| Basic Information | |
|---|---|
| Family ID | F029829 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 187 |
| Average Sequence Length | 42 residues |
| Representative Sequence | MNGSRSRPPASLYVAGPFSMGYVDFYTFLIPLYGLSLGLNASE |
| Number of Associated Samples | 132 |
| Number of Associated Scaffolds | 187 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 42.01 % |
| % of genes near scaffold ends (potentially truncated) | 89.84 % |
| % of genes from short scaffolds (< 2000 bps) | 85.03 % |
| Associated GOLD sequencing projects | 122 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.45 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (61.497 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (41.176 % of family members) |
| Environment Ontology (ENVO) | Unclassified (57.754 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (51.337 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 43.66% β-sheet: 0.00% Coil/Unstructured: 56.34% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.45 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 187 Family Scaffolds |
|---|---|---|
| PF07690 | MFS_1 | 13.37 |
| PF01724 | DUF29 | 9.09 |
| PF00496 | SBP_bac_5 | 2.14 |
| PF07969 | Amidohydro_3 | 2.14 |
| PF00753 | Lactamase_B | 2.14 |
| PF08450 | SGL | 1.60 |
| PF00144 | Beta-lactamase | 1.60 |
| PF02558 | ApbA | 1.60 |
| PF13649 | Methyltransf_25 | 1.07 |
| PF00561 | Abhydrolase_1 | 1.07 |
| PF07366 | SnoaL | 1.07 |
| PF07687 | M20_dimer | 1.07 |
| PF01381 | HTH_3 | 1.07 |
| PF00383 | dCMP_cyt_deam_1 | 1.07 |
| PF01042 | Ribonuc_L-PSP | 1.07 |
| PF02515 | CoA_transf_3 | 0.53 |
| PF00536 | SAM_1 | 0.53 |
| PF13924 | Lipocalin_5 | 0.53 |
| PF00346 | Complex1_49kDa | 0.53 |
| PF00083 | Sugar_tr | 0.53 |
| PF05973 | Gp49 | 0.53 |
| PF00441 | Acyl-CoA_dh_1 | 0.53 |
| PF07883 | Cupin_2 | 0.53 |
| PF02518 | HATPase_c | 0.53 |
| PF13683 | rve_3 | 0.53 |
| PF12681 | Glyoxalase_2 | 0.53 |
| PF03706 | LPG_synthase_TM | 0.53 |
| PF00296 | Bac_luciferase | 0.53 |
| PF00355 | Rieske | 0.53 |
| PF00005 | ABC_tran | 0.53 |
| PF01906 | YbjQ_1 | 0.53 |
| PF02826 | 2-Hacid_dh_C | 0.53 |
| PF07978 | NIPSNAP | 0.53 |
| PF02705 | K_trans | 0.53 |
| PF01522 | Polysacc_deac_1 | 0.53 |
| PF07681 | DoxX | 0.53 |
| COG ID | Name | Functional Category | % Frequency in 187 Family Scaffolds |
|---|---|---|---|
| COG3391 | DNA-binding beta-propeller fold protein YncE | General function prediction only [R] | 1.60 |
| COG1680 | CubicO group peptidase, beta-lactamase class C family | Defense mechanisms [V] | 1.60 |
| COG1686 | D-alanyl-D-alanine carboxypeptidase | Cell wall/membrane/envelope biogenesis [M] | 1.60 |
| COG3386 | Sugar lactone lactonase YvrE | Carbohydrate transport and metabolism [G] | 1.60 |
| COG2367 | Beta-lactamase class A | Defense mechanisms [V] | 1.60 |
| COG0251 | Enamine deaminase RidA/Endoribonuclease Rid7C, YjgF/YER057c/UK114 family | Defense mechanisms [V] | 1.07 |
| COG2141 | Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase) | Coenzyme transport and metabolism [H] | 0.53 |
| COG4679 | Phage-related protein gp49, toxin component of the Tad-Ata toxin-antitoxin system | Defense mechanisms [V] | 0.53 |
| COG4270 | Uncharacterized membrane protein | Function unknown [S] | 0.53 |
| COG3657 | Putative component of the toxin-antitoxin plasmid stabilization module | Defense mechanisms [V] | 0.53 |
| COG3261 | Ni,Fe-hydrogenase III large subunit | Energy production and conversion [C] | 0.53 |
| COG3158 | K+ uptake protein Kup | Inorganic ion transport and metabolism [P] | 0.53 |
| COG2259 | Uncharacterized membrane protein YphA, DoxX/SURF4 family | Function unknown [S] | 0.53 |
| COG1960 | Acyl-CoA dehydrogenase related to the alkylation response protein AidB | Lipid transport and metabolism [I] | 0.53 |
| COG1804 | Crotonobetainyl-CoA:carnitine CoA-transferase CaiB and related acyl-CoA transferases | Lipid transport and metabolism [I] | 0.53 |
| COG0726 | Peptidoglycan/xylan/chitin deacetylase, PgdA/NodB/CDA1 family | Cell wall/membrane/envelope biogenesis [M] | 0.53 |
| COG0649 | NADH:ubiquinone oxidoreductase 49 kD subunit (chain D) | Energy production and conversion [C] | 0.53 |
| COG0393 | Uncharacterized pentameric protein YbjQ, UPF0145 family | Function unknown [S] | 0.53 |
| COG0392 | Predicted membrane flippase AglD2/YbhN, UPF0104 family | Cell wall/membrane/envelope biogenesis [M] | 0.53 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 61.50 % |
| Unclassified | root | N/A | 38.50 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300002245|JGIcombinedJ26739_100662828 | All Organisms → cellular organisms → Bacteria | 921 | Open in IMG/M |
| 3300004082|Ga0062384_100063113 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae | 1848 | Open in IMG/M |
| 3300004082|Ga0062384_100864958 | Not Available | 637 | Open in IMG/M |
| 3300004152|Ga0062386_101827333 | All Organisms → cellular organisms → Bacteria | 507 | Open in IMG/M |
| 3300004635|Ga0062388_101663231 | Not Available | 651 | Open in IMG/M |
| 3300005435|Ga0070714_102373673 | Not Available | 515 | Open in IMG/M |
| 3300005446|Ga0066686_10754052 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium centrosematis | 652 | Open in IMG/M |
| 3300005903|Ga0075279_10049058 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 698 | Open in IMG/M |
| 3300006086|Ga0075019_10699975 | All Organisms → cellular organisms → Bacteria | 641 | Open in IMG/M |
| 3300006175|Ga0070712_101021178 | All Organisms → cellular organisms → Bacteria | 716 | Open in IMG/M |
| 3300006176|Ga0070765_100746922 | Not Available | 924 | Open in IMG/M |
| 3300006176|Ga0070765_101251280 | Not Available | 700 | Open in IMG/M |
| 3300006176|Ga0070765_101839710 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 568 | Open in IMG/M |
| 3300006804|Ga0079221_10221594 | All Organisms → cellular organisms → Bacteria | 1053 | Open in IMG/M |
| 3300006806|Ga0079220_11307124 | Not Available | 608 | Open in IMG/M |
