| Basic Information | |
|---|---|
| Family ID | F029717 |
| Family Type | Metagenome |
| Number of Sequences | 187 |
| Average Sequence Length | 45 residues |
| Representative Sequence | MSGFNLDNYVDVPTRLGMALKKYPDLRIQETHREIIEMPDKSCFIR |
| Number of Associated Samples | 112 |
| Number of Associated Scaffolds | 187 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Viruses |
| % of genes with valid RBS motifs | 29.79 % |
| % of genes near scaffold ends (potentially truncated) | 99.47 % |
| % of genes from short scaffolds (< 2000 bps) | 96.79 % |
| Associated GOLD sequencing projects | 100 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.38 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Duplodnaviria (90.374 % of family members) |
| NCBI Taxonomy ID | 2731341 |
| Taxonomy | All Organisms → Viruses → Duplodnaviria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake (37.433 % of family members) |
| Environment Ontology (ENVO) | Unclassified (55.615 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (55.080 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 14.86% β-sheet: 8.11% Coil/Unstructured: 77.03% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.38 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 187 Family Scaffolds |
|---|---|---|
| PF01541 | GIY-YIG | 5.88 |
| PF01464 | SLT | 5.88 |
| PF01978 | TrmB | 0.53 |
| PF02467 | Whib | 0.53 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 98.40 % |
| Unclassified | root | N/A | 1.60 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000117|DelMOWin2010_c10089703 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1165 | Open in IMG/M |
| 3300001968|GOS2236_1001454 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 900 | Open in IMG/M |
| 3300003393|JGI25909J50240_1099947 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 576 | Open in IMG/M |
| 3300003394|JGI25907J50239_1122646 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 504 | Open in IMG/M |
| 3300004240|Ga0007787_10391692 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 692 | Open in IMG/M |
| 3300005581|Ga0049081_10146557 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 865 | Open in IMG/M |
| 3300005582|Ga0049080_10244338 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 587 | Open in IMG/M |
| 3300005582|Ga0049080_10250653 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 578 | Open in IMG/M |
| 3300006037|Ga0075465_10136276 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 556 | Open in IMG/M |
| 3300006641|Ga0075471_10601270 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 540 | Open in IMG/M |
| 3300006802|Ga0070749_10345823 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 827 | Open in IMG/M |
| 3300006805|Ga0075464_10145603 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1389 | Open in IMG/M |
| 3300006875|Ga0075473_10277629 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 678 | Open in IMG/M |
| 3300007344|Ga0070745_1344570 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 524 | Open in IMG/M |
| 3300007346|Ga0070753_1226665 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 684 | Open in IMG/M |
| 3300007520|Ga0105054_11071705 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 553 | Open in IMG/M |
| 3300007538|Ga0099851_1080374 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1255 | Open in IMG/M |
| 3300007538|Ga0099851_1203220 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 720 | Open in IMG/M |
| 3300007538|Ga0099851_1261051 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 618 | Open in IMG/M |
| 3300007538|Ga0099851_1366861 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 500 | Open in IMG/M |
| 3300007540|Ga0099847_1139744 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 724 | Open in IMG/M |
| 3300007541|Ga0099848_1143501 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 888 | Open in IMG/M |
| 3300007541|Ga0099848_1260703 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 604 | Open in IMG/M |
| 3300007541|Ga0099848_1313352 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 536 | Open in IMG/M |
| 3300007542|Ga0099846_1129679 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 916 | Open in IMG/M |
| 3300007542|Ga0099846_1184473 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 741 | Open in IMG/M |
| 3300007559|Ga0102828_1000716 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5882 | Open in IMG/M |
| 3300007559|Ga0102828_1000757 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5732 | Open in IMG/M |
| 3300007559|Ga0102828_1109620 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 675 | Open in IMG/M |
| 3300007640|Ga0070751_1307109 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 590 | Open in IMG/M |
