764\|Ga0066903_103274747	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	875	Open in IMG/M
3300005764\|Ga0066903_103357675	Not Available	864	Open in IMG/M
3300005764\|Ga0066903_107486818	Not Available	563	Open in IMG/M
3300005764\|Ga0066903_109032045	Not Available	504	Open in IMG/M
3300005980\|Ga0066798_10011061	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium arachidis	3240	Open in IMG/M
3300006055\|Ga0097691_1017396	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	3232	Open in IMG/M
3300006055\|Ga0097691_1037888	All Organisms → cellular organisms → Bacteria	1803	Open in IMG/M
3300006173\|Ga0070716_100073739	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	2014	Open in IMG/M
3300006173\|Ga0070716_100361143	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae	1031	Open in IMG/M
3300006175\|Ga0070712_100537779	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	983	Open in IMG/M
3300006354\|Ga0075021_10302990	All Organisms → cellular organisms → Bacteria	990	Open in IMG/M
3300006800\|Ga0066660_10692160	Not Available	839	Open in IMG/M
3300006845\|Ga0075421_100273030	Not Available	2065	Open in IMG/M
3300006852\|Ga0075433_10264528	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1524	Open in IMG/M
3300006881\|Ga0068865_100248332	All Organisms → cellular organisms → Bacteria	1403	Open in IMG/M
3300007788\|Ga0099795_10009327	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Rhizobiales bacterium 32-66-8	2843	Open in IMG/M
3300007788\|Ga0099795_10090302	All Organisms → cellular organisms → Bacteria	1186	Open in IMG/M
3300007788\|Ga0099795_10147707	Not Available	960	Open in IMG/M
3300007788\|Ga0099795_10261565	Not Available	749	Open in IMG/M
3300007788\|Ga0099795_10600705	Not Available	524	Open in IMG/M
3300009029\|Ga0066793_10747609	Not Available	555	Open in IMG/M
3300009038\|Ga0099829_10547298	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	962	Open in IMG/M
3300009094\|Ga0111539_11772884	All Organisms → cellular organisms → Bacteria	716	Open in IMG/M
3300009143\|Ga0099792_10243003	All Organisms → cellular organisms → Bacteria	1045	Open in IMG/M
3300009143\|Ga0099792_10578195	All Organisms → cellular organisms → Bacteria → Proteobacteria	713	Open in IMG/M
3300009176\|Ga0105242_11999402	All Organisms → cellular organisms → Bacteria → Proteobacteria	622	Open in IMG/M
3300009522\|Ga0116218_1151131	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1054	Open in IMG/M
3300009645\|Ga0116106_1208860	Not Available	621	Open in IMG/M
3300010046\|Ga0126384_11748964	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	589	Open in IMG/M
3300010049\|Ga0123356_10888495	Not Available	1062	Open in IMG/M
3300010343\|Ga0074044_10003735	Not Available	12850	Open in IMG/M
3300010343\|Ga0074044_10005818	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	9975	Open in IMG/M
3300010343\|Ga0074044_10017322	Not Available	5277	Open in IMG/M
3300010343\|Ga0074044_10295196	All Organisms → cellular organisms → Bacteria	1066	Open in IMG/M
3300010376\|Ga0126381_101601536	All Organisms → cellular organisms → Bacteria → Proteobacteria	941	Open in IMG/M
3300010376\|Ga0126381_102215167	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	790	Open in IMG/M
3300010376\|Ga0126381_103341240	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae	632	Open in IMG/M
3300010379\|Ga0136449_100070666	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	7494	Open in IMG/M
3300010379\|Ga0136449_100416941	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	2373	Open in IMG/M
3300010379\|Ga0136449_100625634	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Parvibaculaceae → Rhodoligotrophos → Rhodoligotrophos appendicifer	1827	Open in IMG/M
3300010379\|Ga0136449_102840895	Not Available	682	Open in IMG/M
3300010396\|Ga0134126_11274195	Not Available	815	Open in IMG/M
3300010396\|Ga0134126_11927070	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp.	647	Open in IMG/M
3300010398\|Ga0126383_10301151	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1602	Open in IMG/M
3300010398\|Ga0126383_11352769	Not Available	802	Open in IMG/M
3300010398\|Ga0126383_11471193	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	771	Open in IMG/M
3300010398\|Ga0126383_13250537	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Klebsiella/Raoultella group → Klebsiella → Klebsiella pneumoniae	531	Open in IMG/M
3300010401\|Ga0134121_10258560	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii	1527	Open in IMG/M
3300011120\|Ga0150983_10727832	Not Available	568	Open in IMG/M
3300011269\|Ga0137392_10629154	Not Available	890	Open in IMG/M
3300012096\|Ga0137389_11656702	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae	536	Open in IMG/M
3300012200\|Ga0137382_10190960	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium icense	1405	Open in IMG/M
3300012202\|Ga0137363_10131201	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1947	Open in IMG/M
3300012202\|Ga0137363_10140178	All Organisms → cellular organisms → Bacteria → Proteobacteria	1889	Open in IMG/M
3300012202\|Ga0137363_10338778	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae	1242	Open in IMG/M
3300012202\|Ga0137363_10491522	All Organisms → cellular organisms → Bacteria → Proteobacteria	1030	Open in IMG/M
3300012202\|Ga0137363_11326584	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	608	Open in IMG/M
3300012202\|Ga0137363_11371302	All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium	596	Open in IMG/M
3300012203\|Ga0137399_10335041	All Organisms → cellular organisms → Bacteria → Proteobacteria	1255	Open in IMG/M
3300012205\|Ga0137362_10007925	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	7543	Open in IMG/M
3300012205\|Ga0137362_10012576	Not Available	6258	Open in IMG/M
3300012205\|Ga0137362_10123124	Not Available	2200	Open in IMG/M
3300012205\|Ga0137362_11770193	All Organisms → cellular organisms → Bacteria	505	Open in IMG/M
3300012206\|Ga0137380_10049214	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	3864	Open in IMG/M
3300012206\|Ga0137380_10159332	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	2058	Open in IMG/M
3300012207\|Ga0137381_11617719	Not Available	539	Open in IMG/M
3300012208\|Ga0137376_10114127	All Organisms → cellular organisms → Bacteria → Proteobacteria	2301	Open in IMG/M
3300012357\|Ga0137384_11316187	Not Available	569	Open in IMG/M
3300012361\|Ga0137360_10012894	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae	5377	Open in IMG/M
3300012361\|Ga0137360_10270188	All Organisms → cellular organisms → Bacteria	1403	Open in IMG/M
3300012361\|Ga0137360_10789677	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae	817	Open in IMG/M
3300012362\|Ga0137361_10112570	Not Available	2386	Open in IMG/M
3300012362\|Ga0137361_10244297	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	1634	Open in IMG/M
3300012582\|Ga0137358_10007177	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	6798	Open in IMG/M
3300012582\|Ga0137358_10189858	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae	1402	Open in IMG/M
3300012923\|Ga0137359_10018204	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	5937	Open in IMG/M
3300012923\|Ga0137359_11189778	Not Available	650	Open in IMG/M
3300012923\|Ga0137359_11412874	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	584	Open in IMG/M
3300012955\|Ga0164298_10538010	Not Available	789	Open in IMG/M
3300012957\|Ga0164303_10047194	All Organisms → cellular organisms → Bacteria → Proteobacteria	1887	Open in IMG/M
3300012957\|Ga0164303_10229307	Not Available	1049	Open in IMG/M
3300012958\|Ga0164299_10226456	All Organisms → cellular organisms → Bacteria	1100	Open in IMG/M
3300012960\|Ga0164301_10001416	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei	7686	Open in IMG/M
3300012960\|Ga0164301_10124746	Not Available	1528	Open in IMG/M
3300012971\|Ga0126369_10413989	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	1389	Open in IMG/M
3300013306\|Ga0163162_11151977	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae	879	Open in IMG/M
3300013306\|Ga0163162_13005974	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	542	Open in IMG/M
3300014151\|Ga0181539_1268995	Not Available	633	Open in IMG/M
3300014152\|Ga0181533_1035351	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	2814	Open in IMG/M