| 3300006871|Ga0075434_101790714 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium centrosematis | 621 | Open in IMG/M |
| 3300009176|Ga0105242_10822996 | All Organisms → cellular organisms → Bacteria | 921 | Open in IMG/M |
| 3300009400|Ga0116854_1060986 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 534 | Open in IMG/M |
| 3300009553|Ga0105249_12577579 | All Organisms → cellular organisms → Bacteria | 581 | Open in IMG/M |
| 3300010046|Ga0126384_10149445 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1796 | Open in IMG/M |
| 3300010048|Ga0126373_10708341 | Not Available | 1065 | Open in IMG/M |
| 3300010048|Ga0126373_12144345 | Not Available | 620 | Open in IMG/M |
| 3300010343|Ga0074044_10539026 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 762 | Open in IMG/M |
| 3300010359|Ga0126376_10209122 | Not Available | 1624 | Open in IMG/M |
| 3300010359|Ga0126376_13175172 | Not Available | 508 | Open in IMG/M |
| 3300010360|Ga0126372_11152427 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 797 | Open in IMG/M |
| 3300010362|Ga0126377_12577602 | Not Available | 584 | Open in IMG/M |
| 3300010366|Ga0126379_13493770 | All Organisms → cellular organisms → Bacteria | 526 | Open in IMG/M |
| 3300010373|Ga0134128_12293420 | All Organisms → cellular organisms → Bacteria | 595 | Open in IMG/M |
| 3300010375|Ga0105239_13327239 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 523 | Open in IMG/M |
| 3300010376|Ga0126381_101081576 | All Organisms → cellular organisms → Bacteria | 1158 | Open in IMG/M |
| 3300010391|Ga0136847_13606473 | All Organisms → cellular organisms → Bacteria | 1335 | Open in IMG/M |
| 3300010396|Ga0134126_10906513 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 991 | Open in IMG/M |
| 3300010398|Ga0126383_10295762 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1614 | Open in IMG/M |
| 3300012205|Ga0137362_11761871 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 506 | Open in IMG/M |
| 3300012361|Ga0137360_10355109 | All Organisms → cellular organisms → Bacteria | 1228 | Open in IMG/M |
| 3300012917|Ga0137395_11211125 | Not Available | 528 | Open in IMG/M |
| 3300012922|Ga0137394_11375735 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → unclassified Pseudomonas → Pseudomonas sp. GW460-8 | 567 | Open in IMG/M |
| 3300012924|Ga0137413_11491950 | Not Available | 549 | Open in IMG/M |
| 3300012988|Ga0164306_10608274 | All Organisms → cellular organisms → Bacteria | 857 | Open in IMG/M |
| 3300013105|Ga0157369_12008674 | All Organisms → cellular organisms → Bacteria | 587 | Open in IMG/M |
| 3300014487|Ga0182000_10102307 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 964 | Open in IMG/M |
| 3300014497|Ga0182008_10601886 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 617 | Open in IMG/M |
| 3300015242|Ga0137412_10964790 | Not Available | 613 | Open in IMG/M |
| 3300016294|Ga0182041_10491149 | All Organisms → cellular organisms → Bacteria | 1063 | Open in IMG/M |
| 3300016294|Ga0182041_11615663 | Not Available | 599 | Open in IMG/M |
| 3300016319|Ga0182033_11664652 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 578 | Open in IMG/M |
| 3300016341|Ga0182035_10161813 | All Organisms → cellular organisms → Bacteria | 1732 | Open in IMG/M |
| 3300016341|Ga0182035_10541341 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 999 | Open in IMG/M |
| 3300016341|Ga0182035_10729252 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 865 | Open in IMG/M |
| 3300016357|Ga0182032_10680709 | Not Available | 862 | Open in IMG/M |
| 3300016371|Ga0182034_10101863 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2059 | Open in IMG/M |
| 3300016387|Ga0182040_10818536 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 768 | Open in IMG/M |
| 3300016387|Ga0182040_11367909 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 599 | Open in IMG/M |
| 3300016404|Ga0182037_10071182 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2407 | Open in IMG/M |
| 3300016404|Ga0182037_10849831 | Not Available | 789 | Open in IMG/M |
| 3300016404|Ga0182037_10974811 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 738 | Open in IMG/M |
| 3300016445|Ga0182038_11201775 | Not Available | 676 | Open in IMG/M |
| 3300016445|Ga0182038_11961460 | Not Available | 530 | Open in IMG/M |
| 3300016445|Ga0182038_11978448 | Not Available | 527 | Open in IMG/M |
| 3300017942|Ga0187808_10109962 | All Organisms → cellular organisms → Bacteria | 1201 | Open in IMG/M |
| 3300018433|Ga0066667_11614160 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium centrosematis | 578 | Open in IMG/M |
| 3300020579|Ga0210407_11183292 | Not Available | 576 | Open in IMG/M |
| 3300020580|Ga0210403_10809101 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium centrosematis | 744 | Open in IMG/M |
| 3300020581|Ga0210399_10589190 | All Organisms → cellular organisms → Bacteria | 920 | Open in IMG/M |
| 3300020582|Ga0210395_10398752 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1035 | Open in IMG/M |
| 3300021178|Ga0210408_10193203 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1618 | Open in IMG/M |
| 3300021178|Ga0210408_10958949 | Not Available | 663 | Open in IMG/M |
| 3300021180|Ga0210396_10789152 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 816 | Open in IMG/M |
| 3300021180|Ga0210396_11379911 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 583 | Open in IMG/M |
| 3300021404|Ga0210389_10353842 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1153 | Open in IMG/M |
| 3300021406|Ga0210386_10402940 | All Organisms → cellular organisms → Bacteria | 1179 | Open in IMG/M |
| 3300021432|Ga0210384_11684651 | All Organisms → cellular organisms → Bacteria | 539 | Open in IMG/M |
| 3300021475|Ga0210392_10998487 | Not Available | 627 | Open in IMG/M |
| 3300021560|Ga0126371_11074701 | Not Available | 944 | Open in IMG/M |
| 3300022720|Ga0242672_1012582 | All Organisms → cellular organisms → Bacteria | 1053 | Open in IMG/M |
| 3300025916|Ga0207663_10945532 | Not Available | 690 | Open in IMG/M |