| 3300007972|Ga0105745_1331295 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 502 | Open in IMG/M |
| 3300007974|Ga0105747_1321386 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 526 | Open in IMG/M |
| 3300009149|Ga0114918_10362350 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 797 | Open in IMG/M |
| 3300010160|Ga0114967_10154106 | All Organisms → Viruses → Predicted Viral | 1273 | Open in IMG/M |
| 3300010160|Ga0114967_10449020 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 636 | Open in IMG/M |
| 3300010354|Ga0129333_11262992 | Not Available | 611 | Open in IMG/M |
| 3300010368|Ga0129324_10175796 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 880 | Open in IMG/M |
| 3300010885|Ga0133913_10298338 | All Organisms → Viruses → Predicted Viral | 4271 | Open in IMG/M |
| 3300010885|Ga0133913_11295977 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1861 | Open in IMG/M |
| 3300011009|Ga0129318_10333879 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 525 | Open in IMG/M |
| 3300011010|Ga0139557_1053204 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 687 | Open in IMG/M |
| 3300012012|Ga0153799_1056987 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 714 | Open in IMG/M |
| 3300012013|Ga0153805_1013855 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1380 | Open in IMG/M |
| 3300012013|Ga0153805_1089411 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 523 | Open in IMG/M |
| 3300012017|Ga0153801_1091282 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 537 | Open in IMG/M |
| 3300012666|Ga0157498_1024311 | All Organisms → cellular organisms → Bacteria | 942 | Open in IMG/M |
| 3300013372|Ga0177922_10140670 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 801 | Open in IMG/M |
| 3300013372|Ga0177922_10153232 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 522 | Open in IMG/M |
| 3300013372|Ga0177922_10448166 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 623 | Open in IMG/M |
| 3300013372|Ga0177922_10622935 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 693 | Open in IMG/M |
| 3300015050|Ga0181338_1067308 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 510 | Open in IMG/M |
| 3300017699|Ga0181345_102597 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 707 | Open in IMG/M |
| 3300017707|Ga0181363_1085736 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 536 | Open in IMG/M |
| 3300017716|Ga0181350_1040888 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1254 | Open in IMG/M |
| 3300017716|Ga0181350_1134169 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 587 | Open in IMG/M |
| 3300017716|Ga0181350_1165218 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 511 | Open in IMG/M |
| 3300017722|Ga0181347_1142682 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 658 | Open in IMG/M |
| 3300017722|Ga0181347_1144854 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 651 | Open in IMG/M |
| 3300017722|Ga0181347_1145716 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 649 | Open in IMG/M |
| 3300017723|Ga0181362_1115445 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 528 | Open in IMG/M |
| 3300017736|Ga0181365_1073884 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 839 | Open in IMG/M |
| 3300017736|Ga0181365_1121157 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 627 | Open in IMG/M |
| 3300017736|Ga0181365_1139086 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 578 | Open in IMG/M |
| 3300017736|Ga0181365_1149176 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 554 | Open in IMG/M |
| 3300017736|Ga0181365_1167500 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 516 | Open in IMG/M |
| 3300017736|Ga0181365_1172608 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 507 | Open in IMG/M |
| 3300017747|Ga0181352_1099197 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 800 | Open in IMG/M |
| 3300017747|Ga0181352_1116235 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 724 | Open in IMG/M |
| 3300017747|Ga0181352_1189606 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 531 | Open in IMG/M |
| 3300017747|Ga0181352_1195740 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 521 | Open in IMG/M |
| 3300017761|Ga0181356_1155723 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 705 | Open in IMG/M |
| 3300017761|Ga0181356_1184963 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 626 | Open in IMG/M |
| 3300017761|Ga0181356_1250473 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 505 | Open in IMG/M |
| 3300017774|Ga0181358_1187667 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 683 | Open in IMG/M |
| 3300017774|Ga0181358_1219390 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 613 | Open in IMG/M |