3300014155\|Ga0181524_10299497	Not Available	734	Open in IMG/M
3300014155\|Ga0181524_10477879	Not Available	532	Open in IMG/M
3300014501\|Ga0182024_12019165	Not Available	637	Open in IMG/M
3300014638\|Ga0181536_10120645	All Organisms → cellular organisms → Bacteria	1438	Open in IMG/M
3300015195\|Ga0167658_1031519	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei	1394	Open in IMG/M
3300016270\|Ga0182036_11206952	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	629	Open in IMG/M
3300016341\|Ga0182035_11135594	All Organisms → cellular organisms → Bacteria → Proteobacteria	696	Open in IMG/M
3300016371\|Ga0182034_12016939	Not Available	510	Open in IMG/M
3300016387\|Ga0182040_10046326	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	2674	Open in IMG/M
3300016445\|Ga0182038_10204381	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	1557	Open in IMG/M
3300016445\|Ga0182038_10285627	All Organisms → cellular organisms → Bacteria	1343	Open in IMG/M
3300017792\|Ga0163161_10390242	All Organisms → cellular organisms → Bacteria	1114	Open in IMG/M
3300017792\|Ga0163161_11588519	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	576	Open in IMG/M
3300017935\|Ga0187848_10098027	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium ADurb.Bin429	1338	Open in IMG/M
3300018002\|Ga0187868_1189057	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	722	Open in IMG/M
3300018025\|Ga0187885_10398941	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae	616	Open in IMG/M
3300018044\|Ga0187890_10232505	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Rhizobium/Agrobacterium group → Rhizobium	1040	Open in IMG/M
3300018088\|Ga0187771_10516469	All Organisms → cellular organisms → Bacteria	1011	Open in IMG/M
3300019996\|Ga0193693_1029524	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	966	Open in IMG/M
3300021086\|Ga0179596_10119588	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	1221	Open in IMG/M
3300021086\|Ga0179596_10519193	Not Available	604	Open in IMG/M
3300021168\|Ga0210406_10311718	All Organisms → cellular organisms → Bacteria	1277	Open in IMG/M
3300021171\|Ga0210405_10504632	All Organisms → cellular organisms → Bacteria → Proteobacteria	948	Open in IMG/M
3300021363\|Ga0193699_10062340	All Organisms → cellular organisms → Bacteria → Proteobacteria	1460	Open in IMG/M
3300021861\|Ga0213853_10368496	Not Available	848	Open in IMG/M
3300022756\|Ga0222622_10369107	All Organisms → cellular organisms → Bacteria → Elusimicrobia → unclassified Elusimicrobiota → Elusimicrobia bacterium RIFOXYB2_FULL_49_7	1004	Open in IMG/M
3300023102\|Ga0247754_1008048	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei	2139	Open in IMG/M
3300025322\|Ga0209641_10895617	All Organisms → cellular organisms → Bacteria → Proteobacteria	587	Open in IMG/M
3300025481\|Ga0208079_1004681	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	5926	Open in IMG/M
3300025898\|Ga0207692_10327175	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	939	Open in IMG/M
3300025899\|Ga0207642_10993438	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	540	Open in IMG/M
3300025906\|Ga0207699_10179202	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae	1423	Open in IMG/M
3300025912\|Ga0207707_10474125	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1069	Open in IMG/M
3300025922\|Ga0207646_10974549	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	750	Open in IMG/M
3300025931\|Ga0207644_10532851	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	971	Open in IMG/M
3300025934\|Ga0207686_11290103	Not Available	599	Open in IMG/M
3300025944\|Ga0207661_10069553	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	2870	Open in IMG/M
3300025972\|Ga0207668_10226150	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae	1506	Open in IMG/M
3300026223\|Ga0209840_1063610	All Organisms → cellular organisms → Bacteria	815	Open in IMG/M
3300026272\|Ga0209913_1067462	Not Available	801	Open in IMG/M
3300026285\|Ga0209438_1134094	Not Available	664	Open in IMG/M
3300026320\|Ga0209131_1002341	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	12905	Open in IMG/M
3300026320\|Ga0209131_1165893	Not Available	1092	Open in IMG/M
3300026322\|Ga0209687_1166249	All Organisms → cellular organisms → Bacteria	702	Open in IMG/M
3300026374\|Ga0257146_1055570	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	641	Open in IMG/M
3300026481\|Ga0257155_1001624	Not Available	2474	Open in IMG/M
3300026482\|Ga0257172_1044195	All Organisms → cellular organisms → Bacteria	813	Open in IMG/M
3300026482\|Ga0257172_1069347	All Organisms → cellular organisms → Bacteria → Proteobacteria	647	Open in IMG/M
3300026494\|Ga0257159_1014583	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	1255	Open in IMG/M
3300027512\|Ga0209179_1127818	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Rhizobiales bacterium 32-66-8	568	Open in IMG/M
3300028047\|Ga0209526_10163814	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	1553	Open in IMG/M
3300030007\|Ga0311338_10877403	All Organisms → cellular organisms → Bacteria	885	Open in IMG/M
3300031546\|Ga0318538_10289078	Not Available	883	Open in IMG/M
3300031561\|Ga0318528_10211561	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	1038	Open in IMG/M
3300031572\|Ga0318515_10134572	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860	1312	Open in IMG/M
3300031573\|Ga0310915_10389572	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	989	Open in IMG/M
3300031713\|Ga0318496_10073446	All Organisms → cellular organisms → Bacteria	1804	Open in IMG/M
3300031719\|Ga0306917_10021120	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	4019	Open in IMG/M
3300031744\|Ga0306918_11421093	Not Available	531	Open in IMG/M
3300031747\|Ga0318502_10371575	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	848	Open in IMG/M
3300031771\|Ga0318546_10991205	Not Available	591	Open in IMG/M
3300031792\|Ga0318529_10583694	All Organisms → cellular organisms → Bacteria	519	Open in IMG/M
3300031820\|Ga0307473_11462815	All Organisms → cellular organisms → Bacteria	517	Open in IMG/M
3300031845\|Ga0318511_10244754	Not Available	804	Open in IMG/M
3300031890\|Ga0306925_11910239	All Organisms → cellular organisms → Bacteria	564	Open in IMG/M
3300031893\|Ga0318536_10534940	Not Available	588	Open in IMG/M
3300031910\|Ga0306923_10743544	All Organisms → cellular organisms → Bacteria → Proteobacteria	1088	Open in IMG/M
3300031912\|Ga0306921_10468314	Not Available	1467	Open in IMG/M
3300031912\|Ga0306921_10906531	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1000	Open in IMG/M
3300031941\|Ga0310912_10477159	Not Available	972	Open in IMG/M
3300031941\|Ga0310912_10838216	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium → unclassified Mesorhizobium → Mesorhizobium sp.	709	Open in IMG/M
3300031942\|Ga0310916_10372980	All Organisms → cellular organisms → Bacteria	1213	Open in IMG/M
3300031942\|Ga0310916_11338070	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	588	Open in IMG/M
3300032001\|Ga0306922_11339374	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	722	Open in IMG/M
3300032039\|Ga0318559_10482625	Not Available	578	Open in IMG/M
3300032044\|Ga0318558_10311790	Not Available	778	Open in IMG/M
3300032059\|Ga0318533_10347134	Not Available	1080	Open in IMG/M
3300032076\|Ga0306924_10340331	All Organisms → cellular organisms → Bacteria → Proteobacteria	1721	Open in IMG/M
3300032160\|Ga0311301_10042681	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	10843	Open in IMG/M
3300032160\|Ga0311301_10069043	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	7502	Open in IMG/M
3300032160\|Ga0311301_10753978	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Parvibaculaceae → Rhodoligotrophos → Rhodoligotrophos appendicifer	1351	Open in IMG/M
3300032160\|Ga0311301_11823910	Not Available	722	Open in IMG/M
3300032174\|Ga0307470_11126477	All Organisms → cellular organisms → Bacteria → Proteobacteria	633	Open in IMG/M
3300032261\|Ga0306920_100086670	All Organisms → cellular organisms → Bacteria → Proteobacteria	4615	Open in IMG/M
3300032261\|Ga0306920_100120994	All Organisms → cellular organisms → Bacteria → Proteobacteria	3889	Open in IMG/M
3300033289\|Ga0310914_11661529	Not Available	542	Open in IMG/M