| 3300026023|Ga0207677_11566787 | All Organisms → cellular organisms → Bacteria | 609 | Open in IMG/M |
| 3300027073|Ga0208366_1014699 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium | 845 | Open in IMG/M |
| 3300027767|Ga0209655_10060073 | Not Available | 1266 | Open in IMG/M |
| 3300027824|Ga0209040_10327940 | Not Available | 735 | Open in IMG/M |
| 3300027855|Ga0209693_10159241 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1114 | Open in IMG/M |
| 3300027884|Ga0209275_10314039 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Aminicenantes → unclassified Aminicenantes → Candidatus Aminicenantes bacterium RBG_13_62_12 | 872 | Open in IMG/M |
| 3300027884|Ga0209275_10616035 | Not Available | 623 | Open in IMG/M |
| 3300029636|Ga0222749_10019545 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2792 | Open in IMG/M |
| 3300031546|Ga0318538_10103694 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1470 | Open in IMG/M |
| 3300031549|Ga0318571_10228595 | Not Available | 676 | Open in IMG/M |
| 3300031561|Ga0318528_10593495 | Not Available | 594 | Open in IMG/M |
| 3300031561|Ga0318528_10679874 | Not Available | 551 | Open in IMG/M |
| 3300031572|Ga0318515_10706492 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 533 | Open in IMG/M |
| 3300031573|Ga0310915_10015848 | All Organisms → cellular organisms → Bacteria | 4488 | Open in IMG/M |
| 3300031573|Ga0310915_10280055 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1176 | Open in IMG/M |
| 3300031640|Ga0318555_10265988 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 927 | Open in IMG/M |
| 3300031679|Ga0318561_10057678 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1961 | Open in IMG/M |
| 3300031682|Ga0318560_10096628 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1524 | Open in IMG/M |
| 3300031708|Ga0310686_117480637 | All Organisms → cellular organisms → Bacteria | 2340 | Open in IMG/M |
| 3300031719|Ga0306917_10215159 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 1460 | Open in IMG/M |
| 3300031736|Ga0318501_10089429 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1519 | Open in IMG/M |
| 3300031744|Ga0306918_10088331 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2176 | Open in IMG/M |
| 3300031744|Ga0306918_11066768 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 626 | Open in IMG/M |
| 3300031747|Ga0318502_10689274 | All Organisms → cellular organisms → Bacteria | 617 | Open in IMG/M |
| 3300031751|Ga0318494_10865542 | All Organisms → cellular organisms → Bacteria | 530 | Open in IMG/M |
| 3300031763|Ga0318537_10144754 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 884 | Open in IMG/M |
| 3300031765|Ga0318554_10373532 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 810 | Open in IMG/M |
| 3300031765|Ga0318554_10755820 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 544 | Open in IMG/M |
| 3300031768|Ga0318509_10420300 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 747 | Open in IMG/M |
| 3300031771|Ga0318546_10099293 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1907 | Open in IMG/M |
| 3300031771|Ga0318546_10785224 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 670 | Open in IMG/M |
| 3300031777|Ga0318543_10209701 | Not Available | 866 | Open in IMG/M |
| 3300031781|Ga0318547_10977270 | Not Available | 529 | Open in IMG/M |
| 3300031782|Ga0318552_10687882 | Not Available | 522 | Open in IMG/M |
| 3300031792|Ga0318529_10399356 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 640 | Open in IMG/M |
| 3300031793|Ga0318548_10518624 | Not Available | 582 | Open in IMG/M |
| 3300031794|Ga0318503_10081330 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium | 1016 | Open in IMG/M |
| 3300031797|Ga0318550_10350055 | Not Available | 716 | Open in IMG/M |
| 3300031799|Ga0318565_10284418 | All Organisms → cellular organisms → Bacteria | 804 | Open in IMG/M |
| 3300031819|Ga0318568_10123963 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1564 | Open in IMG/M |
| 3300031833|Ga0310917_10488707 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 838 | Open in IMG/M |
| 3300031846|Ga0318512_10330742 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 760 | Open in IMG/M |
| 3300031846|Ga0318512_10424456 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 669 | Open in IMG/M |
| 3300031859|Ga0318527_10095742 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0017 | 1214 | Open in IMG/M |
| 3300031860|Ga0318495_10018633 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2957 | Open in IMG/M |
| 3300031860|Ga0318495_10398287 | Not Available | 607 | Open in IMG/M |
| 3300031879|Ga0306919_10505892 | All Organisms → cellular organisms → Bacteria | 931 | Open in IMG/M |
| 3300031879|Ga0306919_10843411 | Not Available | 703 | Open in IMG/M |
| 3300031879|Ga0306919_11463030 | Not Available | 515 | Open in IMG/M |
| 3300031890|Ga0306925_10491796 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1307 | Open in IMG/M |
| 3300031890|Ga0306925_11065752 | Not Available | 819 | Open in IMG/M |
| 3300031890|Ga0306925_11730751 | All Organisms → cellular organisms → Bacteria | 602 | Open in IMG/M |
| 3300031890|Ga0306925_11783450 | Not Available | 590 | Open in IMG/M |
| 3300031890|Ga0306925_12198913 | All Organisms → cellular organisms → Bacteria | 513 | Open in IMG/M |
| 3300031896|Ga0318551_10097482 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1561 | Open in IMG/M |
| 3300031897|Ga0318520_10436966 | Not Available | 803 | Open in IMG/M |
| 3300031897|Ga0318520_10497084 | All Organisms → cellular organisms → Bacteria | 753 | Open in IMG/M |
| 3300031910|Ga0306923_10202562 | Not Available | 2269 | Open in IMG/M |
| 3300031912|Ga0306921_10030729 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 5985 | Open in IMG/M |
| 3300031912|Ga0306921_10897074 | All Organisms → cellular organisms → Bacteria | 1007 | Open in IMG/M |
| 3300031942|Ga0310916_10841698 | All Organisms → cellular organisms → Bacteria | 771 | Open in IMG/M |
