| Basic Information | |
|---|---|
| Family ID | F029858 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 187 |
| Average Sequence Length | 47 residues |
| Representative Sequence | MLVLLLIVVLIILSLMFGGFQKGTKSGGLGPMAPSCTACTSAPMND |
| Number of Associated Samples | 155 |
| Number of Associated Scaffolds | 187 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 87.63 % |
| % of genes near scaffold ends (potentially truncated) | 25.67 % |
| % of genes from short scaffolds (< 2000 bps) | 89.30 % |
| Associated GOLD sequencing projects | 146 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.38 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (62.032 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (15.508 % of family members) |
| Environment Ontology (ENVO) | Unclassified (34.225 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (49.198 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Fibrous | Signal Peptide: | Yes | Secondary Structure distribution: | α-helix: 20.27% β-sheet: 0.00% Coil/Unstructured: 79.73% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.38 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 187 Family Scaffolds |
|---|---|---|
| PF14014 | DUF4230 | 26.20 |
| PF11716 | MDMPI_N | 20.32 |
| PF13411 | MerR_1 | 10.70 |
| PF00248 | Aldo_ket_red | 3.21 |
| PF00376 | MerR | 1.60 |
| PF00491 | Arginase | 1.07 |
| PF03572 | Peptidase_S41 | 0.53 |
| PF07690 | MFS_1 | 0.53 |
| PF14016 | DUF4232 | 0.53 |
| PF03551 | PadR | 0.53 |
| PF00817 | IMS | 0.53 |
| COG ID | Name | Functional Category | % Frequency in 187 Family Scaffolds |
|---|---|---|---|
| COG0010 | Arginase/agmatinase family enzyme | Amino acid transport and metabolism [E] | 1.07 |
| COG0389 | Nucleotidyltransferase/DNA polymerase DinP involved in DNA repair | Replication, recombination and repair [L] | 0.53 |
| COG0793 | C-terminal processing protease CtpA/Prc, contains a PDZ domain | Posttranslational modification, protein turnover, chaperones [O] | 0.53 |
| COG1695 | DNA-binding transcriptional regulator, PadR family | Transcription [K] | 0.53 |
| COG1733 | DNA-binding transcriptional regulator, HxlR family | Transcription [K] | 0.53 |
| COG1846 | DNA-binding transcriptional regulator, MarR family | Transcription [K] | 0.53 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 62.03 % |
| Unclassified | root | N/A | 37.97 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2166559006|FI_contig14800 | Not Available | 828 | Open in IMG/M |
| 2170459023|GZGNO2B02HGTT5 | Not Available | 514 | Open in IMG/M |
| 3300002568|C688J35102_117966272 | Not Available | 519 | Open in IMG/M |
| 3300003659|JGI25404J52841_10004025 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2952 | Open in IMG/M |
| 3300004156|Ga0062589_101679142 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 633 | Open in IMG/M |
| 3300005168|Ga0066809_10128526 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Amycolatopsis | 642 | Open in IMG/M |
| 3300005175|Ga0066673_10529883 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 692 | Open in IMG/M |
| 3300005177|Ga0066690_10156382 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1501 | Open in IMG/M |
| 3300005186|Ga0066676_10591432 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Amycolatopsis | 752 | Open in IMG/M |
| 3300005331|Ga0070670_101195248 | Not Available | 695 | Open in IMG/M |
| 3300005332|Ga0066388_100638732 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1681 | Open in IMG/M |
| 3300005333|Ga0070677_10647094 | All Organisms → cellular organisms → Bacteria | 590 | Open in IMG/M |
| 3300005334|Ga0068869_100746708 | All Organisms → cellular organisms → Bacteria | 837 | Open in IMG/M |
| 3300005336|Ga0070680_100090170 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2537 | Open in IMG/M |
| 3300005337|Ga0070682_100144952 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1623 | Open in IMG/M |
| 3300005434|Ga0070709_10021497 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 3758 | Open in IMG/M |
| 3300005434|Ga0070709_10516487 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Amycolatopsis | 909 | Open in IMG/M |
| 3300005434|Ga0070709_10552184 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Amycolatopsis | 881 | Open in IMG/M |
| 3300005434|Ga0070709_10677490 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Amycolatopsis | 800 | Open in IMG/M |
| 3300005434|Ga0070709_10773721 | Not Available | 751 | Open in IMG/M |
| 3300005434|Ga0070709_10953573 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 681 | Open in IMG/M |
| 3300005435|Ga0070714_101192644 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Amycolatopsis | 742 | Open in IMG/M |
| 3300005435|Ga0070714_101780449 | Not Available | 601 | Open in IMG/M |
| 3300005435|Ga0070714_101884716 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Amycolatopsis → Amycolatopsis mediterranei | 583 | Open in IMG/M |
| 3300005435|Ga0070714_101896650 | Not Available | 581 | Open in IMG/M |
| 3300005437|Ga0070710_10024203 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 3200 | Open in IMG/M |
| 3300005437|Ga0070710_11474428 | Not Available | 510 | Open in IMG/M |
| 3300005439|Ga0070711_101947182 | Not Available | 517 | Open in IMG/M |
| 3300005444|Ga0070694_100278059 | Not Available | 1275 | Open in IMG/M |
| 3300005445|Ga0070708_100116011 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2465 | Open in IMG/M |
| 3300005445|Ga0070708_100197238 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1884 | Open in IMG/M |
| 3300005467|Ga0070706_100213288 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1802 | Open in IMG/M |
| 3300005467|Ga0070706_100333056 | Not Available | 1415 | Open in IMG/M |
| 3300005471|Ga0070698_100349365 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1410 | Open in IMG/M |
| 3300005471|Ga0070698_100965971 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 799 | Open in IMG/M |
| 3300005559|Ga0066700_10760391 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 657 | Open in IMG/M |
| 3300005560|Ga0066670_10899035 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 539 | Open in IMG/M |
| 3300005578|Ga0068854_100191854 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1601 | Open in IMG/M |
| 3300005718|Ga0068866_10527737 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 785 | Open in IMG/M |
| 3300006028|Ga0070717_10198725 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1755 | Open in IMG/M |