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:

Habitat	Taxonomy	Distribution
Environmental	Environmental	92.51%
Host-Associated	Host-Associated	7.49%

Habitat	Taxonomy	Distribution
Terrestrial	Environmental → Terrestrial	85.56%
Aquatic	Environmental → Aquatic	6.95%
Plants	Host-Associated → Plants	6.95%
Arthropoda	Host-Associated → Arthropoda	0.53%

Habitat	Taxonomy	Distribution
Soil	Environmental → Terrestrial → Soil	85.03%
Freshwater	Environmental → Aquatic → Freshwater	5.88%
Rhizosphere	Host-Associated → Plants → Rhizosphere	3.74%
Rhizoplane	Host-Associated → Plants → Rhizoplane	3.21%
Sediment	Environmental → Aquatic → Sediment	1.07%
Peat	Environmental → Terrestrial → Peat	0.53%
Digestive System	Host-Associated → Arthropoda → Digestive System	0.53%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified	67.91%
Loam	Environmental → Terrestrial → Soil → Loam	11.76%
Wetlands	Environmental → Aquatic → Freshwater → Wetlands	5.35%
Wetlands	Environmental → Terrestrial → Soil → Wetlands	5.35%
Epiphytes	Host-Associated → Plants → Rhizoplane → Epiphytes	3.21%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified	2.67%
Unclassified	Environmental → Aquatic → Sediment → Unclassified	1.07%
Soil	Host-Associated → Plants → Rhizosphere → Soil	1.07%
Sediment	Environmental → Aquatic → Freshwater → Sediment	0.53%
Unclassified	Environmental → Terrestrial → Peat → Unclassified	0.53%
Gut	Host-Associated → Arthropoda → Digestive System → Gut	0.53%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified → Unclassified	37.43%
Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil	22.99%
Agricultural Soil	Environmental → Terrestrial → Soil → Loam → Agricultural Soil	5.88%
Grasslands	Environmental → Terrestrial → Soil → Unclassified → Grasslands	5.35%
Bog	Environmental → Aquatic → Freshwater → Wetlands → Bog	4.81%
Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil	4.81%
Unclassified	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified	3.21%
Unclassified	Environmental → Terrestrial → Soil → Wetlands → Unclassified	2.67%
Permafrost	Environmental → Terrestrial → Soil → Wetlands → Permafrost	2.67%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified	2.67%
Permafrost	Environmental → Terrestrial → Soil → Unclassified → Permafrost	1.60%
Unclassified	Environmental → Aquatic → Sediment → Unclassified → Unclassified	1.07%
Unclassified	Host-Associated → Plants → Rhizosphere → Soil → Unclassified	1.07%
Unclassified	Environmental → Aquatic → Freshwater → Sediment → Unclassified	0.53%
Unclassified	Environmental → Aquatic → Freshwater → Wetlands → Unclassified	0.53%
Agricultural Land	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land	0.53%
Grasslands	Environmental → Terrestrial → Soil → Loam → Grasslands	0.53%
Unclassified	Environmental → Terrestrial → Soil → Loam → Unclassified	0.53%
Unclassified	Environmental → Terrestrial → Peat → Unclassified → Unclassified	0.53%
Unclassified	Host-Associated → Arthropoda → Digestive System → Gut → Unclassified	0.53%

Habitat	Taxonomy	Distribution
Vadose Zone Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil	21.39%
Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil	13.37%
Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil	8.56%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil	4.81%
Peatlands Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil	4.81%
Corn, Switchgrass And Miscanthus Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere	4.81%
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	4.28%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil	3.74%
Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil	3.21%
Bog	Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog	2.67%
Peatland	Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland	2.14%
Bog Forest Soil	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil	2.14%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere	2.14%
Terrestrial Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil	1.60%
Arctic Peat Soil	Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil	1.60%
Grasslands Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil	1.60%
Soil	Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil	1.60%
Populus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere	1.60%
Hardwood Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil	1.07%
Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil	1.07%
Corn Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere	1.07%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere	1.07%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	1.07%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere	1.07%
Watersheds	Environmental → Aquatic → Freshwater → Sediment → Unclassified → Watersheds	0.53%
Peatland	Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland	0.53%
Watersheds	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds	0.53%
Groundwater Sediment	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment	0.53%
Glacier Forefield Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil	0.53%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil	0.53%
Grass Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil	0.53%
Tropical Peatland	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland	0.53%
Prmafrost Soil	Environmental → Terrestrial → Soil → Wetlands → Permafrost → Prmafrost Soil	0.53%
Permafrost	Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost	0.53%
Soil	Environmental → Terrestrial → Soil → Loam → Grasslands → Soil	0.53%
Soil	Environmental → Terrestrial → Soil → Loam → Unclassified → Soil	0.53%
Palsa	Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa	0.53%
Termite Gut	Host-Associated → Arthropoda → Digestive System → Gut → Unclassified → Termite Gut	0.53%