| 3300017774|Ga0181358_1278454 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 517 | Open in IMG/M |
| 3300017774|Ga0181358_1287039 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 506 | Open in IMG/M |
| 3300017777|Ga0181357_1079141 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1259 | Open in IMG/M |
| 3300017777|Ga0181357_1085745 | All Organisms → Viruses → Predicted Viral | 1203 | Open in IMG/M |
| 3300017777|Ga0181357_1242533 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 629 | Open in IMG/M |
| 3300017777|Ga0181357_1284430 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 566 | Open in IMG/M |
| 3300017777|Ga0181357_1312585 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 530 | Open in IMG/M |
| 3300017778|Ga0181349_1112778 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1008 | Open in IMG/M |
| 3300017780|Ga0181346_1100810 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1121 | Open in IMG/M |
| 3300017780|Ga0181346_1116179 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1028 | Open in IMG/M |
| 3300017780|Ga0181346_1137899 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 922 | Open in IMG/M |
| 3300017780|Ga0181346_1202216 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 716 | Open in IMG/M |
| 3300017780|Ga0181346_1271457 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 585 | Open in IMG/M |
| 3300017780|Ga0181346_1290270 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 558 | Open in IMG/M |
| 3300017784|Ga0181348_1201840 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 713 | Open in IMG/M |
| 3300017784|Ga0181348_1231333 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 648 | Open in IMG/M |
| 3300017785|Ga0181355_1117117 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1092 | Open in IMG/M |
| 3300017785|Ga0181355_1347181 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 546 | Open in IMG/M |
| 3300019784|Ga0181359_1073013 | All Organisms → Viruses → Predicted Viral | 1296 | Open in IMG/M |
| 3300019784|Ga0181359_1142901 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 830 | Open in IMG/M |
| 3300019784|Ga0181359_1210016 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 620 | Open in IMG/M |
| 3300019784|Ga0181359_1243798 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 550 | Open in IMG/M |
| 3300019784|Ga0181359_1258181 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 524 | Open in IMG/M |
| 3300020160|Ga0211733_10531590 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 663 | Open in IMG/M |
| 3300020183|Ga0194115_10346805 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 658 | Open in IMG/M |
| 3300020198|Ga0194120_10113725 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1729 | Open in IMG/M |
| 3300020200|Ga0194121_10590357 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 534 | Open in IMG/M |
| 3300020205|Ga0211731_11668884 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 777 | Open in IMG/M |
| 3300021961|Ga0222714_10349225 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 795 | Open in IMG/M |
| 3300021962|Ga0222713_10551225 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 681 | Open in IMG/M |
| 3300021963|Ga0222712_10557618 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 668 | Open in IMG/M |
| 3300021963|Ga0222712_10585398 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 647 | Open in IMG/M |
| 3300022179|Ga0181353_1038788 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1261 | Open in IMG/M |
| 3300022179|Ga0181353_1039341 | All Organisms → Viruses → Predicted Viral | 1250 | Open in IMG/M |
| 3300022179|Ga0181353_1110423 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 667 | Open in IMG/M |
| 3300022179|Ga0181353_1135927 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 576 | Open in IMG/M |
| 3300022179|Ga0181353_1153297 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 529 | Open in IMG/M |
| 3300022190|Ga0181354_1153419 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 719 | Open in IMG/M |
| 3300022198|Ga0196905_1094196 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 804 | Open in IMG/M |
| 3300022198|Ga0196905_1157828 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 581 | Open in IMG/M |
| 3300022200|Ga0196901_1281336 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 506 | Open in IMG/M |
| 3300022407|Ga0181351_1067395 | All Organisms → Viruses → Predicted Viral | 1457 | Open in IMG/M |
| 3300022407|Ga0181351_1097751 | All Organisms → Viruses → Predicted Viral | 1140 | Open in IMG/M |
| 3300022407|Ga0181351_1165399 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 779 | Open in IMG/M |
| 3300022407|Ga0181351_1178583 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 733 | Open in IMG/M |