| 3300006046|Ga0066652_100754390 | Not Available | 929 | Open in IMG/M |
| 3300006173|Ga0070716_101148407 | Not Available | 622 | Open in IMG/M |
| 3300006791|Ga0066653_10274986 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Amycolatopsis → Amycolatopsis mediterranei | 855 | Open in IMG/M |
| 3300006800|Ga0066660_10089949 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2142 | Open in IMG/M |
| 3300006904|Ga0075424_102006160 | Not Available | 610 | Open in IMG/M |
| 3300006914|Ga0075436_100705467 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 747 | Open in IMG/M |
| 3300006954|Ga0079219_11218127 | Not Available | 654 | Open in IMG/M |
| 3300007258|Ga0099793_10315519 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 761 | Open in IMG/M |
| 3300007788|Ga0099795_10067081 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1345 | Open in IMG/M |
| 3300009098|Ga0105245_10396384 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1378 | Open in IMG/M |
| 3300009101|Ga0105247_10167389 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1459 | Open in IMG/M |
| 3300009174|Ga0105241_10517931 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1066 | Open in IMG/M |
| 3300009174|Ga0105241_12622499 | Not Available | 506 | Open in IMG/M |
| 3300009792|Ga0126374_10367509 | Not Available | 993 | Open in IMG/M |
| 3300010043|Ga0126380_10127916 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1583 | Open in IMG/M |
| 3300010043|Ga0126380_12276293 | Not Available | 503 | Open in IMG/M |
| 3300010159|Ga0099796_10139158 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 947 | Open in IMG/M |
| 3300010303|Ga0134082_10184648 | Not Available | 850 | Open in IMG/M |
| 3300010304|Ga0134088_10239703 | Not Available | 872 | Open in IMG/M |
| 3300010325|Ga0134064_10193742 | Not Available | 726 | Open in IMG/M |
| 3300010326|Ga0134065_10179315 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 756 | Open in IMG/M |
| 3300010329|Ga0134111_10526331 | Not Available | 522 | Open in IMG/M |
| 3300010359|Ga0126376_10876544 | Not Available | 885 | Open in IMG/M |
| 3300010359|Ga0126376_11742039 | Not Available | 659 | Open in IMG/M |
| 3300010364|Ga0134066_10064231 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 981 | Open in IMG/M |
| 3300010366|Ga0126379_10363365 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1483 | Open in IMG/M |
| 3300010371|Ga0134125_11168382 | Not Available | 841 | Open in IMG/M |
| 3300010373|Ga0134128_13211191 | Not Available | 502 | Open in IMG/M |
| 3300010401|Ga0134121_10202006 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1719 | Open in IMG/M |
| 3300012198|Ga0137364_10330966 | Not Available | 1134 | Open in IMG/M |
| 3300012199|Ga0137383_10125630 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Actinoplanes → Actinoplanes flavus | 1872 | Open in IMG/M |
| 3300012199|Ga0137383_10758061 | Not Available | 709 | Open in IMG/M |
| 3300012200|Ga0137382_10783621 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 685 | Open in IMG/M |
| 3300012201|Ga0137365_10063101 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2798 | Open in IMG/M |
| 3300012201|Ga0137365_10645007 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Actinoplanes → Actinoplanes flavus | 775 | Open in IMG/M |
| 3300012202|Ga0137363_10380918 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1172 | Open in IMG/M |
| 3300012203|Ga0137399_10732581 | Not Available | 832 | Open in IMG/M |
| 3300012203|Ga0137399_11741830 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 511 | Open in IMG/M |
| 3300012205|Ga0137362_10497389 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1055 | Open in IMG/M |
| 3300012207|Ga0137381_10801695 | Not Available | 816 | Open in IMG/M |
| 3300012208|Ga0137376_10259259 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1508 | Open in IMG/M |
| 3300012208|Ga0137376_10460417 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1104 | Open in IMG/M |
| 3300012208|Ga0137376_11455922 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 576 | Open in IMG/M |
| 3300012210|Ga0137378_11477782 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 591 | Open in IMG/M |
| 3300012351|Ga0137386_11117241 | Not Available | 556 | Open in IMG/M |
| 3300012353|Ga0137367_10046248 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 3290 | Open in IMG/M |
| 3300012356|Ga0137371_10322289 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1202 | Open in IMG/M |
| 3300012356|Ga0137371_10763965 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 738 | Open in IMG/M |
| 3300012360|Ga0137375_10150651 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2272 | Open in IMG/M |
| 3300012487|Ga0157321_1020748 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 600 | Open in IMG/M |
| 3300012492|Ga0157335_1012286 | Not Available | 714 | Open in IMG/M |
| 3300012507|Ga0157342_1003286 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1377 | Open in IMG/M |
| 3300012685|Ga0137397_11304280 | Not Available | 516 | Open in IMG/M |
| 3300012918|Ga0137396_10166242 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1612 | Open in IMG/M |
| 3300012925|Ga0137419_11548656 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 562 | Open in IMG/M |
| 3300012944|Ga0137410_10792389 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 795 | Open in IMG/M |
| 3300012960|Ga0164301_10124520 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1529 | Open in IMG/M |
| 3300012988|Ga0164306_10205302 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1385 | Open in IMG/M |
| 3300012989|Ga0164305_11673441 | Not Available | 570 | Open in IMG/M |
| 3300012989|Ga0164305_12246770 | Not Available | 502 | Open in IMG/M |
| 3300013105|Ga0157369_12668957 | Not Available | 504 | Open in IMG/M |
| 3300013296|Ga0157374_11041973 | Not Available | 838 | Open in IMG/M |
| 3300013306|Ga0163162_12202773 | Not Available | 633 | Open in IMG/M |
| 3300014325|Ga0163163_12533041 | Not Available | 571 | Open in IMG/M |
| 3300014325|Ga0163163_12852471 | Not Available | 539 | Open in IMG/M |
| 3300014326|Ga0157380_12531433 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 579 | Open in IMG/M |
| 3300015200|Ga0173480_10995368 | Not Available | 552 | Open in IMG/M |
| 3300015264|Ga0137403_10155400 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2250 | Open in IMG/M |
| 3300015371|Ga0132258_12120391 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1412 | Open in IMG/M |