Visualization

Powered by ApexCharts

Associated Samples

Taxon OID	Sample Name	Habitat Type	IMG/M Link
2170459003	Grass soil microbial communities from Rothamsted Park, UK - March 2009 indirect MP BIO 1O1 lysis 0-21cm	Environmental	Open in IMG/M
3300005171	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126	Environmental	Open in IMG/M
3300005178	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137	Environmental	Open in IMG/M
3300005439	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG	Environmental	Open in IMG/M
3300005467	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG	Environmental	Open in IMG/M
3300005471	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG	Environmental	Open in IMG/M
3300005554	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110	Environmental	Open in IMG/M
3300005557	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153	Environmental	Open in IMG/M
3300005764	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)	Environmental	Open in IMG/M
3300005980	Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil leachate replicate DNA2013-203	Environmental	Open in IMG/M
3300006055	Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-1 deep-072012	Environmental	Open in IMG/M
3300006173	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG	Environmental	Open in IMG/M
3300006175	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG	Environmental	Open in IMG/M
3300006354	Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012	Environmental	Open in IMG/M
3300006800	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109	Environmental	Open in IMG/M
3300006845	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5	Host-Associated	Open in IMG/M
3300006852	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2	Host-Associated	Open in IMG/M
3300006881	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2	Host-Associated	Open in IMG/M
3300007788	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2	Environmental	Open in IMG/M
3300009029	Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 1 DNA2013-189	Environmental	Open in IMG/M
3300009038	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG	Environmental	Open in IMG/M
3300009094	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2)	Host-Associated	Open in IMG/M
3300009143	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2	Environmental	Open in IMG/M
3300009176	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG	Host-Associated	Open in IMG/M
3300009522	Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_5_LS metaG	Environmental	Open in IMG/M
3300009645	Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_40	Environmental	Open in IMG/M
3300010046	Tropical forest soil microbial communities from Panama - MetaG Plot_36	Environmental	Open in IMG/M
3300010049	Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3	Host-Associated	Open in IMG/M
3300010343	Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1	Environmental	Open in IMG/M
3300010376	Tropical forest soil microbial communities from Panama - MetaG Plot_28	Environmental	Open in IMG/M
3300010379	Sb_50d combined assembly	Environmental	Open in IMG/M
3300010396	Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2	Environmental	Open in IMG/M
3300010398	Tropical forest soil microbial communities from Panama - MetaG Plot_35	Environmental	Open in IMG/M
3300010401	Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1	Environmental	Open in IMG/M
3300011120	Combined assembly of Microbial Forest Soil metaT	Environmental	Open in IMG/M
3300011269	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG	Environmental	Open in IMG/M
3300012096	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG	Environmental	Open in IMG/M
3300012200	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG	Environmental	Open in IMG/M
3300012202	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG	Environmental	Open in IMG/M
3300012203	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG	Environmental	Open in IMG/M
3300012205	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG	Environmental	Open in IMG/M
3300012206	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG	Environmental	Open in IMG/M
3300012207	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG	Environmental	Open in IMG/M
3300012208	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG	Environmental	Open in IMG/M
3300012357	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG	Environmental	Open in IMG/M
3300012361	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG	Environmental	Open in IMG/M
3300012362	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG	Environmental	Open in IMG/M
3300012582	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG	Environmental	Open in IMG/M
3300012923	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG	Environmental	Open in IMG/M
3300012955	Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MG	Environmental	Open in IMG/M
3300012957	Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG	Environmental	Open in IMG/M
3300012958	Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MG	Environmental	Open in IMG/M
3300012960	Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG	Environmental	Open in IMG/M
3300012971	Tropical forest soil microbial communities from Panama - MetaG Plot_1	Environmental	Open in IMG/M
3300013306	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG	Host-Associated	Open in IMG/M
3300014151	Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_60_metaG	Environmental	Open in IMG/M
3300014152	Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_60_metaG	Environmental	Open in IMG/M
3300014155	Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_60_metaG	Environmental	Open in IMG/M
3300014501	Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly)	Environmental	Open in IMG/M
3300014638	Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_60_metaG	Environmental	Open in IMG/M
3300015195	Arctic soil microbial communities from a glacier forefield, Storglaci?ren, Tarfala, Sweden (Sample st-6c, vegetation/snow interface)	Environmental	Open in IMG/M
3300016270	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080	Environmental	Open in IMG/M
3300016341	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170	Environmental	Open in IMG/M
3300016371	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172	Environmental	Open in IMG/M
3300016387	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176	Environmental	Open in IMG/M
3300016445	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108	Environmental	Open in IMG/M
3300017792	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG	Host-Associated	Open in IMG/M
3300017935	Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_40	Environmental	Open in IMG/M
3300018002	Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_40	Environmental	Open in IMG/M
3300018025	Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_100	Environmental	Open in IMG/M
3300018044	Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_21_10	Environmental	Open in IMG/M
3300018088	Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_10_MG	Environmental	Open in IMG/M
3300019996	Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3a2	Environmental	Open in IMG/M
3300021086	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_1_08_16fungal (Illumina Assembly)	Environmental	Open in IMG/M
3300021168	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M	Environmental	Open in IMG/M
3300021171	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M	Environmental	Open in IMG/M
3300021363	Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3c2	Environmental	Open in IMG/M
3300021861	Metatranscriptome of freshwater sediment microbial communities from post-fracked creek in Pennsylvania, United States - ABR_2016 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300022756	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1	Environmental	Open in IMG/M
3300023102	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S184-509B-5	Environmental	Open in IMG/M
3300025322	Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 16_1 (SPAdes)	Environmental	Open in IMG/M
3300025481	Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-2 deep-092012 (SPAdes)	Environmental	Open in IMG/M
3300025898	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes)	Environmental	Open in IMG/M
3300025899	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes)	Host-Associated	Open in IMG/M
3300025906	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes)	Environmental	Open in IMG/M
3300025912	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes)	Environmental	Open in IMG/M
3300025922	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes)	Environmental	Open in IMG/M
3300025931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025934	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025944	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes)	Environmental	Open in IMG/M
3300025972	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300026223	Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 2 DNA2013-190 (SPAdes)	Environmental	Open in IMG/M
3300026272	Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil leachate replicate DNA2013-203 (SPAdes)	Environmental	Open in IMG/M
3300026285	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_20cm (SPAdes)	Environmental	Open in IMG/M
3300026320	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_40cm (SPAdes)	Environmental	Open in IMG/M
3300026322	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136 (SPAdes)	Environmental	Open in IMG/M
3300026374	Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - CO-08-A	Environmental	Open in IMG/M
3300026481	Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NI-19-A	Environmental	Open in IMG/M
3300026482	Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-16-B	Environmental	Open in IMG/M
3300026494	Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NL-07-A	Environmental	Open in IMG/M
3300027512	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes)	Environmental	Open in IMG/M
3300028047	Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes)	Environmental	Open in IMG/M
3300030007	I_Palsa_E1 coassembly	Environmental	Open in IMG/M
3300031546	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23	Environmental	Open in IMG/M
3300031561	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26	Environmental	Open in IMG/M
3300031572	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19	Environmental	Open in IMG/M
3300031573	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111	Environmental	Open in IMG/M
3300031713	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f22	Environmental	Open in IMG/M
3300031719	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2)	Environmental	Open in IMG/M
3300031744	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2)	Environmental	Open in IMG/M
3300031747	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22	Environmental	Open in IMG/M
3300031771	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19	Environmental	Open in IMG/M
3300031792	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f23	Environmental	Open in IMG/M
3300031820	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515	Environmental	Open in IMG/M
3300031845	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f18	Environmental	Open in IMG/M
3300031890	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2)	Environmental	Open in IMG/M
3300031893	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f28	Environmental	Open in IMG/M
3300031910	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2)	Environmental	Open in IMG/M
3300031912	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2)	Environmental	Open in IMG/M
3300031941	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080	Environmental	Open in IMG/M
3300031942	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176	Environmental	Open in IMG/M
3300032001	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2)	Environmental	Open in IMG/M
3300032039	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f21	Environmental	Open in IMG/M
3300032044	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f20	Environmental	Open in IMG/M
3300032059	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27	Environmental	Open in IMG/M
3300032076	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2)	Environmental	Open in IMG/M
3300032160	Sb_50d combined assembly (MetaSPAdes)	Environmental	Open in IMG/M
3300032174	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05	Environmental	Open in IMG/M
3300032261	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2)	Environmental	Open in IMG/M
3300033289	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108	Environmental	Open in IMG/M