| 3300031945|Ga0310913_10147645 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1623 | Open in IMG/M |
| 3300031947|Ga0310909_10138219 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1993 | Open in IMG/M |
| 3300031947|Ga0310909_10582559 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 935 | Open in IMG/M |
| 3300031947|Ga0310909_10745905 | Not Available | 811 | Open in IMG/M |
| 3300031947|Ga0310909_11030409 | Not Available | 671 | Open in IMG/M |
| 3300031947|Ga0310909_11131290 | All Organisms → cellular organisms → Bacteria | 635 | Open in IMG/M |
| 3300031954|Ga0306926_11403557 | All Organisms → cellular organisms → Bacteria | 810 | Open in IMG/M |
| 3300031954|Ga0306926_11600998 | All Organisms → cellular organisms → Bacteria | 747 | Open in IMG/M |
| 3300031954|Ga0306926_12048236 | Not Available | 642 | Open in IMG/M |
| 3300031962|Ga0307479_10384394 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1388 | Open in IMG/M |
| 3300032001|Ga0306922_12242354 | Not Available | 525 | Open in IMG/M |
| 3300032009|Ga0318563_10784308 | Not Available | 511 | Open in IMG/M |
| 3300032060|Ga0318505_10573181 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 531 | Open in IMG/M |
| 3300032063|Ga0318504_10540174 | Not Available | 559 | Open in IMG/M |
| 3300032064|Ga0318510_10004051 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3762 | Open in IMG/M |
| 3300032067|Ga0318524_10248250 | Not Available | 916 | Open in IMG/M |
| 3300032068|Ga0318553_10137481 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0017 | 1261 | Open in IMG/M |
| 3300032076|Ga0306924_11647042 | All Organisms → cellular organisms → Bacteria | 674 | Open in IMG/M |
| 3300032076|Ga0306924_11749177 | All Organisms → cellular organisms → Bacteria | 650 | Open in IMG/M |
| 3300032091|Ga0318577_10476895 | Not Available | 595 | Open in IMG/M |
| 3300032094|Ga0318540_10305756 | All Organisms → cellular organisms → Bacteria | 767 | Open in IMG/M |
| 3300032160|Ga0311301_11703281 | All Organisms → cellular organisms → Bacteria | 759 | Open in IMG/M |
| 3300032205|Ga0307472_100345301 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1219 | Open in IMG/M |
| 3300032261|Ga0306920_100891113 | Not Available | 1301 | Open in IMG/M |
| 3300032261|Ga0306920_101538668 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 948 | Open in IMG/M |
| 3300032261|Ga0306920_102448653 | Not Available | 719 | Open in IMG/M |
| 3300032261|Ga0306920_102568279 | All Organisms → cellular organisms → Bacteria | 699 | Open in IMG/M |
| 3300032261|Ga0306920_103930643 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 541 | Open in IMG/M |
| 3300032783|Ga0335079_11234989 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 750 | Open in IMG/M |
| 3300033290|Ga0318519_10125515 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 1410 | Open in IMG/M |
| 3300033412|Ga0310810_10516425 | Not Available | 1182 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 41.18% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 24.06% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 6.42% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 4.28% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 3.21% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 3.21% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.14% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.07% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.07% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 1.07% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.07% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 1.07% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.07% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Sediment | 0.53% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.53% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.53% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.53% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 0.53% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.53% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.53% |
| Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 0.53% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.53% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.53% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.53% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.53% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.53% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.53% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.53% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.53% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.53% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300004082 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3 | Environmental | Open in IMG/M |
| 3300004152 | Coassembly of ECP12_OM1, ECP12_OM2, ECP12_OM3 | Environmental | Open in IMG/M |
| 3300004635 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
| 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
| 3300005446 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 | Environmental | Open in IMG/M |
| 3300005561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 | Environmental | Open in IMG/M |
| 3300005903 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_10C_0N_303 | Environmental | Open in IMG/M |
| 3300006086 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
| 3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009400 | Soil microbial community of the Robinson Ridge, Antarctica. Combined Assembly of Gp0139162, Gp0138857, Gp0138858 | Environmental | Open in IMG/M |
| 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010343 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
| 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010391 | Freshwater sediment microbial communities from Lake Superior, USA - Station SU-17. Combined Assembly of Gp0155404, Gp0155335, Gp0155336, Gp0155336, Gp0155403, Gp0155406 | Environmental | Open in IMG/M |