| 3300015374|Ga0132255_104828145 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 571 | Open in IMG/M |
| 3300016294|Ga0182041_10670810 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 917 | Open in IMG/M |
| 3300017947|Ga0187785_10167386 | Not Available | 935 | Open in IMG/M |
| 3300018060|Ga0187765_10288794 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 979 | Open in IMG/M |
| 3300019361|Ga0173482_10036146 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1527 | Open in IMG/M |
| 3300020002|Ga0193730_1018655 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1996 | Open in IMG/M |
| 3300020002|Ga0193730_1094482 | Not Available | 836 | Open in IMG/M |
| 3300020002|Ga0193730_1134554 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 667 | Open in IMG/M |
| 3300020069|Ga0197907_10468098 | Not Available | 841 | Open in IMG/M |
| 3300020080|Ga0206350_11059439 | Not Available | 635 | Open in IMG/M |
| 3300020579|Ga0210407_10330625 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1191 | Open in IMG/M |
| 3300020579|Ga0210407_11071469 | Not Available | 612 | Open in IMG/M |
| 3300021088|Ga0210404_10323266 | Not Available | 852 | Open in IMG/M |
| 3300021171|Ga0210405_10178849 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1681 | Open in IMG/M |
| 3300021178|Ga0210408_10115251 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Actinoplanes → Actinoplanes flavus | 2117 | Open in IMG/M |
| 3300021180|Ga0210396_10482655 | Not Available | 1086 | Open in IMG/M |
| 3300021403|Ga0210397_10000637 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 23177 | Open in IMG/M |
| 3300021403|Ga0210397_10084289 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2113 | Open in IMG/M |
| 3300021403|Ga0210397_11538212 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 516 | Open in IMG/M |
| 3300021432|Ga0210384_10098710 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2620 | Open in IMG/M |
| 3300021478|Ga0210402_10693031 | Not Available | 941 | Open in IMG/M |
| 3300021479|Ga0210410_10288752 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1472 | Open in IMG/M |
| 3300024254|Ga0247661_1027309 | Not Available | 1013 | Open in IMG/M |
| 3300024279|Ga0247692_1019852 | Not Available | 1024 | Open in IMG/M |
| 3300024288|Ga0179589_10070896 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1365 | Open in IMG/M |
| 3300024310|Ga0247681_1029310 | Not Available | 811 | Open in IMG/M |
| 3300025735|Ga0207713_1104974 | Not Available | 969 | Open in IMG/M |
| 3300025885|Ga0207653_10006299 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 3701 | Open in IMG/M |
| 3300025898|Ga0207692_10494593 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 775 | Open in IMG/M |
| 3300025898|Ga0207692_11075721 | Not Available | 532 | Open in IMG/M |
| 3300025899|Ga0207642_10095184 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1481 | Open in IMG/M |
| 3300025910|Ga0207684_10142464 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2061 | Open in IMG/M |
| 3300025910|Ga0207684_10383119 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1209 | Open in IMG/M |
| 3300025912|Ga0207707_10102206 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2505 | Open in IMG/M |
| 3300025915|Ga0207693_10314364 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1226 | Open in IMG/M |
| 3300025916|Ga0207663_10779162 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 761 | Open in IMG/M |
| 3300025928|Ga0207700_10348394 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1289 | Open in IMG/M |
| 3300025960|Ga0207651_10492839 | Not Available | 1058 | Open in IMG/M |
| 3300025961|Ga0207712_10279934 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1361 | Open in IMG/M |
| 3300026116|Ga0207674_11152098 | Not Available | 745 | Open in IMG/M |
| 3300026323|Ga0209472_1314826 | Not Available | 503 | Open in IMG/M |
| 3300026374|Ga0257146_1020557 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1075 | Open in IMG/M |
| 3300026489|Ga0257160_1062077 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 654 | Open in IMG/M |
| 3300026550|Ga0209474_10624662 | Not Available | 553 | Open in IMG/M |
| 3300026552|Ga0209577_10498578 | Not Available | 812 | Open in IMG/M |
| 3300027119|Ga0209522_1033848 | Not Available | 627 | Open in IMG/M |
| 3300027560|Ga0207981_1018109 | Not Available | 1267 | Open in IMG/M |
| 3300027725|Ga0209178_1333138 | Not Available | 565 | Open in IMG/M |
| 3300027750|Ga0209461_10189768 | Not Available | 519 | Open in IMG/M |
| 3300027787|Ga0209074_10267771 | Not Available | 671 | Open in IMG/M |
| 3300028715|Ga0307313_10186650 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 643 | Open in IMG/M |
| 3300028811|Ga0307292_10530960 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 506 | Open in IMG/M |
| 3300028828|Ga0307312_10149186 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1483 | Open in IMG/M |
| 3300031057|Ga0170834_101860305 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 835 | Open in IMG/M |
| 3300031091|Ga0308201_10209187 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium SCGC AG-212-D15 | 649 | Open in IMG/M |
| 3300031170|Ga0307498_10182329 | Not Available | 720 | Open in IMG/M |
| 3300031184|Ga0307499_10195897 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 619 | Open in IMG/M |
| 3300031543|Ga0318516_10810635 | All Organisms → cellular organisms → Bacteria | 528 | Open in IMG/M |
| 3300031720|Ga0307469_10204148 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1547 | Open in IMG/M |
| 3300031740|Ga0307468_100130763 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1568 | Open in IMG/M |
| 3300031859|Ga0318527_10487540 | All Organisms → cellular organisms → Bacteria | 526 | Open in IMG/M |
| 3300031890|Ga0306925_11930065 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 560 | Open in IMG/M |
| 3300031947|Ga0310909_11252770 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 598 | Open in IMG/M |
| 3300031954|Ga0306926_10531381 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1443 | Open in IMG/M |
| 3300031996|Ga0308176_10093184 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2622 | Open in IMG/M |
| 3300032001|Ga0306922_10561839 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1212 | Open in IMG/M |
| 3300032052|Ga0318506_10165268 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 971 | Open in IMG/M |
| 3300032089|Ga0318525_10308793 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 812 | Open in IMG/M |