| 3300022929|Ga0255752_10333632 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 627 | Open in IMG/M |
| 3300022929|Ga0255752_10346341 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 608 | Open in IMG/M |
| 3300023174|Ga0214921_10361191 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 766 | Open in IMG/M |
| 3300023179|Ga0214923_10236291 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1043 | Open in IMG/M |
| 3300023179|Ga0214923_10338332 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 799 | Open in IMG/M |
| 3300024262|Ga0210003_1250760 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 699 | Open in IMG/M |
| 3300024346|Ga0244775_10570790 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 920 | Open in IMG/M |
| 3300024491|Ga0255203_1027267 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 802 | Open in IMG/M |
| 3300025543|Ga0208303_1031043 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1421 | Open in IMG/M |
| 3300025646|Ga0208161_1008970 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4278 | Open in IMG/M |
| 3300025646|Ga0208161_1148894 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 586 | Open in IMG/M |
| 3300025646|Ga0208161_1163423 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 542 | Open in IMG/M |
| 3300025674|Ga0208162_1115613 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 777 | Open in IMG/M |
| 3300025771|Ga0208427_1166407 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 719 | Open in IMG/M |
| 3300025771|Ga0208427_1247249 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 549 | Open in IMG/M |
| 3300025818|Ga0208542_1071000 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1044 | Open in IMG/M |
| 3300025889|Ga0208644_1089827 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1544 | Open in IMG/M |
| 3300025889|Ga0208644_1171539 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 972 | Open in IMG/M |
| 3300025889|Ga0208644_1197256 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 878 | Open in IMG/M |
| 3300025889|Ga0208644_1277746 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 677 | Open in IMG/M |
| 3300027121|Ga0255074_1021248 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 824 | Open in IMG/M |
| 3300027151|Ga0255063_1028218 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1149 | Open in IMG/M |
| 3300027193|Ga0208800_1034134 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 684 | Open in IMG/M |
| 3300027337|Ga0255087_1053366 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 755 | Open in IMG/M |
| 3300027608|Ga0208974_1097271 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 789 | Open in IMG/M |
| 3300027659|Ga0208975_1008865 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3532 | Open in IMG/M |
| 3300027697|Ga0209033_1065885 | All Organisms → Viruses → Predicted Viral | 1257 | Open in IMG/M |
| 3300027707|Ga0209443_1264531 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 582 | Open in IMG/M |
| 3300027732|Ga0209442_1222360 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 688 | Open in IMG/M |
| 3300027785|Ga0209246_10098155 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1147 | Open in IMG/M |
| 3300027798|Ga0209353_10270353 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 727 | Open in IMG/M |
| 3300027798|Ga0209353_10356436 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 609 | Open in IMG/M |
| 3300027808|Ga0209354_10065933 | All Organisms → Viruses → Predicted Viral | 1466 | Open in IMG/M |
| 3300027808|Ga0209354_10261426 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 693 | Open in IMG/M |
| 3300027808|Ga0209354_10303647 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 634 | Open in IMG/M |
| 3300028086|Ga0255201_1039992 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 741 | Open in IMG/M |
| 3300031565|Ga0307379_10768429 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 854 | Open in IMG/M |
| 3300031565|Ga0307379_11025599 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 701 | Open in IMG/M |
| 3300031565|Ga0307379_11647207 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 503 | Open in IMG/M |
| 3300031669|Ga0307375_10823094 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 523 | Open in IMG/M |
| 3300031673|Ga0307377_10529772 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 853 | Open in IMG/M |
| 3300031673|Ga0307377_10719062 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 700 | Open in IMG/M |
| 3300031772|Ga0315288_11194345 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 656 | Open in IMG/M |
| 3300031772|Ga0315288_11220265 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 646 | Open in IMG/M |
| 3300031834|Ga0315290_11647603 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 517 | Open in IMG/M |