| 3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
| 3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
| 3300012924 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012988 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MG | Environmental | Open in IMG/M |
| 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Host-Associated | Open in IMG/M |
| 3300014487 | Bulk soil microbial communities from Mexico - Magueyal (Ma) metaG | Environmental | Open in IMG/M |
| 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Host-Associated | Open in IMG/M |
| 3300015242 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
| 3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
| 3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
| 3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
| 3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
| 3300017942 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_3 | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
| 3300021404 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O | Environmental | Open in IMG/M |
| 3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021475 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-O | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300022720 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027073 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF010 (SPAdes) | Environmental | Open in IMG/M |
| 3300027767 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027824 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027855 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027884 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes) | Environmental | Open in IMG/M |
| 3300029636 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031543 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20 | Environmental | Open in IMG/M |
| 3300031545 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26 | Environmental | Open in IMG/M |
| 3300031546 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23 | Environmental | Open in IMG/M |
| 3300031549 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f24 | Environmental | Open in IMG/M |
| 3300031561 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26 | Environmental | Open in IMG/M |
| 3300031572 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19 | Environmental | Open in IMG/M |
| 3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
| 3300031640 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23 | Environmental | Open in IMG/M |
| 3300031679 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23 | Environmental | Open in IMG/M |
| 3300031682 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f22 | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
| 3300031736 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f21 | Environmental | Open in IMG/M |
| 3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
| 3300031747 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22 | Environmental | Open in IMG/M |
| 3300031751 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f24 | Environmental | Open in IMG/M |
| 3300031763 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f29 | Environmental | Open in IMG/M |
| 3300031765 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22 | Environmental | Open in IMG/M |
| 3300031768 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f22 | Environmental | Open in IMG/M |
| 3300031771 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19 | Environmental | Open in IMG/M |
| 3300031777 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f24 | Environmental | Open in IMG/M |
| 3300031781 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20 | Environmental | Open in IMG/M |
| 3300031782 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f20 | Environmental | Open in IMG/M |
| 3300031792 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f23 | Environmental | Open in IMG/M |
| 3300031793 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f21 | Environmental | Open in IMG/M |
| 3300031794 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f23 | Environmental | Open in IMG/M |
| 3300031797 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f23 | Environmental | Open in IMG/M |
| 3300031799 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f21 | Environmental | Open in IMG/M |
| 3300031819 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f21 | Environmental | Open in IMG/M |
| 3300031833 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178 | Environmental | Open in IMG/M |
| 3300031846 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f19 | Environmental | Open in IMG/M |
| 3300031859 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f25 | Environmental | Open in IMG/M |
| 3300031860 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f25 | Environmental | Open in IMG/M |
| 3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031896 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f19 | Environmental | Open in IMG/M |
| 3300031897 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16 | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
| 3300031945 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082 | Environmental | Open in IMG/M |
| 3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
| 3300032009 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f19 | Environmental | Open in IMG/M |
| 3300032060 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f18 | Environmental | Open in IMG/M |
| 3300032063 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f17 | Environmental | Open in IMG/M |
| 3300032064 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f17 | Environmental | Open in IMG/M |
| 3300032067 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f22 | Environmental | Open in IMG/M |
| 3300032068 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f21 | Environmental | Open in IMG/M |