| 3300032421|Ga0310812_10165075 | Not Available | 948 | Open in IMG/M |
| 3300032805|Ga0335078_11884524 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 646 | Open in IMG/M |
| 3300032828|Ga0335080_11658227 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 628 | Open in IMG/M |
| 3300032893|Ga0335069_10430613 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1542 | Open in IMG/M |
| 3300032898|Ga0335072_10624995 | Not Available | 1076 | Open in IMG/M |
| 3300032898|Ga0335072_11800410 | Not Available | 505 | Open in IMG/M |
| 3300033134|Ga0335073_10065689 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 4790 | Open in IMG/M |
| 3300033134|Ga0335073_11157007 | Not Available | 781 | Open in IMG/M |
| 3300033158|Ga0335077_11059291 | Not Available | 804 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 15.51% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 13.90% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 11.76% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 8.56% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 5.35% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 4.28% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 3.21% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 3.21% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.67% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 2.14% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.60% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.60% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 1.60% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 1.60% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere | 1.60% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.60% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.07% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 1.07% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.07% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 1.07% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 1.07% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.07% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 1.07% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 1.07% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.07% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.07% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 1.07% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grass Soil | 0.53% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.53% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil | 0.53% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.53% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.53% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.53% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.53% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.53% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.53% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.53% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.53% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.53% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.53% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.53% |
| Agave | Host-Associated → Plants → Phyllosphere → Phylloplane/Leaf Surface → Unclassified → Agave | 0.53% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2166559006 | Grass soil microbial communities from Rothamsted Park, UK - FI (heavy metals 2g/kg) assembled | Environmental | Open in IMG/M |
| 2170459023 | Grass soil microbial communities from Rothamsted Park, UK - FA3 (control condition) | Environmental | Open in IMG/M |
| 3300002568 | Grasslands soil microbial communities from Hopland, California, USA - 2 | Environmental | Open in IMG/M |
| 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Host-Associated | Open in IMG/M |
| 3300004156 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1 | Environmental | Open in IMG/M |
| 3300005168 | Soil and rhizosphere microbial communities from Laval, Canada - mgLPC | Environmental | Open in IMG/M |
| 3300005175 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 | Environmental | Open in IMG/M |
| 3300005177 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 | Environmental | Open in IMG/M |
| 3300005186 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 | Environmental | Open in IMG/M |
| 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Host-Associated | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Host-Associated | Open in IMG/M |
| 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Host-Associated | Open in IMG/M |
| 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Environmental | Open in IMG/M |
| 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Environmental | Open in IMG/M |
| 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
| 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
| 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Environmental | Open in IMG/M |
| 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
| 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Environmental | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
| 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
| 3300005559 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 | Environmental | Open in IMG/M |
| 3300005560 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119 | Environmental | Open in IMG/M |
| 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Host-Associated | Open in IMG/M |
| 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Host-Associated | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006791 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102 | Environmental | Open in IMG/M |
| 3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
| 3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
| 3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
| 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Environmental | Open in IMG/M |
| 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Host-Associated | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Environmental | Open in IMG/M |
| 3300010303 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09182015 | Environmental | Open in IMG/M |
| 3300010304 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09182015 | Environmental | Open in IMG/M |
| 3300010325 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_0_1 metaG | Environmental | Open in IMG/M |