Geographical Distribution

Zoom:	Powered by OpenStreetMap

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
E4A_09158040	2170459003	Grass Soil	PLSLTTYFFTEISFAAMTCPPSPVVGDESESPNPFKLVEAGD
Ga0066677_106355262	3300005171	Soil	LSLTTYFFTEISFAAMIASLAIVGDESESLNPFKLVEAGE*
Ga0066688_108090581	3300005178	Soil	RSRSSPLSLTTYFFTEISFAAMIASLAIVGDESESLNPFQLVEAGD*
Ga0070711_1004823382	3300005439	Corn, Switchgrass And Miscanthus Rhizosphere	NRTTYLFTEFAFAAMIPSAAIKGGKSESLNPFKLVEASD*
Ga0070706_1000222937	3300005467	Corn, Switchgrass And Miscanthus Rhizosphere	SLTTYFFTEISFAAMIASLAIVGDESESLNPFKLVEAGD*
Ga0070698_1004340124	3300005471	Corn, Switchgrass And Miscanthus Rhizosphere	PVSLTTYFFTEISFAAMIASLAIVGDESESLNPFKLVEAGD*
Ga0066661_104583631	3300005554	Soil	YFFTEISFAAMIASLAIVGDESESLNPFKLVEAGD*
Ga0066661_105618742	3300005554	Soil	RTTYLFTEFSLAAMIPSAAIRGGKTESLNSFKLVEASD*
Ga0066704_102114361	3300005557	Soil	LTTYFFTEISFAAMIASLAIVGDESESLNPFKLVEAGD*
Ga0066903_1005064713	3300005764	Tropical Forest Soil	CSRSSALNRTTYRFTEISFAAMIPSAVNNDDKSESPNPFELVEAGD*
Ga0066903_1015978313	3300005764	Tropical Forest Soil	LTTYVFTEISFAAILASIANPGDGSESPNPFKLVEAND*
Ga0066903_1022624631	3300005764	Tropical Forest Soil	NLTTYVFTEISFAAILASIANPGDGSESPNPFKLVEAND*
Ga0066903_1032747473	3300005764	Tropical Forest Soil	RSRSSPLSLTTYFFTEISFAAMIASLAIVGDESESLNPFKLVEAGD*
Ga0066903_1033576753	3300005764	Tropical Forest Soil	LTTYFFTEISFAAMIASSPVVGDESESLNPFELVEAGD*
Ga0066903_1074868181	3300005764	Tropical Forest Soil	TYVFTEISFAAILASIANPGDGSESPNPFKLVEAND*
Ga0066903_1090320452	3300005764	Tropical Forest Soil	ASSRSRSSALNRTTYFFTEISFPAMILSSAQLGEKSESLNPFKLIEAGD*
Ga0066798_100110611	3300005980	Soil	YFFTEISFAAMIASLASSGDESESPNPFKLVEASD*
Ga0097691_10173965	3300006055	Arctic Peat Soil	TTYFFTEISFAAMIASLASSGDESESPNPFKLVEAGD*
Ga0097691_10378882	3300006055	Arctic Peat Soil	TYFFTEISFAAMIASLASSGDESESPNPFKLVEASD*
Ga0070716_1000737391	3300006173	Corn, Switchgrass And Miscanthus Rhizosphere	LFTEFSFAAMIPSAAIKGGKSESLNPFKLVEASD*
Ga0070716_1003611431	3300006173	Corn, Switchgrass And Miscanthus Rhizosphere	TTYLFTEFSFAAMIPSAAIKGGKSESLNPFKLVEASD*
Ga0070712_1005377791	3300006175	Corn, Switchgrass And Miscanthus Rhizosphere	YLFTEFAFAAMIPSAAIKGGKSESLNPFKLVEASD*
Ga0075021_103029901	3300006354	Watersheds	TYFFTEISFAAIMVSLVRGCESESLNPSQLVEAGD*
Ga0066660_106921604	3300006800	Soil	TYFFTEISFAAMIASVADSGDKSESLNPFKLVEAGD*
Ga0075421_1002730301	3300006845	Populus Rhizosphere	TTYFFAEISFAAMIASLAIVGDESESLNPFKLVEAGD*
Ga0075433_102645284	3300006852	Populus Rhizosphere	NRTTYRFTEISFPAMIAFANSSDESESSIPFELVEATD*
Ga0068865_1002483321	3300006881	Miscanthus Rhizosphere	LGSATAHRTLTLNLTTYVFTEISFAAILASIANPSDGSESPNPFKLVEAND*
Ga0099795_100093271	3300007788	Vadose Zone Soil	NRTTYPFTEISFAAMIASVVPTVDESESSNPFNLVEAGD*
Ga0099795_100903021	3300007788	Vadose Zone Soil	LNRTTYLFTEISFAAMIASVVPTVDESESSNPFNLVEAGD*
Ga0099795_101477072	3300007788	Vadose Zone Soil	YLFTEISFAAMIASVVPTVDESESSNPFNLVEAGD*
Ga0099795_102615651	3300007788	Vadose Zone Soil	TTYLFTEISFAAMIASVVPTVDESESSNPFNLVEAGD*
Ga0099795_106007052	3300007788	Vadose Zone Soil	NRTTYLFTEISFAAMIASVVPTVDESESSNPFNLVEAGD*
Ga0066793_107476092	3300009029	Prmafrost Soil	LTTYFFTEISFAAMIASLASSGDESESPNPFKLVEARD*
Ga0099829_105472981	3300009038	Vadose Zone Soil	YLFTEISFAAIIAPVVRPSTSESLNPFELVEAGD*
Ga0111539_117728841	3300009094	Populus Rhizosphere	LSLTTYFFTEISFAAMIASSPVVCDESESLDPFKLVEAGD*
Ga0099792_102430032	3300009143	Vadose Zone Soil	RTTYLFTEISFAAMIASVVPTVDESESSNPFNLVEAGD*
Ga0099792_105781951	3300009143	Vadose Zone Soil	RSSALNRTTYLFTEFSFAAMIPSAAIRGAKSESLKPFKLVEASD*
Ga0105242_119994021	3300009176	Miscanthus Rhizosphere	SRSRSSALNRTTYLFTEFSFAAMIPSAAIKGGKSESLNPFKLVEASD*
Ga0116218_11511313	3300009522	Peatlands Soil	SPLNRTTYFFTELSLPAMIAPVIRVMTSESSNPFKVVEAGD*
Ga0116106_12088602	3300009645	Peatland	NLTTYFFTEISFAAMIASVVRGCESESPNPFQLVEAGD*
Ga0126384_117489641	3300010046	Tropical Forest Soil	TYFFTEISFAAMLASVVRRGDQSESLIPFKMVEAGD*
Ga0123356_108884951	3300010049	Termite Gut	TTYRFTEISFAAMIPSAANSGDKSESTNPFKIVDAGD*
Ga0074044_100037351	3300010343	Bog Forest Soil	TYFFTEISFAAMIASIANSGDQSESQNPFKLVEAGD*
Ga0074044_1000581810	3300010343	Bog Forest Soil	FFTKISFAAMIASIANSGDQSESQNPFKLVEAGD*