| 3300031952|Ga0315294_11422381 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 547 | Open in IMG/M |
| 3300032046|Ga0315289_10508541 | Not Available | 1155 | Open in IMG/M |
| 3300032118|Ga0315277_10877257 | Not Available | 836 | Open in IMG/M |
| 3300032173|Ga0315268_11387030 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 714 | Open in IMG/M |
| 3300032516|Ga0315273_10462751 | All Organisms → Viruses → Predicted Viral | 1703 | Open in IMG/M |
| 3300033996|Ga0334979_0254517 | All Organisms → Viruses → Predicted Viral | 1014 | Open in IMG/M |
| 3300034012|Ga0334986_0150842 | All Organisms → Viruses → Predicted Viral | 1341 | Open in IMG/M |
| 3300034012|Ga0334986_0330495 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 797 | Open in IMG/M |
| 3300034064|Ga0335001_0473272 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 667 | Open in IMG/M |
| 3300034064|Ga0335001_0501799 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 644 | Open in IMG/M |
| 3300034071|Ga0335028_0137536 | All Organisms → Viruses → Predicted Viral | 1566 | Open in IMG/M |
| 3300034071|Ga0335028_0687597 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 537 | Open in IMG/M |
| 3300034071|Ga0335028_0750472 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 505 | Open in IMG/M |
| 3300034096|Ga0335025_0489013 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 622 | Open in IMG/M |
| 3300034112|Ga0335066_0258680 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1003 | Open in IMG/M |
| 3300034116|Ga0335068_0029632 | All Organisms → Viruses → Predicted Viral | 3313 | Open in IMG/M |
| 3300034117|Ga0335033_0323512 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 783 | Open in IMG/M |
| 3300034118|Ga0335053_0608095 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 628 | Open in IMG/M |
| 3300034122|Ga0335060_0593747 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 558 | Open in IMG/M |
| 3300034355|Ga0335039_0316417 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 822 | Open in IMG/M |
| 3300034356|Ga0335048_0541439 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 549 | Open in IMG/M |
| 3300034418|Ga0348337_093878 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1001 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 37.43% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 18.18% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 10.16% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 4.28% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 4.28% |
| Soil | Environmental → Terrestrial → Soil → Clay → Unclassified → Soil | 3.21% |
| Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 2.67% |
| Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 2.67% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 2.14% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 2.14% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 2.14% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 1.60% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 1.60% |
| Surface Ice | Environmental → Aquatic → Freshwater → Ice → Unclassified → Surface Ice | 1.07% |
| Deep Subsurface | Environmental → Aquatic → Marine → Oceanic → Sediment → Deep Subsurface | 1.07% |
| Estuary Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water | 1.07% |
| Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 1.07% |
| Freshwater, Surface Ice | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Surface Ice | 0.53% |
| Freshwater | Environmental → Aquatic → Freshwater → Ice → Unclassified → Freshwater | 0.53% |
| Freshwater | Environmental → Aquatic → Freshwater → Ice → Glacial Lake → Freshwater | 0.53% |
| Marine | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine | 0.53% |
| Estuarine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine | 0.53% |
| Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine | 0.53% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000117 | Marine microbial communities from Delaware Coast, sample from Delaware MO Winter December 2010 | Environmental | Open in IMG/M |
| 3300001968 | Marine microbial communities from Lake Gatun, Panama - GS020 | Environmental | Open in IMG/M |
| 3300003393 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.DD | Environmental | Open in IMG/M |
| 3300003394 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SN | Environmental | Open in IMG/M |
| 3300004240 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.SN | Environmental | Open in IMG/M |
| 3300005581 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF | Environmental | Open in IMG/M |
| 3300005582 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF | Environmental | Open in IMG/M |