| 3300010326 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010329 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_11112015 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010364 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09212015 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
| 3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
| 3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
| 3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012353 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012360 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_113_16 metaG | Environmental | Open in IMG/M |
| 3300012487 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.4.old.130510 | Host-Associated | Open in IMG/M |
| 3300012492 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.yng.030610 | Host-Associated | Open in IMG/M |
| 3300012507 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 | Host-Associated | Open in IMG/M |
| 3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
| 3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
| 3300012988 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MG | Environmental | Open in IMG/M |
| 3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
| 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Host-Associated | Open in IMG/M |
| 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Host-Associated | Open in IMG/M |
| 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
| 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
| 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Host-Associated | Open in IMG/M |
| 3300015200 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S209-509C-1 (version 2) | Environmental | Open in IMG/M |
| 3300015264 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300017947 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_4_20_MG | Environmental | Open in IMG/M |
| 3300018060 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MG | Environmental | Open in IMG/M |
| 3300019361 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2 (version 2) | Environmental | Open in IMG/M |
| 3300020002 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1a1 | Environmental | Open in IMG/M |
| 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300021088 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M | Environmental | Open in IMG/M |
| 3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
| 3300021403 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
| 3300024254 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK02 | Environmental | Open in IMG/M |
| 3300024279 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK33 | Environmental | Open in IMG/M |
| 3300024288 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300024310 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK22 | Environmental | Open in IMG/M |
| 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026323 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 (SPAdes) | Environmental | Open in IMG/M |
| 3300026374 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - CO-08-A | Environmental | Open in IMG/M |
| 3300026489 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NL-11-A | Environmental | Open in IMG/M |
| 3300026550 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 (SPAdes) | Environmental | Open in IMG/M |
| 3300026552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 (SPAdes) | Environmental | Open in IMG/M |
| 3300027119 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM1H0_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027560 | Soil and rhizosphere microbial communities from Laval, Canada - mgLPC (SPAdes) | Environmental | Open in IMG/M |
| 3300027725 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 (SPAdes) | Environmental | Open in IMG/M |
| 3300027750 | Agave microbial communities from Guanajuato, Mexico - As.Ma.rz (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027787 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter (SPAdes) | Environmental | Open in IMG/M |
| 3300028715 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_203 | Environmental | Open in IMG/M |
| 3300028811 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_149 | Environmental | Open in IMG/M |
| 3300028828 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202 | Environmental | Open in IMG/M |
| 3300031057 | Oak Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031091 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_355 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031170 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 12_S | Environmental | Open in IMG/M |
| 3300031184 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 13_S | Environmental | Open in IMG/M |
| 3300031543 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20 | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
| 3300031859 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f25 | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300031996 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R2 | Environmental | Open in IMG/M |
| 3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
| 3300032052 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f19 | Environmental | Open in IMG/M |
| 3300032089 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f23 | Environmental | Open in IMG/M |
| 3300032421 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NN3 | Environmental | Open in IMG/M |
| 3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
| 3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
| 3300032893 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1 | Environmental | Open in IMG/M |
| 3300032898 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.1 | Environmental | Open in IMG/M |
| 3300033134 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.2 | Environmental | Open in IMG/M |
| 3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| FI_00183120 | 2166559006 | Grass Soil | MLVLLLIVVLIILSLMFGGFQKGTKSSGLAPLCTACAS |
| FA3_12059040 | 2170459023 | Grass Soil | MLVLLLIVVLIILSLMFGGFQKGTKSGGLSPMAPSCAACTSAPMND |
| C688J35102_1179662721 | 3300002568 | Soil | MLVLLLIVVLIILSLMFGGFQKGTKSGGLGRGLGQLAAVCTACTSTPLERDRS* |
| JGI25404J52841_100040252 | 3300003659 | Tabebuia Heterophylla Rhizosphere | MLVLLLIVVLIILSLMFGGFQKGTKSGGLGPLGPLCTACV* |