Ga0074044_100173227	3300010343	Bog Forest Soil	NLTTYFFTEISFAAMIASIANSGDQSESQNPFKLVEAGD*
Ga0074044_102951962	3300010343	Bog Forest Soil	FFTEISFAAMIASIANSGDQSESQNPFKLVEAGD*
Ga0126381_1016015361	3300010376	Tropical Forest Soil	ASSCSRSSALNRTTYRFTEISFAAMIPSAVNNDDKSESPNLFEMVEAGD*
Ga0126381_1022151672	3300010376	Tropical Forest Soil	SCSRSSALNRTTYRFTEISFATMIPSAVNTDDKSESQNPFEMVEAGD*
Ga0126381_1033412401	3300010376	Tropical Forest Soil	NRTTYRFTEISFAAMIPSAVNNDDKSESPNPFEMVEAGD*
Ga0136449_1000706661	3300010379	Peatlands Soil	SFTTYFFTETTLPAMITPVANQCDKSESNNPFKLVEAGH*
Ga0136449_1004169414	3300010379	Peatlands Soil	SSSLSFTTYFFTETTLPAMITPVANQCDKSESNNPFKLVEAGH*
Ga0136449_1006256345	3300010379	Peatlands Soil	FTTYFFTETTLPAMITPVANQCDKSESNNPFKLVEAGH*
Ga0136449_1028408951	3300010379	Peatlands Soil	TYFFTEISFPAMIPLRRLCGDPSESLNPFKLVEAGD*
Ga0134126_112741951	3300010396	Terrestrial Soil	NRTIYLFTVISCAAMIPSAADSGNKSESPNPFKLVEAGD*
Ga0134126_119270703	3300010396	Terrestrial Soil	TTYLFTEFSFAAMIPSAAIKGGKSESLNPFKLVEAGD*
Ga0126383_103011511	3300010398	Tropical Forest Soil	TTYFFTEISFAAMLASVVRRGDQSESLIPFKMVEAGD*
Ga0126383_113527691	3300010398	Tropical Forest Soil	RTTYFFTEISFAAMLASVVRRGDQSESLIPFKMVEAGD*
Ga0126383_114711931	3300010398	Tropical Forest Soil	SASSCSRSSALNRTTYRFTEISFAAMIPSAVNNDDKSESPNPFEMVEAGD*
Ga0126383_132505372	3300010398	Tropical Forest Soil	ALNRTTYRFTEISFAAMIPSAVNNDDKSESPNPFKMVEAGD*
Ga0134121_102585603	3300010401	Terrestrial Soil	SASSRSRSSALNRTTYLFTEFAFAAMIPSAAIKGGKSESLNPFKLVEASD*
Ga0150983_107278322	3300011120	Forest Soil	SVERLEYVFTEIPFAAMIASIADSDESESQNPFKLV*
Ga0137392_106291542	3300011269	Vadose Zone Soil	TYFFTEISFAAIFASVARSCDESESLNPFKLVEADD*
Ga0137389_116567021	3300012096	Vadose Zone Soil	SLTTYFFTEISFAAMIASVSRRGDESESLNPFKLVKAGD*
Ga0137382_101909602	3300012200	Vadose Zone Soil	TTYLFTEFSLAAMIPSAAIRGGKTESLNSFKLVEASD*
Ga0137363_101312011	3300012202	Vadose Zone Soil	TYFFTKISFAAMIAPAARFNGKSESSNPFNLIEAGD*
Ga0137363_101401781	3300012202	Vadose Zone Soil	TYLFTEFSLAAMIPSAAIRGGKTESLNTFKLVEASD*
Ga0137363_103387781	3300012202	Vadose Zone Soil	LNRTTYLFTEFSLAAMIPSAAIRGGKTESLNSFKLVEASD*
Ga0137363_104915221	3300012202	Vadose Zone Soil	YLFTEFSLAAMIPSAAIRGGKTESLNSFKLVEASD*
Ga0137363_113265841	3300012202	Vadose Zone Soil	RSSALNRTTYLFTEFSFAAMIPSAVIRGGKSESLNPFELVEASD*
Ga0137363_113713022	3300012202	Vadose Zone Soil	FFTEISFAAMLASVVRRGDQSESLIPFKMVEAGD*
Ga0137399_103350413	3300012203	Vadose Zone Soil	EISFAAIIAPVVRPSTSESLNPFELVEAGDSLPAV*
Ga0137362_100079251	3300012205	Vadose Zone Soil	RTTYLFTEFSLAAMIPSAAIRGGKTESLNTFKLVEASD*
Ga0137362_100125761	3300012205	Vadose Zone Soil	TYLFTEISFAAMIASVVPTVDESESSNPFNLVEAGD*
Ga0137362_101231242	3300012205	Vadose Zone Soil	SRSSALNRTTYLFTEISFAAMIASVVPTVDESESPNPFNLVEAGD*
Ga0137362_117701933	3300012205	Vadose Zone Soil	FFTEISFAAMLASVVRRDDQSESLIPFKMVEAGD*
Ga0137380_100492141	3300012206	Vadose Zone Soil	SPLNLTTYLFTGISFAAMIASVASSGDESESPNPFKLVEAAD*
Ga0137380_101593325	3300012206	Vadose Zone Soil	LNLTTYLFTGISFAAMIASVASSGDESESPNPFKLVEAGD*
Ga0137381_116177192	3300012207	Vadose Zone Soil	NLTTYVFTEISFPSMIASIANNGDASESSNPFKLVEAGD*
Ga0137376_101141271	3300012208	Vadose Zone Soil	SSALNRTTYLFTEFSLAAMIPSAAIRGGKTESLNTFKLVEASD*
Ga0137384_113161872	3300012357	Vadose Zone Soil	SRSSALNRTTYLFTEFSLAAMIPSAAIRGGKTESLNSFKLVEAGD*
Ga0137360_100128941	3300012361	Vadose Zone Soil	VFTEISFAAMIASIANSGDGNESSNPFKFVEAGD*
Ga0137360_102701881	3300012361	Vadose Zone Soil	SVTTYFFTKISFAAMIAPAARFNGKSESSNPFNLIEAGD*
Ga0137360_107896771	3300012361	Vadose Zone Soil	LSVTTYFFTKISFAAMIAPAARFNGKSESSNPFNLIEAGD*
Ga0137361_101125701	3300012362	Vadose Zone Soil	SSALNRTTYLFTEISFAAMIASVVPTVDESESSNTFNLVEAGD*
Ga0137361_102442971	3300012362	Vadose Zone Soil	NRTTYLFTEISFAAIIAPVVRPSTSESLNPFELVEAGD*
Ga0137358_100071771	3300012582	Vadose Zone Soil	SASSRSRSSALNRTTYLFTEFSLAAMIPSAAIRGGKTESLNAFKLVEASD*
Ga0137358_101898581	3300012582	Vadose Zone Soil	TYLFTEFSLAAMIPSAAIRGGKTESLNSFKLVEASD*
Ga0137359_100182041	3300012923	Vadose Zone Soil	ALNRTTYLFTEISFAAMIASVVPTVDESESSNPFNLVEAGG*
Ga0137359_111897781	3300012923	Vadose Zone Soil	TYLFTEISVAAMVGSVVPTVDASECSDRFKLGEPGA*
Ga0137359_114128742	3300012923	Vadose Zone Soil	RSRSSALNRTTYLFTEFSLAAMIPSAAIRGGKTESLNSFKLVEASD*
Ga0164298_105380101	3300012955	Soil	NRTTYLFTEFSFAAMIPSAVIRGGKSESLNPFELVEASD*