| 3300006037 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006641 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006802 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 | Environmental | Open in IMG/M |
| 3300006805 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006875 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_>0.8_DNA | Environmental | Open in IMG/M |
| 3300007344 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_4 | Environmental | Open in IMG/M |
| 3300007346 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_31 | Environmental | Open in IMG/M |
| 3300007520 | Freshwater microbial communities from Lake Bonney liftoff mats and glacier meltwater in Antarctica - BON-02 (megahit assembly) | Environmental | Open in IMG/M |
| 3300007538 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_2 Viral MetaG | Environmental | Open in IMG/M |
| 3300007540 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG | Environmental | Open in IMG/M |
| 3300007541 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG | Environmental | Open in IMG/M |
| 3300007542 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG | Environmental | Open in IMG/M |
| 3300007559 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.541 | Environmental | Open in IMG/M |
| 3300007640 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_28 | Environmental | Open in IMG/M |
| 3300007972 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460ABC_3.0um | Environmental | Open in IMG/M |
| 3300007974 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460C_0.2um | Environmental | Open in IMG/M |
| 3300009149 | Deep subsurface microbial communities from Baltic Sea to uncover new lineages of life (NeLLi) - Landsort_02402 metaG | Environmental | Open in IMG/M |
| 3300010160 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130628_MF_MetaG | Environmental | Open in IMG/M |
| 3300010354 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNA | Environmental | Open in IMG/M |
| 3300010368 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_15_0.2_DNA | Environmental | Open in IMG/M |
| 3300010885 | northern Canada Lakes Co-assembly | Environmental | Open in IMG/M |
| 3300011009 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_0.1_0.8_DNA | Environmental | Open in IMG/M |
| 3300011010 | Freshwater microbial communities from Western Basin Lake Erie, Ontario, Canada - Station 970 - Surface Ice | Environmental | Open in IMG/M |
| 3300012012 | Freshwater microbial communities from Eastern Basin Lake Erie, Ontario, Canada - Station 879 - Top - Depth 1m | Environmental | Open in IMG/M |
| 3300012013 | Freshwater microbial communities from Eastern Basin Lake Erie, Ontario, Canada - Station 67 - Surface Ice | Environmental | Open in IMG/M |
| 3300012017 | Freshwater microbial communities from Central Basin Lake Erie, Ontario, Canada - Station 1208 - Top - Depth 1m | Environmental | Open in IMG/M |
| 3300012666 | Freshwater microbial communities from Central Basin Lake Erie, Ontario, Canada - Station 1208 - Surface Ice version 2 | Environmental | Open in IMG/M |
| 3300013372 | Freshwater microbial communities from Lake Erie, Ontario, Canada. Combined Assembly of 10 SPs | Environmental | Open in IMG/M |
| 3300015050 | Freshwater viral communities from Lake Michigan, USA - Sp13.VD.MM110.S.D | Environmental | Open in IMG/M |
| 3300017699 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.S.N | Environmental | Open in IMG/M |
| 3300017707 | Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MLB.S.N | Environmental | Open in IMG/M |
| 3300017716 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.DCM.D | Environmental | Open in IMG/M |
| 3300017722 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.N | Environmental | Open in IMG/M |
| 3300017723 | Freshwater viral communities from Lake Michigan, USA - Su13.ND.MM110.S.N | Environmental | Open in IMG/M |
| 3300017736 | Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MM110.D.N | Environmental | Open in IMG/M |
| 3300017747 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MLB.S.N | Environmental | Open in IMG/M |
| 3300017761 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.N | Environmental | Open in IMG/M |
| 3300017774 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.D | Environmental | Open in IMG/M |
| 3300017777 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.D.N | Environmental | Open in IMG/M |
| 3300017778 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.D | Environmental | Open in IMG/M |
| 3300017780 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.D.N | Environmental | Open in IMG/M |
| 3300017784 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.D.N | Environmental | Open in IMG/M |
| 3300017785 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.D.N | Environmental | Open in IMG/M |