| 3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
| 3300032091 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f25 | Environmental | Open in IMG/M |
| 3300032094 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f25 | Environmental | Open in IMG/M |
| 3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
| 3300033290 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15 | Environmental | Open in IMG/M |
| 3300033412 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NC | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGIcombinedJ26739_1006628281 | 3300002245 | Forest Soil | VPYAPSHPPPTIYVAGLFAMGYTEFYTFLIPLYGL |
| Ga0062384_1000631131 | 3300004082 | Bog Forest Soil | MPSLRSGPPTSLYVAGPFAQGYTEVYNFLIPLYGLSLGMS |
| Ga0062384_1008649581 | 3300004082 | Bog Forest Soil | MNASRAGPPASLYVAGPFSMGYVDFFTFLIPLYGLSRGLDASEIGI |
| Ga0062386_1018273332 | 3300004152 | Bog Forest Soil | MSDPRSQPPASLYVAGPFSMGYVDFYTFLIPLYGLSLGLGASEIG |
| Ga0062388_1016632311 | 3300004635 | Bog Forest Soil | MNASRVGPPASLYVAGPFSMGYVDFFTFLIPLYGFLIPLYGLSRGLDASEIGI |
| Ga0070714_1023736732 | 3300005435 | Agricultural Soil | MTRFQSRLPASLYVAGPFAMGYTEFYNFLIPLYGLSLGMS |
| Ga0066686_107540522 | 3300005446 | Soil | MNACRLRPPASLYVAGPFSMGYVDFFTFLIPLYALSLGFDASEIGILV |
| Ga0066699_109659343 | 3300005561 | Soil | MTPLPYRPPASIYVAGLFAMGYTEFYIFLIPLYALSLGMSA |
| Ga0075279_100490581 | 3300005903 | Rice Paddy Soil | MNSRPPRLTPLFVAAPFSMGYVDFYTFLMPLYALSLGFDATEVG |
| Ga0075019_106999751 | 3300006086 | Watersheds | LAGAAARMNRSGTQSLTALYIAAPFSMGYVDFYTFLMPLYALSLG |
| Ga0070712_1010211782 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | MNAHRLRPPASLYVAGPFSMGYVDFYTFLIPLYGLSLGLDASEIGML |
| Ga0070765_1007469221 | 3300006176 | Soil | MARFQSRLPASLYVAGPFAMGYTEFYNFLIPLYGLSLG |
| Ga0070765_1012512801 | 3300006176 | Soil | MSTAPSRPPASLYVAGPFSMGYVDFFTFLIPLYGLSL |
| Ga0070765_1018397101 | 3300006176 | Soil | MLSVRSRPPASLYVTGPFAQGYTQLYNFLVPLYGLSLG |
| Ga0079221_102215941 | 3300006804 | Agricultural Soil | MNNAHPKPPAALYVAGPFSMGYVDFFTFLIPLYGLSLGLDAVEIGILV |
| Ga0079220_113071242 | 3300006806 | Agricultural Soil | MVRFQSRLPASLYVAGSFAMGYTEFYNFLIPLYGLSL |
| Ga0075434_1017907142 | 3300006871 | Populus Rhizosphere | MNACRSRPPASLYVAGPFSMGYVDFFTFLIPLYALSLG |
| Ga0105242_108229961 | 3300009176 | Miscanthus Rhizosphere | VAGCVNRSGIRSLTALYVAAPFSMGYVDFYTFLMPLYALS |
| Ga0116854_10609861 | 3300009400 | Soil | MKAFRSSPLSSLYVAGPFSMGYVDFYTFLIPLYALSLGFDASEIGIL |
| Ga0105249_125775792 | 3300009553 | Switchgrass Rhizosphere | MNGSGTRSLTALYVAAPFSMGYVDFYTFLMPLYALSLGFDAT |
| Ga0126384_101494453 | 3300010046 | Tropical Forest Soil | VNGLHPRPPASLYVAGPFSMGYVDFYTFLIPLFGLSLGL |
| Ga0126373_107083412 | 3300010048 | Tropical Forest Soil | MNGSGTRSLTALYVAAPFSMGYVDFYTFLMPLYALSLGFDAA |
| Ga0126373_121443452 | 3300010048 | Tropical Forest Soil | MKSSSARPLTALYVAGPFSMGYVDFYTFLMPLYALSLGFD |
| Ga0074044_105390263 | 3300010343 | Bog Forest Soil | MTPRPSRLPASIYITGLFAMGYTEFYTFLIPLYGLSLGMS |
| Ga0126376_102091221 | 3300010359 | Tropical Forest Soil | MKASLPRSLPSLYVAGPFSMGYVDFHTFLIPLYGLSLGFDA |
| Ga0126376_131751722 | 3300010359 | Tropical Forest Soil | MARFQSRLPASLYIAGPFAMGHTEFYNFVIPLYGLSLGM |
| Ga0126372_111524273 | 3300010360 | Tropical Forest Soil | MNPSRSRSLASLYVAGPFSMGYVDFYTFLIPLYGLSLGFDASEVGILVG |
| Ga0126377_125776021 | 3300010362 | Tropical Forest Soil | MIGSGTRSLTALYVAAPFSMGYVDFYNFLMPLYALS |
| Ga0126379_134937702 | 3300010366 | Tropical Forest Soil | MNTFRSRPLTSLYVAGPLSMGYVDFYTFLIPLYALSLG |
| Ga0134128_122934202 | 3300010373 | Terrestrial Soil | MNGSGARPLTALYLAAPFSMGYVDFYTFLMPLYALSLGFDAAE |
| Ga0105239_133272392 | 3300010375 | Corn Rhizosphere | MKGSGTRSLTALYVAAPFSMGYVDFYTFLMPLYALSLGFDAAEVG |
| Ga0126381_1010815762 | 3300010376 | Tropical Forest Soil | MNGSGARSLTALYVAAPFSMGYVDFYTFLMPLYALSLGFDAAEV |
| Ga0136847_136064731 | 3300010391 | Freshwater Sediment | MNVSRSRPPASLYVVGPFSMGYVDFYTFLIPLYGLSLGLDASEIGILVGAR |
| Ga0134126_109065133 | 3300010396 | Terrestrial Soil | MDTTRPTPPASLYVAGPFSMGYVDFFTFLIPLYGLSLGLDAVEIGILVGARS |
| Ga0126383_102957623 | 3300010398 | Tropical Forest Soil | MNASRSRSLASLYVAGPFSMGYVDFYTFLIPLYGLSLG |
| Ga0137362_117618712 | 3300012205 | Vadose Zone Soil | MTRTQTGPPASIYVAGLFAMGYTDFYIFLIPLYGLSLGMSAGE |
| Ga0137360_103551091 | 3300012361 | Vadose Zone Soil | MSASRSRPPASLYVAGPLSMGYVDFFTFLIPLYALSLGLDASEIGI |
| Ga0137361_101632552 | 3300012362 | Vadose Zone Soil | MTPRPSRPPASIYLAGLFAMGYTEFYIFLIPLYALSLGMSAGEVG |
| Ga0137395_112111252 | 3300012917 | Vadose Zone Soil | MRTAPARPPAALYVAGPFSMGYVDFFTFLIPLYGLSLGF |
| Ga0137394_113757351 | 3300012922 | Vadose Zone Soil | MNQPRPRPLASLYVAGPFSMGYVDFYTFLIPLYGLSLGLGASEIGILV |
| Ga0137413_114919502 | 3300012924 | Vadose Zone Soil | MSASRSRPPASLYVAGPLSMGYVDFFTFLIPLYALSLGLDAS |
| Ga0137407_121216651 | 3300012930 | Vadose Zone Soil | MTPRPSRPPASIYVAGLFAMGYTDFYIFLIPLYALSLGMSAGEVG |
| Ga0164306_106082741 | 3300012988 | Soil | MNRSGTQSLTALYIAAPFSMGYVDFYTFLMPLYAL |
| Ga0157369_120086741 | 3300013105 | Corn Rhizosphere | MNGSGARPLTALYLAAPFSMGYVDFYTFPMPLYPLSLGFDAVEVGILV |
| Ga0182000_101023072 | 3300014487 | Soil | MHDIGPRQLTSLYVAGPFSMGYVDFFTFLIPLYGLSLGLDAAEIGVLVG |
| Ga0182008_106018861 | 3300014497 | Rhizosphere | MNGSGARPLSALYVAAPFSMSYVDFYTFLMPLHALSLR |
| Ga0137412_109647902 | 3300015242 | Vadose Zone Soil | MSASRSRPPASLYVAGPLSMGYVDFFTFLIPLYALSLGLDASE |
| Ga0182041_104911491 | 3300016294 | Soil | MATIRSRLPASLYVAGPFAMGYTEFYNFLIPLYGLSL |
| Ga0182041_116156631 | 3300016294 | Soil | MAIIRSRLPASLYVAGPFAMGYTEFYNFLIPLYGLSL |
| Ga0182033_101470961 | 3300016319 | Soil | MIPSPSRPPASIYIAGLFAMGYTEFYTFLIPLYGLSLGMTAGEIG |
| Ga0182033_116646522 | 3300016319 | Soil | MTTSPSRPPASVYVAGPFAMGYTEIYTFLIPLYGLSV |
| Ga0182035_101618133 | 3300016341 | Soil | MSARGSRPPVSLYVAGPFSMGYVDFFTFLIPLYALSLGLDA |
| Ga0182035_105413413 | 3300016341 | Soil | MPDFRSRPPASLYVAGPFAMGYTEFYNFLIPLYGLSLGM |
| Ga0182035_107292521 | 3300016341 | Soil | MTAGSPRPPASIYVVGPFSMGYVDFYTFLIPLYGLSLGLDASE |