| Ga0062589_1016791421 | 3300004156 | Soil | MLVLLLIVVLIILSLMFGGFQKGTKSGGLGPMTPSCTACTSAPMND* |
| Ga0066809_101285261 | 3300005168 | Soil | MVVLLVIVVLIILSLMFGGFQKGTKSGGLGPPGPLCTTCV* |
| Ga0066673_105298831 | 3300005175 | Soil | MLVLLLIVVLIILSLMFGGFQKGTKSGGLGPMTPLCTTCTSEPMTH* |
| Ga0066690_101563823 | 3300005177 | Soil | MLVLLVIVVLIILSLMFGGFQKGTKSGGLGPLSPSGTSCVSASTQGRVLV* |
| Ga0066676_105914322 | 3300005186 | Soil | MLVLLVIVVLIILSLMFGGFQKGTKSGGLGPLSPSCASCVSASTQRR |
| Ga0070670_1011952482 | 3300005331 | Switchgrass Rhizosphere | MLVLLLIVVLIILSLMFGGFQKGTKSGGLGPITPSCTACTSAPMND* |
| Ga0066388_1006387321 | 3300005332 | Tropical Forest Soil | MLVLLLIVVLIILSLMFGGFQKGTKSGGLGPMTPLCTACV* |
| Ga0070677_106470941 | 3300005333 | Miscanthus Rhizosphere | MLVLLLIVVLIILSLMFGGFQKGTKSGGLGPMAPSCTACTSAPMND* |
| Ga0068869_1007467082 | 3300005334 | Miscanthus Rhizosphere | MLVLLLIVVLIILSLMFGGFQKGTKSGGLGPMTPLCTTCTSAPMTD* |
| Ga0070680_1000901703 | 3300005336 | Corn Rhizosphere | MLVLLLIVVLIILSLMFGGFQKGTKSGGLGPMTPSCTACTSAPIND* |
| Ga0070682_1001449521 | 3300005337 | Corn Rhizosphere | MLVLLLIVVLIILSLMFGGFQKGTKSGGLGRGLGPLAAACTACTSIPLTSGSS* |
| Ga0070709_100214974 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | VLVLLAIVVLVILSLMFGGFQKGTKSGSLAPLCTACTSASAKPAPARAIS* |
| Ga0070709_105164872 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | MLVLLLIVVLIILSLMFGGFQKGTKSGGLSPMAPSCTACTSAPMND* |
| Ga0070709_105521842 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | MLVLLVIVVLIILSIMFGGFQKGTKSGSLGPPGAVCVACTSAVLTPGSS* |
| Ga0070709_106774902 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | MLVLLVIVVLIILSLMFGGFQKGTKSGGLGPLSPSCTSCVSASTQRRVLV* |
| Ga0070709_107737211 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | VLVLLVIVVLIILSLMFGGFQKGTKSGSLGGGLGSGPGPLAAVCTACASTSVTSGSG* |
| Ga0070709_109535731 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | LVLLVIVVLIILSLMFGGFQKGTKSGSLAPLAPLCTACV* |
| Ga0070714_1011926442 | 3300005435 | Agricultural Soil | MLVLLVIVVLIILSLMFGGFQKGTKSGSLAPLAPLCTACV* |
| Ga0070714_1017804492 | 3300005435 | Agricultural Soil | LLIVVLIILSLMFGGFQKGTKSGGLGPMTPSCTACTSAPMND* |
| Ga0070714_1018847161 | 3300005435 | Agricultural Soil | VLLLIVVLIILSLMFGGFQKGTKSGGLSPMAPSCTACTSAPMND* |
| Ga0070714_1018966502 | 3300005435 | Agricultural Soil | VLVLLVIVVLVILSLMFGGFQKGTKSGSLGGGLGSGPGPLAAVCTACASTSVTSGSG* |
| Ga0070710_100242034 | 3300005437 | Corn, Switchgrass And Miscanthus Rhizosphere | MLVLLVIVVLIILSLMFGGFQKGTKSGGLGPLSPSCTSCVSPSTQRRVLV* |
| Ga0070710_114744281 | 3300005437 | Corn, Switchgrass And Miscanthus Rhizosphere | VLLLIVVLIILSLMFGGFQKGTKSGGLGPMTPSCTACTSAPIND* |
| Ga0070711_1019471821 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | IVVLVILSLMFGGFQKGTKSGSLGGGLGSGPGPLAAVCTACASTSVTSGSG* |
| Ga0070694_1002780591 | 3300005444 | Corn, Switchgrass And Miscanthus Rhizosphere | MLVLLLIVVLIILSLMFGGFQKGTKSGGLGRGLGPLAAACTACTSIPLTSGSG* |
| Ga0070708_1001160113 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | VLVLLVIVVLIILSLMFGGFQKGTKSGSLGPLAPLCTACTSAPIASGQDG* |
| Ga0070708_1001972382 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | VLALLVIVVLIILSLMFGGFQKGTKSGGLGPMVPLCTACTSAQATHAPAGAIS* |
| Ga0070706_1002132882 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | MLVLLVIVVLIILSLMFGGFQKGTKSGGLGGGLGPGPLAAVCTACTPTPLTPGSGSG* |
| Ga0070706_1003330562 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | VLALLAIVVLVILSLMFGGFQKGTKSGGLGPMVPLCTACTSAQATHAPAGAIS* |
| Ga0070698_1003493653 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | MVVLLVIVVLIILSLMFGGFQKGTKSGSLGPSAPLCTACTSAPQLLAPRAPNS* |
| Ga0070698_1009659711 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | LLVIVVLIILSLMFGGFQKGTKSGSLGPLAPLCTACTSAPIASGQDG* |
| Ga0066700_107603911 | 3300005559 | Soil | VLVLLAIVVLVILSLMFGGFQKGTKSGGLGPLGPLCTACTS |
| Ga0066670_108990352 | 3300005560 | Soil | MLVLLLIVVLIILSLMFGGFQKGTKSGGLGPMTPLCTTCTSEPATD* |
| Ga0068854_1001918541 | 3300005578 | Corn Rhizosphere | LIILSLMFGGFQKGTKSGGLGPMAPSCTACTSAPMND* |
| Ga0068866_105277372 | 3300005718 | Miscanthus Rhizosphere | MLVLLLIVVLIILSLMFDGFQKGTKSGGLGPMTPSCTACTSAPIND* |
| Ga0070717_101987253 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MLVLLVIVVLIILSLMFGGFQKGTKSGSLGPSAPLCTACTSAPQLLAPRAPNS* |
| Ga0066652_1007543901 | 3300006046 | Soil | MLVLLLIVVLIILSLMFGGFQKGTKSGSLGPLRPPCAECTSVWATRAGATAIS* |
| Ga0070716_1011484071 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | MLVLLVIVVLIILSLMFGGFQKGTKSGGLGLGPGPLAAVCTACTPTPLTPGSGSG* |
| Ga0066653_102749862 | 3300006791 | Soil | MLVLLVIVVLIILSLMFGGFQKGTKSGSLGPMAPLCTTCTSAPTAPGQEG* |
| Ga0066660_100899491 | 3300006800 | Soil | MLVLLLIVVLIILSLMFGGFQKGTKSGGLGPMTPLCATCTSAPMND* |
| Ga0075424_1020061601 | 3300006904 | Populus Rhizosphere | MLVLLLIVVLIILSLMFGGFQKGTKSGGLGPMTPSCTACTSAPIN* |
| Ga0075436_1007054672 | 3300006914 | Populus Rhizosphere | MLVLLLIVVLIILSLMFGGFQKGTKSGGLGPRTPLCTTCTSEPMTH* |
| Ga0079219_112181272 | 3300006954 | Agricultural Soil | MLVLLVIVVLIILSLMFGGVQKGTKSGGIGPMTPLCTTCTSEPMTD* |
| Ga0099793_103155191 | 3300007258 | Vadose Zone Soil | VLVLLVIVVLIILSLMFGGFQKGTKSGSLGGGLGPGPLAAVCTACASTSVTSGSG* |
| Ga0099795_100670812 | 3300007788 | Vadose Zone Soil | VLVLLVIVVLIILSLMFGGFQKGTKSGSLGPLAPLCTACA* |
| Ga0105245_103963842 | 3300009098 | Miscanthus Rhizosphere | VLVLLAIVVLVILSLMFGGFQKGTKSGSLAPLRTACTSASAKPAPARAIS* |
| Ga0105247_101673891 | 3300009101 | Switchgrass Rhizosphere | MLVLLVIVVLIILSLMFGGFQKGTKSGGLGPMTPLCTTCTSAPMTD* |
| Ga0105241_105179312 | 3300009174 | Corn Rhizosphere | MLVLLLIVVLIILSLMFGGFQKGTKSGGLGPMAPSCTACTSAPIND* |
| Ga0105241_126224991 | 3300009174 | Corn Rhizosphere | MLVLLAIVVLIILSLMFGGFQKGTKSGGLGRGLAPLAAVCTACTSTPLMSGSG* |
| Ga0126374_103675092 | 3300009792 | Tropical Forest Soil | MLVLLLIVVLIILSLMFGGFQKGTKSGGLGPMTPLCTTCTSAPMTN* |
| Ga0126380_101279161 | 3300010043 | Tropical Forest Soil | MLVLLLIVVLIILSLMFGGFQKGTKSGGLGPMTPLCTACTSEPMTD* |
| Ga0126380_122762931 | 3300010043 | Tropical Forest Soil | MLVLLLIVALIILSLMFGGFQKGTKSGGLAPLRPLCTACV* |
| Ga0099796_101391582 | 3300010159 | Vadose Zone Soil | MLVLLVIVVLIILSLMFGGFQKGTKSGSLGGGLGPGPLAAVCTACASTSVTSGSG* |
| Ga0134082_101846481 | 3300010303 | Grasslands Soil | MVVLLVIVVLIILSLMFGGFQKGTKSGGLGPLSPSCASCVSASTQRRVLV* |
| Ga0134088_102397031 | 3300010304 | Grasslands Soil | MLVLLLIVVLIILSLMFGGFQKGTKSGGLGPPGPLCTTCV* |
| Ga0134064_101937421 | 3300010325 | Grasslands Soil | MLVLLLVVVLIILSLMFGGFQKGTKSGSLGPMAPLCTTCTSAPTAPGQEG* |
| Ga0134065_101793152 | 3300010326 | Grasslands Soil | MLVLLLIVVLIILSLMFGGFQKGTKSSGLGPMTPLCATCTSEPMTD* |