Ga0164303_100471944	3300012957	Soil	YLFTEFSFAAMIPSAVIRGGKSESLNPFELVEASD*
Ga0164303_102293072	3300012957	Soil	LNLTTYVFTEISFPSMIASIANNGDASESSNPFKLVEAGD*
Ga0164299_102264561	3300012958	Soil	LNRTTYLFTEFSFAAMIPSAVIRGGKSESLNPFELVEASD*
Ga0164301_100014161	3300012960	Soil	LFTEFSFAAMIPSAVIRGGKSESLNPFELVEASD*
Ga0164301_101247461	3300012960	Soil	TTYLFTEFSFAAMIPSAVIRGGKSELLNPFELVEASD*
Ga0126369_104139891	3300012971	Tropical Forest Soil	RFTEISFAAMIPSAINNDDKSESPNPFEMVEAGD*
Ga0163162_111519772	3300013306	Switchgrass Rhizosphere	SSALNRTTYLFTEFAFAAMIPSAAIKGGKSESLNSFKLVEASD*
Ga0163162_130059742	3300013306	Switchgrass Rhizosphere	YLFTEFSFAAMIPSAAIKGGKSESLNPFKLVEASD*
Ga0181539_12689951	3300014151	Bog	NRTTYFFTEIFFAAMIASPAHDGQERESLNPFKLVEAGD*
Ga0181533_10353514	3300014152	Bog	FFTEIFFAAMIASPAHDGQERESLNPFKLVEAGD*
Ga0181524_102994971	3300014155	Bog	TYFFTEIFFAAMIASPAHDGQERESLNPFKLVEAGD*
Ga0181524_104778792	3300014155	Bog	LNRTTYFFTEIFFAAMIASPAHDGQERESLNPFKLVEAGD*
Ga0182024_120191652	3300014501	Permafrost	YFFTEISFAAMIAPPPARDGEEKESLNPFKLVEADD*
Ga0181536_101206451	3300014638	Bog	LNLTTYFFTEISFAAMIASVVRGCESESPNPFQLVEAGD*
Ga0167658_10315193	3300015195	Glacier Forefield Soil	PLSLTTYFFTEISFAAMIASVARSCDESESPNPFKLVEADD*
Ga0182036_112069521	3300016270	Soil	SLTTYFFTEISFAAIIASLASLGDESESLNHFKLVEAGD
Ga0182035_111355941	3300016341	Soil	TTYFFTEISFPAMIAPSPNHGSSESSNPFKLVETGD
Ga0182034_120169391	3300016371	Soil	SRSSPLSLTTYFFTEISFAAMIASLASLGDESESLNPFELVEAGD
Ga0182040_100463261	3300016387	Soil	TTYFFTEISFAAMIASLASLGDESESLNHFKLVEAGD
Ga0182038_102043812	3300016445	Soil	LTTYFFTEISFAAIIASLASLGDESESLNHFKLVEAGD
Ga0182038_102856272	3300016445	Soil	LSLTTYFFTEISFAAMIASLASRWDESESLNPFELVEAGD
Ga0163161_103902421	3300017792	Switchgrass Rhizosphere	TYLFTEFSFAAMIPSAAIKGGKSESLNPFKLVEASD
Ga0163161_115885192	3300017792	Switchgrass Rhizosphere	SRSRSSALNRTTYLFTEFAFAAMIPSAAIKGGKSESLNPFKLVEASD
Ga0187848_100980272	3300017935	Peatland	NRTTYFFTEIFFAAMIASPAHDGQERESLNPFKLVEAGD
Ga0187868_11890572	3300018002	Peatland	TYFFTEIFFAAMIASPAHDGQERESLNPFKLVEAGD
Ga0187885_103989413	3300018025	Peatland	TTYFFTEISFAAMIASVVRGCESESPNPFQLVEAGD
Ga0187890_102325051	3300018044	Peatland	RSSALSRTTYFFTEISFAAMIPSVARLANQSESLNPFKLVEAGD
Ga0187771_105164691	3300018088	Tropical Peatland	SCSRSSPLNRTTYRFTEISFAAMIPSVANNGDKSESLNPFKLIEAGN
Ga0193693_10295243	3300019996	Soil	SRTTYFFTEISFAAMIASVTSSADESESLNPFKLVEAGD
Ga0179596_101195883	3300021086	Vadose Zone Soil	LNRTTYLFTEISFAAMIASVVPTVDESESSNPFNLVEAGD
Ga0179596_105191931	3300021086	Vadose Zone Soil	SLSFTTYFFTETTLPAMITPVANQCDKSESNNPFKLVEAGH
Ga0210406_103117182	3300021168	Soil	PLSLTTYLFTEISFASMIASVARSCDESESLNPFKLVEADD
Ga0210405_105046323	3300021171	Soil	SLTTYFFTEISFAAMIAPFAGRGDESESPNPFKLVEAGD
Ga0193699_100623401	3300021363	Soil	LSRTTYFFTEISFAAMIASVTSSADESESLNPFKLVEAGD
Ga0213853_103684962	3300021861	Watersheds	TTYFFTKISFAAMIAPAARFNGRSESSNPFNLIEAGD
Ga0222622_103691071	3300022756	Groundwater Sediment	LLNLTTYVFTEISFAAILASIANPSDGSESPNPFKLVEAND
Ga0247754_10080481	3300023102	Soil	TLTLNLTTYVFTEISFAAILASIANPCDGSESPNPFKLVEAND
Ga0209641_108956172	3300025322	Soil	LNRTTYFFTEISFAVMITSAANSGDKSESLNPFKLVEAGD
Ga0208079_100468110	3300025481	Arctic Peat Soil	YFFTEISFAAMIASLASSGDESESPNPFKLVEASD
Ga0207692_103271753	3300025898	Corn, Switchgrass And Miscanthus Rhizosphere	LNRTTYLFTEFSFAAMIPSAAIKGGKSESLNPFKLVEASD
Ga0207642_109934382	3300025899	Miscanthus Rhizosphere	ALNRTTYLFTEFAFAAMIPSAAIKGGKSESLNPFKLVEASD
Ga0207699_101792023	3300025906	Corn, Switchgrass And Miscanthus Rhizosphere	ALNRTTYLFTEFSFAAMIPSAAIKGGKSESLNPFKLVEASD
Ga0207707_104741253	3300025912	Corn Rhizosphere	LNRTTYLFTEISFAAMIPSSANSGGKSESLNPFKLVEASD
Ga0207646_109745493	3300025922	Corn, Switchgrass And Miscanthus Rhizosphere	SLTTYFFTEISFAAMIASLASPVVGDESESLIPFKLVEAGD
Ga0207644_105328511	3300025931	Switchgrass Rhizosphere	LNRTTYLITEFAFAAMIPSAAIKGGKSESLNPFKLVEASD
Ga0207686_112901032	3300025934	Miscanthus Rhizosphere	RSSALNRTTYLFTEFAFAAMIPSAAIKGGKSESLNPFKLVEAGD
Ga0207661_100695536	3300025944	Corn Rhizosphere	ALNRTTYLFTEISFAAMVPSSANSAGKSESLNPFKLVEAND
Ga0207668_102261501	3300025972	Switchgrass Rhizosphere	SRSSALNRTTYLFTEFSFAAMIPSAAIKGGKSESLNPFKLVEAGD
Ga0209840_10636102	3300026223	Soil	LSLTTYFFTEISFAAMIASLASSGDESESPNPFKLVEASD