| 3300019784 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.D | Environmental | Open in IMG/M |
| 3300020160 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_105 megahit1 | Environmental | Open in IMG/M |
| 3300020183 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015002 Mahale S4 surface | Environmental | Open in IMG/M |
| 3300020198 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015019 Mahale Deep Cast 65m | Environmental | Open in IMG/M |
| 3300020200 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015020 Mahale Deep Cast 50m | Environmental | Open in IMG/M |
| 3300020205 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_103 megahit1 | Environmental | Open in IMG/M |
| 3300021961 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_3D | Environmental | Open in IMG/M |
| 3300021962 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649D | Environmental | Open in IMG/M |
| 3300021963 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_657D | Environmental | Open in IMG/M |
| 3300022179 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MLB.D.N | Environmental | Open in IMG/M |
| 3300022190 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.N | Environmental | Open in IMG/M |
| 3300022198 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG (v3) | Environmental | Open in IMG/M |
| 3300022200 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG (v3) | Environmental | Open in IMG/M |
| 3300022407 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.S.D | Environmental | Open in IMG/M |
| 3300022929 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011512CT metaG | Environmental | Open in IMG/M |
| 3300023174 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1505 | Environmental | Open in IMG/M |
| 3300023179 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1510 | Environmental | Open in IMG/M |
| 3300024262 | Deep subsurface microbial communities from Baltic Sea to uncover new lineages of life (NeLLi) - Landsort_02402 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300024346 | Whole water sample coassembly | Environmental | Open in IMG/M |
| 3300024491 | Freshwater microbial communities from Mississippi River, Louisiana, United States - Miss_Colum_RepB_8h | Environmental | Open in IMG/M |
| 3300025543 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025646 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025674 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1M Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025771 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_N_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025818 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025889 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 (SPAdes) | Environmental | Open in IMG/M |
| 3300027121 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Yuk_RepC_8h | Environmental | Open in IMG/M |
| 3300027151 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Cont_RepA_0h | Environmental | Open in IMG/M |
| 3300027193 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.541 (SPAdes) | Environmental | Open in IMG/M |
| 3300027337 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Miss_RepA_8d | Environmental | Open in IMG/M |
| 3300027608 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF (SPAdes) | Environmental | Open in IMG/M |
| 3300027659 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF (SPAdes) | Environmental | Open in IMG/M |
| 3300027697 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.DN (SPAdes) | Environmental | Open in IMG/M |
| 3300027707 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM110.DCMD (SPAdes) | Environmental | Open in IMG/M |
| 3300027732 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.DD (SPAdes) | Environmental | Open in IMG/M |
| 3300027785 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SN (SPAdes) | Environmental | Open in IMG/M |
| 3300027798 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD (SPAdes) | Environmental | Open in IMG/M |
| 3300027808 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.DD (SPAdes) | Environmental | Open in IMG/M |
| 3300028086 | Freshwater microbial communities from Mississippi River, Louisiana, United States - Miss_Atlam_RepC_8h | Environmental | Open in IMG/M |
| 3300031565 | Soil microbial communities from Risofladan, Vaasa, Finland - UN-2 | Environmental | Open in IMG/M |
| 3300031669 | Soil microbial communities from Risofladan, Vaasa, Finland - TR-1 | Environmental | Open in IMG/M |
| 3300031673 | Soil microbial communities from Risofladan, Vaasa, Finland - TR-3 | Environmental | Open in IMG/M |
| 3300031772 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_20 | Environmental | Open in IMG/M |