| Ga0182032_106807091 | 3300016357 | Soil | MNGRRSKSLASLYIAGPLSMGYVDFYTFLIPLYTVSLGFDASEIG |
| Ga0182034_101018633 | 3300016371 | Soil | MFTRMSGSRPRPPASLYVAGPFIMGYVDFYTFLIP |
| Ga0182040_108185362 | 3300016387 | Soil | MSLSRSRPPASLYVAGPFSMGYIDFYTFLIPLYGLSLGLNASEIGILVGGR |
| Ga0182040_113679091 | 3300016387 | Soil | MNGSHPRPPASLYVAGPFSMGYVDFYTFLIPLYGLSLGLDASEI |
| Ga0182037_100711821 | 3300016404 | Soil | MFTRMSGSRPRPPASLYVAGPFSMGYVDFYTFLIPLYGL |
| Ga0182037_108498311 | 3300016404 | Soil | MAIIRSRLPASLYVAGPFAMGYTEFFNFLIPLYGLSLG |
| Ga0182037_109748111 | 3300016404 | Soil | MNGSRSRPPASLYVAGPFSMGYVDFYTFLIPLYGLSLGLNASEIGILV |
| Ga0182038_112017751 | 3300016445 | Soil | MADFRLRPPASLYVAGPFAMGYTEFYNFLIPLYGLSLGMSAGEVGMLV |
| Ga0182038_119614602 | 3300016445 | Soil | MPEFPSRPPASLYVAGPFAMGYTEFYNFLIPLYGLSL |
| Ga0182038_119784482 | 3300016445 | Soil | MVHFRSRLPASLYVAGPFAMGYTEFYNFLIPLYGLSL |
| Ga0187808_101099621 | 3300017942 | Freshwater Sediment | MPSLRSGPPASLYIAGPFSQGYTEVYNFLIPLYGLSLGMSASKIGMLV |
| Ga0066667_116141601 | 3300018433 | Grasslands Soil | MNACRLRPPASLYVAGPFSMGYVDFFTFLIPLYALSLGLDASEIGILVG |
| Ga0210407_111832922 | 3300020579 | Soil | MNASRSGSLASLYIVGPFSMGYVDFYTFLIPLYGLSLGFDAS |
| Ga0210403_108091012 | 3300020580 | Soil | MSASRSRPPASLYVAGPFSMGYVDFFTFLIPLYALSLGLDASEIGIL |
| Ga0210399_105891901 | 3300020581 | Soil | MTRFQSRLPASLYVAGPFAMGYTEFYNFLIPLYGLSL |
| Ga0210395_103987523 | 3300020582 | Soil | MTRPRAGPPASIYVAGLFAMGYTDFYIFLIPLYGLSL |
| Ga0210408_101932031 | 3300021178 | Soil | VNGSRPRPPASLYVAGPFSMGYVDFSTFLIPLFGLSLGLHASE |
| Ga0210408_109589491 | 3300021178 | Soil | MARFQSRLPASLYVAGPFAMGYTEFYNFLIPLYGLSLGMSA |
| Ga0210396_107891521 | 3300021180 | Soil | MAGVADCMNGSRIRSLTALYVAAPFSMGYVDFYTFLMPLYALSLGFDAA |
| Ga0210396_113799111 | 3300021180 | Soil | MARFRSRLPASLYVAGPFAMGYTEFYNFLIPLYGLSLGMS |
| Ga0210389_103538421 | 3300021404 | Soil | MNTARPKPPASLYLAGPFSMGYLDFFTFLIPLYGLSLGLDAVEIGILVGARSM |
| Ga0210386_104029401 | 3300021406 | Soil | MNTPRPAPPASLYVAGPFSMGYVDFFTFLIPLYGLSLRLDAVQIG |
| Ga0210384_116846511 | 3300021432 | Soil | MNTPRPKPPASLYLAGPFSMGYVDFFTFLIPLYGL |
| Ga0210392_109984871 | 3300021475 | Soil | MTRFQSRLPASLYVAGPFAMGYTEFYNFLIPLYGLS |
| Ga0126371_105767231 | 3300021560 | Tropical Forest Soil | MTLHPSRPPASIFVAGLFAMGYTQFYVFLIPLFGLS |
| Ga0126371_110747011 | 3300021560 | Tropical Forest Soil | MPEFRLRPPASLYVAGPFAMGYTEFYNFLIPLYGLSLGMSAG |
| Ga0242672_10125821 | 3300022720 | Soil | MNTPRPKPPASLYLAGPFSMGYVDFFTFLIPLYGLSLRLDAVQIGIL |
| Ga0207663_109455321 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | MNTAPSRPPASLYVAGPFSMGYVDFFTFLIPLYGLSLGFDAAEI |
| Ga0207677_115667872 | 3300026023 | Miscanthus Rhizosphere | MNGSGTRSLTALYVAAPFSMGYVDFYTFLMPLYALSL |
| Ga0208366_10146991 | 3300027073 | Forest Soil | MPRLRSRPPASLYVAGPFAMGYTEFYNFLIPLYGL |
| Ga0209655_100600733 | 3300027767 | Bog Forest Soil | MPSLRSGPPASLYVAGPFAQGYTEVYNFLIPLYGLSLGMSAGKIGMLV |
| Ga0209040_103279403 | 3300027824 | Bog Forest Soil | MPSFRSQPPASLYVAGPFAMGYTEFYNFLIPLYGL |
| Ga0209693_101592412 | 3300027855 | Soil | MNTARPKPPASLYLAGPFSMGYLDFFTFLIPLYGLSLGLDAAEIG |
| Ga0209275_103140392 | 3300027884 | Soil | MSAAPSRPPASLYVAGPFSMGYVDFFTFLIPLYGLSLGFDAVEI |
| Ga0209275_106160351 | 3300027884 | Soil | MNTARPKPPASLYLAGPFSMGYLDFFTFLIPLYGLSLGLDAVEIGILVGARSKS |
| Ga0222749_100195451 | 3300029636 | Soil | MSASRSRPPASLYVAGPFSMGYVDFFTFLIPLYALSLGLDA |
| Ga0318516_102053471 | 3300031543 | Soil | MTAGPPRPPASIYVAGLFAMGYTQFYTFLIPLYGLAVGL |
| Ga0318541_101961403 | 3300031545 | Soil | MTPGPSRPPASIYIAGLFAMGYTEFYTFLIPLYGLSLGMSAGEIGML |
| Ga0318538_100875973 | 3300031546 | Soil | MTPGPSRPPASIYIAGLFAMGYTEFYTFLIPLYGLSLV |
| Ga0318538_101036943 | 3300031546 | Soil | MPEFRSRPPASLYVAGPFAMGYTEFYNFLIPLYSLSLGM |
| Ga0318571_102285951 | 3300031549 | Soil | MPEFRSRPPASLYVAGPFAMGYTEFYNFLIPLYGLSLGMSAGKVGML |
| Ga0318528_105006102 | 3300031561 | Soil | MTPGPSRPPASIYIAGLFAMGYTEFYTFLIPLYGFSLGMS |
| Ga0318528_105934951 | 3300031561 | Soil | MAHFRSRLPASLYVAGPFAMGYTEFYNFLIPLYGLSLG |
| Ga0318528_106798741 | 3300031561 | Soil | MVRFQSRLPASLYVAGPFAMGYTEFYNFLIPLYGLSLGMSAGQIG |
| Ga0318515_107064921 | 3300031572 | Soil | MSGSRSRPPASLYVAGPFSMGYVDFYTFLIPLYGLSLGLDASEIGILV |
| Ga0310915_100158481 | 3300031573 | Soil | MSARGSRPPVSLYVAGPFSMGYVDFFTFLIPLYAL |
| Ga0310915_102800552 | 3300031573 | Soil | MSLSRSRPPASLYVAGPFSMGYIDFYTFLIPLYGLS |
| Ga0318555_101657202 | 3300031640 | Soil | MTPSPSRPPASIYITGLFAMGYTEFYTFLIPLYGLSLGMSAGEIGM |
| Ga0318555_102659881 | 3300031640 | Soil | MTAGSPRPPASIYVVGPFSMGYVDFYTFLIPLYGLSLGLDASEI |
| Ga0318561_100576782 | 3300031679 | Soil | MNASRPGSLASLYVAGPFSMGYVDFYTFLIPLYGLSLGFDASRIGILV |
| Ga0318560_100966282 | 3300031682 | Soil | MNGSRSRPPASLYVAGPFSMGYVDFYTFLIPLYGLSLGLNASE |
| Ga0310686_1174806371 | 3300031708 | Soil | MNASRSSPLTPLYVAGPFSMGYVDFYTFLIPLYGLSLGFDA |
| Ga0306917_102151591 | 3300031719 | Soil | MPEFRSRPPASLYVAGPFAMGYTEFYNFLIPLYGLSLGM |
| Ga0306917_112773472 | 3300031719 | Soil | MTPSPSRPPASIYIAGLFAMGYTEFYTFLIPLYGFSLGMSA |
| Ga0318501_100894293 | 3300031736 | Soil | MAHFRSRLPASLYVAGPFAMGYTEYYNFLIPLYGLSLGMSASQIG |
| Ga0306918_100883311 | 3300031744 | Soil | MNGSHPRPPASLYVAGPFSMGYVDFYTFLIPLYGLSLGLDASEIGILVGGR |
| Ga0306918_110667682 | 3300031744 | Soil | MTARAPRPPASMCVVGPFSMGYVDFYTFLIPLYGLSLGLDASEIGILVGGR |
| Ga0318502_106892741 | 3300031747 | Soil | MNASRPGSLASLYVAGPFSMGYVDFYTFLIPLYGLSLGLDASRIGILV |
| Ga0318494_108655421 | 3300031751 | Soil | MKTSRSHPLTSLYVAGPFSMGYIDFYTFLMPLYAL |
| Ga0318537_101447543 | 3300031763 | Soil | MTAGSPRPPASIYVVGPFSMGYVDFYTFLIPLYGLS |
| Ga0318554_103735322 | 3300031765 | Soil | MPDFRSRPPTSLYVAGPFAMGYTEFYNFLIPLYGL |
| Ga0318554_107558201 | 3300031765 | Soil | MSVSRPRLPASLYVAGPFSMGYVDFYTFLIPLYGLLLG |
| Ga0318509_104203001 | 3300031768 | Soil | MNGSHPRPPASLYVAGPFSMGYVDFYTFLIPLYGL |
| Ga0318546_100992933 | 3300031771 | Soil | MSLSRSRPPASLYVAGQFSMGYIDFYTFLIPLYGL |
| Ga0318546_101186083 | 3300031771 | Soil | MTPGPSRPPASIYIAGLFAMGYTEFYTFLIPLYGLSLVM |
| Ga0318546_107852241 | 3300031771 | Soil | MARFRSRLPASLYVAGPFAMGYTEFYNFLIPLYGLSLGMSAGQIG |