| Ga0134111_105263311 | 3300010329 | Grasslands Soil | MLVLLVIVVLIILSLMFGGFQKGTRSGSVGPLGPLCTACV* |
| Ga0126376_108765442 | 3300010359 | Tropical Forest Soil | MLVLLLIVVLIILSLMFGGFQKGTKSSGLGPMTPLCTTCTSEPTTD* |
| Ga0126376_117420391 | 3300010359 | Tropical Forest Soil | MLVLLLIVALIILSLMFGGFQKGTKSGGLGPMTPLCTACV* |
| Ga0134066_100642312 | 3300010364 | Grasslands Soil | MVVLLVIVVLIILSLMFGGFQKGTKSGSLGPMAPLCTTCTSAPTAPGQEG* |
| Ga0126379_103633652 | 3300010366 | Tropical Forest Soil | VLVLLLIVVLIILSLMFGGFQKGTKSSGLAPWCTACVSAAEYGLH* |
| Ga0134125_111683822 | 3300010371 | Terrestrial Soil | LLVIVVLIVLSLMFGGFQKGTKSGGLGPMTPSCTACT |
| Ga0134128_132111912 | 3300010373 | Terrestrial Soil | IVVLIILSLMFGGFQKGTKSGSLGGGLGSGPGPLAAVCTACASTSVTSGSG* |
| Ga0134121_102020063 | 3300010401 | Terrestrial Soil | LIVVLIILSLMFGGFQKGTKSGGLGPMTPSCTACTSAPMND* |
| Ga0137364_103309661 | 3300012198 | Vadose Zone Soil | MVVLLVIVVLIILSLMFGGFQKGTKSGSLGPMASLCTTCTSAPIAPGQEG* |
| Ga0137383_101256303 | 3300012199 | Vadose Zone Soil | VLVLLAIVVLVILSLMFGGFQKGTKSGGLAPLVPVCAACTSALMAPAQGG* |
| Ga0137383_107580612 | 3300012199 | Vadose Zone Soil | MLVLLVIVVLIILSLMFGGFQKGTKSGSLGPMTPLCTACV* |
| Ga0137382_107836211 | 3300012200 | Vadose Zone Soil | MLVLLVIVVLIILSLMFGGFQKGTKSGSLGPLGPSCTACV* |
| Ga0137365_100631015 | 3300012201 | Vadose Zone Soil | MVVLLVIVVLIILSLMFGGFQKGTKSGSLGPMAPLCTACASAPATHPPARAIS* |
| Ga0137365_106450072 | 3300012201 | Vadose Zone Soil | MVVLLVIVVLIILSLMFGGFQKGTKSGSLGPMAPLCTTCTSTPIAIGQEG* |
| Ga0137363_103809182 | 3300012202 | Vadose Zone Soil | VLVLLVIVVLVILSLMFGGFQKGTKSGSLGGDLGPGPLAAVCTACASTSVTSGSG* |
| Ga0137399_107325812 | 3300012203 | Vadose Zone Soil | VLVLLVIVVLVILSLMFGGFQKGTKSGSLGGGLGPGPLAAVCTACASTSVTSGSG* |
| Ga0137399_117418301 | 3300012203 | Vadose Zone Soil | GGCLVLVLLVIVVLVILSLMFGGFQKGTKSGSLGPLAPLCTACTSAPPLLALRGPNGLPA |
| Ga0137362_104973892 | 3300012205 | Vadose Zone Soil | VLVLLVIVVLVILSLMFGGFQKGTKSGSLGGGLGPGPLATVCTACASTSVTSGSG* |
| Ga0137381_108016952 | 3300012207 | Vadose Zone Soil | MLVLLLIVVLIILSLMFGGFQKGTKSGSLGPMAPLCTACASAPATHPPARAIS* |
| Ga0137376_102592591 | 3300012208 | Vadose Zone Soil | MVVLLVIVVLIILSLMFGGFQKGTKSGSLGPMAPLCTTCTSAPIAIGQEG* |
| Ga0137376_104604173 | 3300012208 | Vadose Zone Soil | MLVLLLIVVLIILSLMFGGFQKGTKSGSLGPLRPPCAECT |
| Ga0137376_114559222 | 3300012208 | Vadose Zone Soil | MLVLLVIVVLIILSLMFGGFQKGTKSGSLGPLRPPCAECT |
| Ga0137378_114777821 | 3300012210 | Vadose Zone Soil | VLVLLAIVVLVILSLMFGGFQKGTKSGGLAPLVPV |
| Ga0137386_111172412 | 3300012351 | Vadose Zone Soil | MLVLLLIVVLIILSLMFGGFQKGTKPGGLAPVCAMCTSAPIAPGQGGPAAAVSGIELQRY |
| Ga0137367_100462484 | 3300012353 | Vadose Zone Soil | MVVLLVIVVLIILSLMFGGFQKGIKSGSLGPMAPLCTACASAPATHPPARAIS* |
| Ga0137371_103222891 | 3300012356 | Vadose Zone Soil | MLVLLVIVVLIILSLMFGGCQKGTKSGGLGPRTTMCTACF* |
| Ga0137371_107639652 | 3300012356 | Vadose Zone Soil | MLVLLVIVVLIILSLMFGGFQKGTKSGGLGPTTPSCTACV* |
| Ga0137375_101506515 | 3300012360 | Vadose Zone Soil | MVVLLVIVVLIILSLMFGGFQKGTKSGSLGPMAPLCTACASAPTTHPPARAIS* |
| Ga0157321_10207482 | 3300012487 | Arabidopsis Rhizosphere | MLVLLLIVVLIILSLMFGGFQKGTKSGGLGPMTPSCTACTSAPM |
| Ga0157335_10122861 | 3300012492 | Arabidopsis Rhizosphere | MLVLRLIVVLIILSLMFGSFQKGTKSSGLGPMTPSCTACTSAPMN |
| Ga0157342_10032861 | 3300012507 | Arabidopsis Rhizosphere | MLVLLLIVVLIILSLMFGGFQKGTKSGGIGPMTPLCTTCTSAPMTD* |
| Ga0137397_113042802 | 3300012685 | Vadose Zone Soil | VLVLLVIVVLVILSLMFGGFQKGTKSGSLGHYRGPGPLGAVCTACTSTPLTPG |
| Ga0137396_101662422 | 3300012918 | Vadose Zone Soil | VLVLLVIVVLIILSLMFGGFQKGTKSGGLAPMAPLCTACV* |
| Ga0137419_115486561 | 3300012925 | Vadose Zone Soil | VLVLLVIVVLIILSLMFGGFQKGTKSGSLGPLAPLCTACTSAPPLLALRGPNGLPA* |
| Ga0137410_107923891 | 3300012944 | Vadose Zone Soil | MLVLLLIVVLIILSLMFGGFQKGTKSGSLGHYRGPGPLGAVCTACTSTPLTPGSG* |
| Ga0164301_101245201 | 3300012960 | Soil | VLVLLVIVVLIILSLMFGGFQKGTKSGSLAPLCTACTSASAKSAPARAIS* |
| Ga0164306_102053022 | 3300012988 | Soil | MLVLLLIVVLIILSLMFGGFQKGTKSGSLGAGLGPLAAVCTACISTPLTSGSG* |
| Ga0164305_116734412 | 3300012989 | Soil | MLVLLVIVVLIILSLMFGGFQKGTKSGGLGPMAPSCTACTSAPMND* |
| Ga0164305_122467702 | 3300012989 | Soil | MLVLLLIVVLIILSLMFGGFQKGTKSGSLAPLCTACTSASAKPAPARAIS* |
| Ga0157369_126689571 | 3300013105 | Corn Rhizosphere | LIVVLIILSLMFGGFQKGTKSGGLGPMTPLCTTCTSAPMTD* |
| Ga0157374_110419731 | 3300013296 | Miscanthus Rhizosphere | MLVLLLIVVFIILSLMFGGFQKGTKSGGLGPMAPSCTACTSAPMN |
| Ga0163162_122027732 | 3300013306 | Switchgrass Rhizosphere | MLVLLVIVVLIILSLMFGGFQKGTKSGGLGPMTPSCTACTSAPIND* |
| Ga0163163_125330413 | 3300014325 | Switchgrass Rhizosphere | LIILSLMFGGFQKGTKSGGLGPMTPLCATCTSAPMND* |
| Ga0163163_128524711 | 3300014325 | Switchgrass Rhizosphere | VLLLIVVLIILSLMLGGFQKGTKSGGLGPMAPSCTACTSAPMND* |
| Ga0157380_125314332 | 3300014326 | Switchgrass Rhizosphere | MLVLLVIVVLIILSLMFGGFQKGTKSGGLRPLRPPCAECT |
| Ga0173480_109953683 | 3300015200 | Soil | MLVLLLIVVLIILSLMFGGFQKGTKSGGLGPLGPFCTACA* |
| Ga0137403_101554004 | 3300015264 | Vadose Zone Soil | VLVLLVIVVLVILSLMFGGFQKGTKSGSLGPLRPPCAECTSVWATRAGATAIS* |
| Ga0132258_121203912 | 3300015371 | Arabidopsis Rhizosphere | VLLLIVVLIILSVMFGGFQKGTKSGGLAPLGPSCTACV* |
| Ga0132255_1048281451 | 3300015374 | Arabidopsis Rhizosphere | MLVLLLIVVLIILSLMFGGFQKGTKSGGLGPLGPLCTACMSGVDVPPMSLEHT |
| Ga0182041_106708101 | 3300016294 | Soil | MLVLLLIVVLIILSVMFGGFQKGTRSSGLGPTAPGCTARVHAANTKT |
| Ga0182037_109594142 | 3300016404 | Soil | MLVLLLVVVLIILSVMFGGFQKGTKSGGLGPVGPSA |
| Ga0187785_101673862 | 3300017947 | Tropical Peatland | MLVLLLIVALIILSLMFGGFQKGTKSGGLAPPGPLCTACV |
| Ga0187765_102887941 | 3300018060 | Tropical Peatland | MLVLLLIVALIILSLMFGGFQKGTKSSGLAPSCTACVPAARLLAGRRVCHSVGMSIF |
| Ga0173482_100361463 | 3300019361 | Soil | MLVLLVIVVLVILSLMFGGFQKGTKSGGLGRGLGQLAAVCTACTSTPLERDRS |
| Ga0193730_10186554 | 3300020002 | Soil | MLVLLLIVVLIILSLMFGGFQKGTKSGSLGHYRGPGPLGAVCTACTSTPLTPGSA |
| Ga0193730_10944822 | 3300020002 | Soil | VLVLLAIVVLIILSLMFGGFQKGTKSGSLGPPAPSCTTCTSAPPLLAL |
| Ga0193730_11345541 | 3300020002 | Soil | MLVLLLIVVLIILSLMFGGFQKGTKSSGLGPMTPLCTTCTSAPMTD |
| Ga0197907_104680982 | 3300020069 | Corn, Switchgrass And Miscanthus Rhizosphere | MLVLLLIVVLIILSLMFGGFQKGTKSGGLGPMTPSCTACTSAPIND |
| Ga0206350_110594391 | 3300020080 | Corn, Switchgrass And Miscanthus Rhizosphere | MLVLLLIVVLIILSLMFGGFQKGTKSGGLGPMTPSCTACTSAPMND |
| Ga0210407_103306251 | 3300020579 | Soil | MVVLLVIVVLIILSLMFGGFQKGTKSGSLGPLAPLCPACTSAHRSSR |
| Ga0210407_110714691 | 3300020579 | Soil | VLVLLVIVVLVILSLMFGGFQKGTKSGGLGPLSPSCTSCVSASTQRRVLV |