Ga0209913_10674622	3300026272	Soil	RLSLTTYFFTEISFAAMIASLASSGDESESPNPFKLVEASD
Ga0209438_11340941	3300026285	Grasslands Soil	SALNRTTYLFTEFSFAAMIPSAVIRGGKSESLNPFELVEASE
Ga0209131_100234112	3300026320	Grasslands Soil	ALNRTTYLFTEISFAAMIASVVPTVDESESSNPFNLVEAGD
Ga0209131_11658932	3300026320	Grasslands Soil	RTTYLFTEISFAAMIASVVPTVDESESSNPFNLVEAGD
Ga0209687_11662491	3300026322	Soil	PLSRTTYFFTEISFAAMILSVVRGGDANESLIPFKLVEAAD
Ga0257146_10555701	3300026374	Soil	ALNRTTYLFTEFSFAAMIPSAVIRGGKSESLNPFELVEASD
Ga0257155_10016242	3300026481	Soil	TYLFTEISFAAMIASVVPTVDESESSNPFNLVEAGD
Ga0257172_10441951	3300026482	Soil	SALNRTTYLFTEISFAAMIASVVPTVDESESSNPFNLVEAGD
Ga0257172_10693471	3300026482	Soil	SALNRTTYLFTEISFAAMIASVVPTVDESESSNPFNLVEAGE
Ga0257159_10145831	3300026494	Soil	NRTTYLFTEISFAAMIASVVPTVDESESSNPFNLVEAGD
Ga0209179_11278181	3300027512	Vadose Zone Soil	NRTTYPFTEISFAAMIASVVPTVDESESSNPFNLVEAGD
Ga0209526_101638143	3300028047	Forest Soil	YLFTEISFASMIASVARSCDKSESLNPFKLVEADD
Ga0311338_108774031	3300030007	Palsa	ALNRTTYLFTEISFAAMIASVVRTVDESESSNPFKLVEAGDYAL
Ga0318538_102890781	3300031546	Soil	SSCARSSALNRTTYRFTEISFAAMIPSAANNDDKSESPKTFKLVDAGD
Ga0318528_102115611	3300031561	Soil	TYFFTEISFAAIIASLASLGDESESLNHFKLVEAGD
Ga0318515_101345721	3300031572	Soil	LSLTTYFFTEISFAAIIASLASLGDESESLNHFKLVEAGD
Ga0310915_103895721	3300031573	Soil	YFFTEISFAAMLASVVRRGDQSESLIPFKMVEAGD
Ga0318496_100734461	3300031713	Soil	YFFTEISFAAMIASLASLGDESESLNHFKLVEAGD
Ga0306917_100211201	3300031719	Soil	LSLTTYFFTEISFAAMIASLASLGDESESLNHFKLVEAGD
Ga0306918_114210932	3300031744	Soil	TYLFTEISFAAMIPSAANSGCKSESPNPFKLIDASD
Ga0318502_103715751	3300031747	Soil	PLSLTTYFFTEISFAAIIASLASLGDESESLNHFKLVEAGD
Ga0318546_109912051	3300031771	Soil	NRTTYRFTEISFAAMIPSAANNDDKSESPKTFKLVDAGD
Ga0318529_105836942	3300031792	Soil	TYRFTEISFAAMIPSAAKNGDKSESPNHFKLAEAGD
Ga0307473_114628152	3300031820	Hardwood Forest Soil	SPLSLTTYFFSKISFAAMIASLASAGDESESLNPFKLVEAGD
Ga0318511_102447541	3300031845	Soil	STLNRTTYFFTEISFPAMIAPSPTHGSSESFNPFKLVETGD
Ga0306925_119102393	3300031890	Soil	TYFFTEISFAAMIASLASLGDESESLNHFKLVEAGD
Ga0318536_105349402	3300031893	Soil	PLNRTTYFFTEISFAAMLASVVRRGDQSESLIPFKMVEAGD
Ga0306923_107435442	3300031910	Soil	ALNLTTYRFTEISFAAMIPSAAKNGDKSESPNHFKLVEAGD
Ga0306921_104683144	3300031912	Soil	YFFTEISFAAIIASLASLGDESESLNHFKLVEAGD
Ga0306921_109065313	3300031912	Soil	NRTTYFFTEISFAAMLASVVRRGDQSESLIPFKMVEAGD
Ga0310912_104771592	3300031941	Soil	RSSPLSLTTYFFTEISFAAMIASLASLGDESESLNPFELVEAGD
Ga0310912_108382161	3300031941	Soil	LNRTTYFFTEISFAAMLASVVRRGDQSESLIPFKMVEAGD
Ga0310916_103729801	3300031942	Soil	TTYFFTEISFAAMLASVVRRGDQSESLIPFKMVEAGD
Ga0310916_113380701	3300031942	Soil	SLTTYFFTEISFAAMIASLASLGDESESLNHFKLVEAGD
Ga0306922_113393741	3300032001	Soil	LTTYFFTEISFAAMIASLASLGDESESLNHFKLVEAGD
Ga0318559_104826252	3300032039	Soil	TTYFFTEISFAAMIASLASLGDESESLNPFELVEAGD
Ga0318558_103117902	3300032044	Soil	SHTTYFFTEISFAAMIASSPVVGDESESLNPFELVEAGD
Ga0318533_103471343	3300032059	Soil	PLSLTTYFFTEISFAAMIASLASLGDESESLNPFELVEAGD
Ga0306924_103403313	3300032076	Soil	NLTTYRFTEISFAAMIPSAAKNGDKSESPNHFKLVEAGD
Ga0311301_100426811	3300032160	Peatlands Soil	YFFTETTLPAMITPVANQCDKSESNNPFKLVEAGH
Ga0311301_1006904311	3300032160	Peatlands Soil	LSFTTYFFTETTLPAMITPVANQCDKSESNNPFKLVEAGH
Ga0311301_107539781	3300032160	Peatlands Soil	FTTYFFTETTLPAMITPVANQCDKSESNNPFKLVEAGH
Ga0311301_118239101	3300032160	Peatlands Soil	LSRTTYFFTEISFEAMIASAAPGCGESESPNPFKLVEAGD
Ga0307470_111264771	3300032174	Hardwood Forest Soil	LNRTTYLFTEFSFAAMIPSAVIRGGKSESLNPFELVEASD
Ga0306920_1000866701	3300032261	Soil	TTYRFTEISFAAMIPSAAKNGDKSESPNHFKLVEAGD
Ga0306920_1001209945	3300032261	Soil	RTTYFFTEISFAAMLASVVRRGDQSESLIPFKMVEAGD
Ga0310914_116615291	3300033289	Soil	SLTTYFFTEISFAAMIASLASLGDESESLNPFELVEAGD

Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

Metagenome / Metatranscriptome Family F029871

Overview

Multiple Sequence Alignments

Structure & Topology

Predicted Secondary Structure and Topology

Predicted 3D Structure

Low Quality Model:

Gene Neighborhood

Neighboring Pfam domains

Neighboring Clusters of Orthologous Genes (COGs)

Phylogeny

NCBI Taxonomy

Associated Scaffolds

Environmental Properties

Associated Habitat Types

Associated Samples

Family Sequences