| Ga0318543_102097011 | 3300031777 | Soil | MPEFRSRPPASLYVAGPFAMGYTEFYNFLIPLYSLSLGMS |
| Ga0318547_109772702 | 3300031781 | Soil | MNASRAGPPASLYVAGSFSMGYVDFFTFLIPLYGLSR |
| Ga0318552_106878821 | 3300031782 | Soil | MATIRSRLPASLYVAGPFAMGYTEFYNFLIPLYGLS |
| Ga0318529_102798563 | 3300031792 | Soil | MTPGPSRPPASIYIAGLFAMGYTEFYTFLIPLYGLSLGMS |
| Ga0318529_103993561 | 3300031792 | Soil | MTAGSPRPPASIYVVGPFSMGYVDFYTFLIPLYGLSLGLDASEIGILV |
| Ga0318548_105186241 | 3300031793 | Soil | MAIIRSRLPASLYVAGPFAMGYTEFYNFLIPLYGLSLGMSAGQIGM |
| Ga0318503_100813303 | 3300031794 | Soil | MARFRSRLPASLYVAGPFAMGYTEFYNFLIPLYGLSLG |
| Ga0318503_102332982 | 3300031794 | Soil | MTPSPSRPPASIYITGLFAMGYTEFYTFLIPLYGLSLGMSAGES |
| Ga0318550_103500551 | 3300031797 | Soil | MPSIRSRPPASLYVAGPFAQGYTQLYNFLVPLYGLSLGLSAGEIGML |
| Ga0318565_102844183 | 3300031799 | Soil | MTAGSPRPPASIYVVGPFSMGYVDFYTFLIPLYGLSLGLDASEIGV |
| Ga0318568_101239633 | 3300031819 | Soil | MSLSRSRPPASLYVAWPFSMGYIDFYTFLIPLYGL |
| Ga0310917_104887072 | 3300031833 | Soil | MPDFQSRPPASLYVAGPFAMGYTEFYNFLIPLYGLSLGMSAG |
| Ga0318512_103307421 | 3300031846 | Soil | MAHFRSRLPASLYVAGPFAMGYTEFYNFLIPLYGLSLGMSAGQIG |
| Ga0318512_104244561 | 3300031846 | Soil | MSLSRSRPPASLYVAGPFSMGYIDFYTFLIPLYGLSLGLNA |
| Ga0318527_100957423 | 3300031859 | Soil | MPEFRSRPPASLYVAGPFAMGYTEFYNFLIPLYGLSLGMSAG |
| Ga0318495_100186331 | 3300031860 | Soil | MNASRAGPPASLYVAGPFSMGYVDFFTFLIPLYGLSRGLDASEIGILVG |
| Ga0318495_102647502 | 3300031860 | Soil | MTRSPSRPPASIYITGLFAMGYTEFYTFLIPLYGLSLGMSA |
| Ga0318495_103982873 | 3300031860 | Soil | MPEFRSRPPASLYVAGPFAMGYTEFYNFLIPLYGLSLGMSAGEVGM |
| Ga0306919_105058922 | 3300031879 | Soil | MNASRPGSLASLYVAGPFSMGYVDFYTFLIPLYGLSLGFDASRIGI |
| Ga0306919_108434112 | 3300031879 | Soil | MAHFRSRLPASLYVAGPFAMGYTEFYNFLIPLYGL |
| Ga0306919_114630302 | 3300031879 | Soil | MVRFQSRLPASLYVAGPFAMGYTELYNFLIPLYGLSLGMSA |
| Ga0306925_104917962 | 3300031890 | Soil | MVRFQSRLPASLYVAGPFAMGYTEFYNFLIPLYGL |
| Ga0306925_110657522 | 3300031890 | Soil | MNASRTGPPASLYVAGPFSMGYVDFFTFLIPLYGLSRGLDASEIGI |
| Ga0306925_117307513 | 3300031890 | Soil | MATIRSRLPASLYVAGPFAMGYTEFYNFLIPLYGLSLGM |
| Ga0306925_117834501 | 3300031890 | Soil | MPSVRSRPPASLYVAGPFAQGYTQLYNFLVPLYGLSL |
| Ga0306925_121989131 | 3300031890 | Soil | MNVSGARPLTALYVAAPFSMGYVDFYTFLMPLYALSL |
| Ga0318551_100974822 | 3300031896 | Soil | MFTRMSGSRPRPPASLYVAGPFSMGYVDFYTFLIPLYGLSLGLDA |
| Ga0318520_104369661 | 3300031897 | Soil | MPEFRSRPPASLYVAGPFAMGYTEFYNFLIPLYGL |
| Ga0318520_104970841 | 3300031897 | Soil | MKTSRSHPLTSLYIAGPFSMGYVDFYTFLIPLYALSLGF |
| Ga0306923_102025621 | 3300031910 | Soil | MNASRAGPPASLYVAGPFSMGYVDFFTFLIPLYGLSRGLDASEIG |
| Ga0306921_100307296 | 3300031912 | Soil | MAHFRSRLPASLYVAGPFAMGYTEFYNFLIPLYGLSLGMS |
| Ga0306921_108970741 | 3300031912 | Soil | MNGSGTRSLTALYVAAPFSMGYVDFYTFLMPLYALSLG |
| Ga0306921_122758172 | 3300031912 | Soil | MTESPSRPPASVYLAGPFAMGYTEIYTFLIPLYGLSVRMTAGQ |
| Ga0310916_108416981 | 3300031942 | Soil | MPEFPSRPPASLYVAGPFAMGYTEFYNFLIPLYGLSLGM |
| Ga0310913_101476452 | 3300031945 | Soil | MSGSRSRPPASLYVAGPFSMGYVDFYTFLIPLYGLSLGLDASEIGILVGGRS |
| Ga0310909_101382191 | 3300031947 | Soil | MPGFRSRPPASLYVAGPFAMGYTEFYNFLIPLYGLSLGMSAGEV |
| Ga0310909_104415383 | 3300031947 | Soil | MTPGPSRPPASIHVAGLFAMGYTQFYTFLIPLYGLSVGLSA |
| Ga0310909_105825591 | 3300031947 | Soil | MNGSHPRPPASLYVAGPFSMGYVDFYTFLIPLYGLSLGLDASEIGILVGGRS |
| Ga0310909_107459052 | 3300031947 | Soil | MNASRTGPPASLYVAGPFSMGYVDFFTFLIPLYGLS |
| Ga0310909_110304091 | 3300031947 | Soil | MVRFQSRLPASLYVAGPFAMGYTEFYNFLIPLYGLSLGMSAGQIGML |
| Ga0310909_111312902 | 3300031947 | Soil | MLGFRSRPPASLYVAGPFAMGYTEFYNFLIPLYGLSLGMSAGEV |
| Ga0306926_114035572 | 3300031954 | Soil | MKTSRSHPLTSLYVAGPFSMGYIDFYTFLMPLYALSLGFDASEIGIL |
| Ga0306926_116009982 | 3300031954 | Soil | MPEFPSRPPASLYVAGPFAMGYTEFYNFLIPLYGLSLGMSAGEVG |
| Ga0306926_120482361 | 3300031954 | Soil | MPAASARPPASLYVTGPFSRGCVDFFTFLIPLYGLSLGLDAGEIGVLVGAKIQFTSA |
| Ga0307479_103843941 | 3300031962 | Hardwood Forest Soil | MNASRAGPPASLYVAGPFSMGYVDFFTFLIPLYGLSRGLDASEI |
| Ga0306922_122423541 | 3300032001 | Soil | MLGFRSRPPASLYVAGPFAMGYTEFYNFLIPLYGLSL |
| Ga0318563_107843082 | 3300032009 | Soil | MPEFRSRPPASLYVAGPFAMGYTEFYNFLIPLYGLSLGMSAGEVGML |
| Ga0318505_105731811 | 3300032060 | Soil | MSGSRPRPPASLYVAGPFSMGYVDFYTFLIPLYGLSLGLDASEIGIL |
| Ga0318504_105401741 | 3300032063 | Soil | MPSVRSRPPASLYVAGPFAQGYTQLYNFLVPLYGLSLGL |
| Ga0318510_100040515 | 3300032064 | Soil | MNASRPRSLASLYVAGPFSMGYVDFYTFLIPLYGLS |
| Ga0318524_102482501 | 3300032067 | Soil | MNRSGTRSLAALYVAAPFSMGYVDFYTFLMPLYAL |
| Ga0318553_101374813 | 3300032068 | Soil | MPEFRSRPPASLYVAGPFAMGYTEFYNFLIPLYSLSLGMSAG |
| Ga0306924_116470423 | 3300032076 | Soil | MLGFRSRPPASLYVAGPFAMGYTEFYNFLIPLYDLSL |
| Ga0306924_117491771 | 3300032076 | Soil | MATIRSRLPASLYVAGPFAMGYTEFYNFLIPLYGLSLGMSA |
| Ga0318577_104768951 | 3300032091 | Soil | MPSVRSRPPASLYVAGPFAQGYTQLYNFLVPLYGLSLGLSAGEI |
| Ga0318540_103057562 | 3300032094 | Soil | MARFRSRLPASLYVAGPFAMGYTEFYNFLIPLYGLSLGM |
| Ga0311301_117032811 | 3300032160 | Peatlands Soil | MNASRSGSFASLYVAGPLSMGYVDFYTFLIPLYGLSLGFD |
| Ga0307472_1003453012 | 3300032205 | Hardwood Forest Soil | MNASRAGPPASLYVAGPFSMGYVDFFTFLIPLYGLSLGLDAVEIGILVGAR |
| Ga0306920_1004513913 | 3300032261 | Soil | MTHAPPRAPASIYVAGLFAMGYTEFYIFLIPLYGL |
| Ga0306920_1008911131 | 3300032261 | Soil | MPDFRSRPSASLYVGPFAMGYTEFYNFLIPLYGLSLGMSAGEVGML |
| Ga0306920_1015386681 | 3300032261 | Soil | MTPPPAHPPASIYVAGPFSMGYVDFYTFLIPLYGLSLGLD |
| Ga0306920_1024486533 | 3300032261 | Soil | MNASRSRSLISLYVAGPFSMGYVDFYTFLIPLYGLSLG |
| Ga0306920_1025682791 | 3300032261 | Soil | MKTSRSHPLTSLYVAGPFSMGYLDFYTFLIPLYALSLGFDASEIGIL |
| Ga0306920_1039306432 | 3300032261 | Soil | MTTSPSRPPASVYVAGPFAMGYTEIYTFLIPLYGL |
| Ga0335079_112349891 | 3300032783 | Soil | MHASVTRPLTALYVAGPFSMGYADFYTFLMPLYALSLGFDAAE |
| Ga0318519_101255153 | 3300033290 | Soil | MARFRSRLPASLYVAGPFAMGYTEFYNFLIPLYGLSLGMSAGQI |
| Ga0310810_105164254 | 3300033412 | Soil | MSEVSSRPPAALYAAGPFSMGYVDFFTFLIPLYGLSLGL |
| ⦗Top⦘ |