| Ga0210404_103232662 | 3300021088 | Soil | MVVLLVIVVLIILSLMFGGFQKGTKSGSLGPLAPLCPACTSAPPLLALGG |
| Ga0210405_101788493 | 3300021171 | Soil | MLVLLVIVVLIILSLMFGGFQKGTKSAGLGPLSPSCTSCVSASTQRRVLV |
| Ga0210408_101152512 | 3300021178 | Soil | MVVLLVIVVLIILSLMFGGFQKGTKSGSLGPLAPLCTACTSAPPLLAPRGPNS |
| Ga0210396_104826552 | 3300021180 | Soil | MLVLLVIVVLIILSLMFGGFQKGTKSGSLAPLCTTCTSALAKHAPAGAVS |
| Ga0210397_100006377 | 3300021403 | Soil | MLVLLLIVVLIILSLMFGGFQKGTKSGGLSPMAPSCTACTSAPMND |
| Ga0210397_100842894 | 3300021403 | Soil | MLVLLVIVVLIILSLMFGGFQKGTKSGSLAPLAPLCTACV |
| Ga0210397_115382121 | 3300021403 | Soil | VLVLLVIVVLVILSLMFGGFQKGTKSGGLGPLSPSC |
| Ga0210384_100987103 | 3300021432 | Soil | VLVLLAIVVLVILSLMFGGFQKGTKSGSLAPMCTACTSASVQPAPARAIS |
| Ga0210402_106930311 | 3300021478 | Soil | MVVLLVIVVLIILSLMFGGFQKGTKSGSLAPLCTTCTSALAKHAPARAVS |
| Ga0210410_102887522 | 3300021479 | Soil | MVVLLVIVVLIILSLMFGGFQKGTKSGSLGPLAPLCPACTSAPPLLALGGPNS |
| Ga0247661_10273092 | 3300024254 | Soil | MLVLLLIVVLIILSLMFGGFQKGTKSGGLGPMTPSC |
| Ga0247692_10198521 | 3300024279 | Soil | MLVLLLIVVLIILSLMFGGFQKGTKSGGLGPMTPSCTACTSAP |
| Ga0179589_100708962 | 3300024288 | Vadose Zone Soil | MLVLLLIVVLIILSLMFGGFQKGTKSGSLGRGLGLLAAVCTACTSSPLTSGSG |
| Ga0247681_10293102 | 3300024310 | Soil | MLVLLLIVVLIILSLMFGGFQKGTKSGGLGPMTPLC |
| Ga0207713_11049741 | 3300025735 | Switchgrass Rhizosphere | MLVLLLIVVLIILSLMFGGFQKGTKSGGLGPMTPSCTACTS |
| Ga0207653_100062995 | 3300025885 | Corn, Switchgrass And Miscanthus Rhizosphere | VLVLLVIVVLIILSLMFGGFQKGTKSGGLGPMTPLCTTCTSAPMTD |
| Ga0207692_104945931 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | MLVLLVIVVLIILSLMFGGFQKGTKSGSLGPLAPLCTACV |
| Ga0207692_110757211 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | MLVLLVIVVLIILSLMFGGFQKGTKSGGLGPLSPSCTSCVSPSTQRRVLV |
| Ga0207642_100951841 | 3300025899 | Miscanthus Rhizosphere | MLVLLLIVVLIILSLMFDGFQKGTKSGGLGPMTPSCTACTSAPIND |
| Ga0207684_101424644 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | VLALLAIVVLVILSLMFGGFQKGTKSGGLGPMVPLCTACTSAQATHAPAGAIS |
| Ga0207684_103831192 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MLVLLVIVVLIILSLMFGGFQKGTKSGGLGGGLGPGPLAAVCTACTPTPLTPGSGSG |
| Ga0207707_101022063 | 3300025912 | Corn Rhizosphere | MLVLLLIVVLIILSLMFGGFQKGTKSGGLGPMAPSCTACTSAPMND |
| Ga0207693_103143642 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | VLVLLVIVVLIILSLMFGGFQKGTKSGSLGGGLGSGPGPLAAVCTACASTSVTSGSG |
| Ga0207663_107791622 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | VLLLIVVLIILSLMFGGFQKGTKSGGLSAMAPSCTACTFAPMND |
| Ga0207700_103483943 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | VLLLIVVLIILSLMFGGFQKGTKSGGLGPMTPSCTACTSAPMND |
| Ga0207651_104928391 | 3300025960 | Switchgrass Rhizosphere | MLVLLLIVVLIILSLMFGGFQKGTKSGGLGRGLGP |
| Ga0207712_102799342 | 3300025961 | Switchgrass Rhizosphere | MLVLLLIVVLIILSLMFGGFQKGTKSGGLGPMTPLCTTCTSAPMTD |
| Ga0207674_111520981 | 3300026116 | Corn Rhizosphere | LLVIVVLIVLSLMFGGFQKGTKSGSLAPLVPVCATCTSAGLT |
| Ga0209472_13148262 | 3300026323 | Soil | MLVLLLIVVLIILSLMFGGFEKGTKSGGLGPMTPLCATCTSAPMNG |
| Ga0257146_10205572 | 3300026374 | Soil | MLVLLLIVVLIILSLMFGGFQKGTKSGSLGPLRPPCAECTSAWATRAGATAIS |
| Ga0257160_10620772 | 3300026489 | Soil | VLVLLVIVVLIILSLMFGGFQKGTKSGSLGPLAPLCTACA |
| Ga0209474_106246621 | 3300026550 | Soil | MVVLLVIVVLIILSLMFGGFQKGTKSGSLGPMAPLCTRCTSAPTAPGQEG |
| Ga0209577_104985781 | 3300026552 | Soil | MVVLLVIVVLIILSLMFGGFQKGTKSGSLGPMAPLCTTCTSAPTAPGQEG |
| Ga0209522_10338482 | 3300027119 | Forest Soil | VLLLIVVLIILSVMFGGFQKGTKSGGLAPLGPSCTACV |
| Ga0207981_10181092 | 3300027560 | Soil | MVVLLVIVVLIILSLMFGGFQKGTKSGGLGPPGPLCTTCV |
| Ga0209178_13331382 | 3300027725 | Agricultural Soil | MLVLLLIVVLIILSLMFGGFQKGTKSDGLSPMAPSCTACTSAPMND |
| Ga0209461_101897682 | 3300027750 | Agave | MLVLLLIVVLIILSLMFGGFQKGTKSGGLGPLGPLCTACV |
| Ga0209074_102677711 | 3300027787 | Agricultural Soil | MLVLLLIVVLIILSLMFGGFQKGTKSGGLGPMTPSCTACTSAPRND |
| Ga0307313_101866502 | 3300028715 | Soil | MLVLLLIVVLIILSLMFGGFQKGTKSGSLGRGLGPLAAVCTACTSTPLASGSG |
| Ga0307292_105309601 | 3300028811 | Soil | MLVLLLIVVLIILSLMFGGFQKGTKSGGLGPITPSCTTCTSAPLTY |
| Ga0307312_101491862 | 3300028828 | Soil | MLVLLVIVVLIILSLMFGGFQKGTKSGGLGPITPSCTTCTSAPLTY |
| Ga0170834_1018603052 | 3300031057 | Forest Soil | MVVLLVIVVLIILSLMFGGFQKGTKSGSLAPLCTTCTSALAKHAPAMAAIMV |
| Ga0308201_102091871 | 3300031091 | Soil | MLVLLLIVVLIILSLMFGGFQKGTKSGGLRPLRPPCAECTSVWATRAGATAIS |
| Ga0307498_101823292 | 3300031170 | Soil | MLVLLLIVVLIILSLMFGGFQKGTKSGGLGPLGPLCTTCTSAPMTD |
| Ga0307499_101958972 | 3300031184 | Soil | MLVLLLIVVLIILSLMFGGFQKGTKSGSIGRSLGPLAAVCTACMSTPLTSGSG |
| Ga0318516_108106351 | 3300031543 | Soil | MLVLLLIVVLIILSVMFGGFQKGTRSSGLGPTAPGCTACVHTAKSKT |
| Ga0307469_102041482 | 3300031720 | Hardwood Forest Soil | VLVLLAIVVLVILSLMFGGFQKGTKSGSLAPLCTGCTSAPAKPAPARAIS |
| Ga0307468_1001307633 | 3300031740 | Hardwood Forest Soil | MLVLLVIVVLIILSLMFGGFQKGTKSGGLGPMTPLCTTCTSAPMTD |
| Ga0318527_104875402 | 3300031859 | Soil | MLVLLLIVVLIILSVMFGGFQKGTRSSGLGPTAPGCTACVHTAKSNT |
| Ga0306925_119300652 | 3300031890 | Soil | MLVLLLIVVLIILSLMFGGFQKGARSSGLGRTVPGCTACVHTAHAET |
| Ga0310909_112527702 | 3300031947 | Soil | MLVLLLVVVLIILSVMFGGFQKGTRSSGLGPTAPGCTA |
| Ga0306926_105313813 | 3300031954 | Soil | VLILLLIVVLIILSLMFGGFQKGTRSSGLGPTAPGCTARVHAANTKT |
| Ga0308176_100931842 | 3300031996 | Soil | MVVLLVIVVLIILSLMFGGFQKGTKSGGLGAMTPLCTTCTSEPMTH |
| Ga0306922_105618391 | 3300032001 | Soil | MLVLLLVVVLIILSVMFGGFQKGTKSGGLAPPGPS |
| Ga0318506_101652682 | 3300032052 | Soil | MLVLLLIVVLIILSLMFGGFQRGARSSGLGPTAPGCTACVHTAKSKT |
| Ga0318525_103087933 | 3300032089 | Soil | MLVLLLIVVLIILSLMFGGFQKGTKSSGLAPLCSACVSATTYACAADKGAS |
| Ga0310812_101650751 | 3300032421 | Soil | MLVLLLIVVLIILSLMFGGFQKGTKSGGLGRGLGQLAAVCTACTSTPLERDRS |
| Ga0335078_118845242 | 3300032805 | Soil | MLVLLLIVALIILSLMFGGFQEGTKSSGLAPLCPACASAAK |
| Ga0335080_116582271 | 3300032828 | Soil | MLVLLLIAALIILSLMFGGFQKGTKSGGLAPAGPLCTACVKNGFAATPTF |
| Ga0335069_104306133 | 3300032893 | Soil | VLLLIVVLIVLSVMFGGFQKGTKSGGLAPLAPLATTSTSASVVDRLRALGCPFS |
| Ga0335072_106249952 | 3300032898 | Soil | MLVLLLIVVLIILSLMFGGFQKGTKSGGLGPMTPLCTTCTSAPMTN |
| Ga0335072_118004101 | 3300032898 | Soil | MLVLLVIVVLIILSLMFGGFQKGTKSGSLAPLCTTCISALATHSPAGAIS |
| Ga0335073_100656891 | 3300033134 | Soil | VVLIILSMMFGGFQKGTKSGSLGPLAPSCTACASASFTGVLG |
| Ga0335073_111570072 | 3300033134 | Soil | MLVLLLIVVLIILSLMFGGFQKGTKSGGLGPMTPLCATCTSAPMND |
| Ga0335077_110592912 | 3300033158 | Soil | MLVLLVIVVLIILSLMFGGFQKGTKSGSFAPLAPLCA |
| ⦗Top⦘ |