| 3300031834 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G12_0 | Environmental | Open in IMG/M |
| 3300031952 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_40 | Environmental | Open in IMG/M |
| 3300032046 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_40 | Environmental | Open in IMG/M |
| 3300032118 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G05_15 | Environmental | Open in IMG/M |
| 3300032173 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C1_top | Environmental | Open in IMG/M |
| 3300032516 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_0 | Environmental | Open in IMG/M |
| 3300033996 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Jul2016-rr0004 | Environmental | Open in IMG/M |
| 3300034012 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Aug2017-rr0027 | Environmental | Open in IMG/M |
| 3300034064 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME14Nov2013-rr0054 | Environmental | Open in IMG/M |
| 3300034071 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Oct2008D10-rr0110 | Environmental | Open in IMG/M |
| 3300034096 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME15Oct2015-rr0098 | Environmental | Open in IMG/M |
| 3300034112 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Aug2014-rr0191 | Environmental | Open in IMG/M |
| 3300034116 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-CONTROL-GENDONOR | Environmental | Open in IMG/M |
| 3300034117 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Jun2014-rr0124 | Environmental | Open in IMG/M |
| 3300034118 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME05Aug2017-rr0165 | Environmental | Open in IMG/M |
| 3300034122 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME03Aug2014-rr0181 | Environmental | Open in IMG/M |
| 3300034355 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Oct2015-rr0135 | Environmental | Open in IMG/M |
| 3300034356 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Jun2014-rr0152 | Environmental | Open in IMG/M |
| 3300034418 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_28 (v4) | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| DelMOWin2010_100897033 | 3300000117 | Marine | MGFSLDNYVDVATRLRLAFEKYPDLRIQETAREVIEMPDKSCF |
| GOS2236_10014544 | 3300001968 | Marine | MAFSLDNYVDVPTRLRMALEKHPDLRVAETGREVV |
| JGI25909J50240_10999472 | 3300003393 | Freshwater Lake | MTGFMDNYVDVATRLKIAFERWPELRIQETHREIVEMPDKTCFIRCVVTIWRTADDP |
| JGI25907J50239_11226462 | 3300003394 | Freshwater Lake | MAIVVSGFNLDNYVDVPTRLGMALKKYPDLRIQETHREIIEMPDKSCFIRC |
| Ga0007787_103916921 | 3300004240 | Freshwater Lake | MTGFMDNYVDVATRLKMAFAKYPDLRIQETGREVIEMPDKSC |
| Ga0049081_101465574 | 3300005581 | Freshwater Lentic | MAIIVSGFNLDNYVDVPTRLGMALKKYPDLRIQETHREIIEMPDKSCFIRCTVTVWR |
| Ga0049080_102443381 | 3300005582 | Freshwater Lentic | MSYDLSNYVDVPTRLGMALQKYPDLRIQETQREIIEMPDKSCFIRCTVTVWRD |
| Ga0049080_102506531 | 3300005582 | Freshwater Lentic | MAIVVSGFNLDNYVDVPTRLGMALKKYPDLRIQETHREIIEMPDKSCFIRCTVTVWRD |
| Ga0075465_101362763 | 3300006037 | Aqueous | MAIVVTGFNLDNYVDVPTRLGMALKKYPDLRIQETHREIIEMPDKSCFIRCTVTVW |
| Ga0075471_106012703 | 3300006641 | Aqueous | MTGFNLDNYVDVPTRLGMALQKYPDLRIQETQREIIEMPD |
| Ga0070749_103458233 | 3300006802 | Aqueous | MTGFNLDNYVDVPTRLGMALQKYPDLRIQETQREIIEMPDKSCFIRCT |
| Ga0075464_101456034 | 3300006805 | Aqueous | MGFSLDNYVDVATRLQLAHAKYPEIRIQETHREVVEMPDKTCFIRCTVTVW |
| Ga0075473_102776291 | 3300006875 | Aqueous | MTGFNLDNYVDVPTRLGMALKKYPDLRIQETQREIIEMPDKSCFIRCTVTVWRDA |
| Ga0070745_13445701 | 3300007344 | Aqueous | MTGFMDNYVDVATRLKMAFAKYPDLRIQETGREVIEMPDKSCFIRCVVTIWRD |
| Ga0070753_12266653 | 3300007346 | Aqueous | MSGFNLDNYVDVPTRLGMALKKYPDLRIQETQREIIEMPDKSCFIRCTVTVWRDA |
| Ga0105054_110717053 | 3300007520 | Freshwater | MAFDLNNYVDVPTRLTLALAKYPDLRVQETDQQIVTM |
| Ga0099851_10803744 | 3300007538 | Aqueous | MSGFMDNYVEVATRLKWAFDKYPDLRIQETSREIVEMPD |
| Ga0099851_12032201 | 3300007538 | Aqueous | VTGFNLDNYVDVPTRLGMALQKYPDLRIQETQREIIEMPDKSCFIRCTVTV |
| Ga0099851_12610512 | 3300007538 | Aqueous | VTGFNLDNYVDVPTRLGMALKKYPDLRIQETQREIIEMPDKSCFIRCTVTVWRDA |
| Ga0099851_13668611 | 3300007538 | Aqueous | MSGFNLDNYVDVPTRLGMALQKYPDLRIQETQREIIEMPDKS |
| Ga0099847_11397441 | 3300007540 | Aqueous | MSGYNLDNYVDVPTRLTAALKKYPDLRIQETGREIIEMPDKSCFIRCTVTV |
| Ga0099848_11435011 | 3300007541 | Aqueous | MSGYNLDNYVDVPTRLTAALKKYPDLRIQETAREIIEMPDKSCFIRCTVTVWRDA |
| Ga0099848_12607032 | 3300007541 | Aqueous | VTGFNLDNYVDVPTRLGMALKKYPDLRIQETQREIIEMPDKSCFIRCTVTVWR |
| Ga0099848_13133521 | 3300007541 | Aqueous | MAFSLDNYVDVPTRLKAALEKYPDLSIQETAPKIVEMPDGKTFLE |
| Ga0099846_11296792 | 3300007542 | Aqueous | MTGFNLDNYVDVPTRLGMALKKYPDLRIQETQREIIEMPDKSCFIRCTVTVA* |
| Ga0099846_11844731 | 3300007542 | Aqueous | VSGYNLDNYVDVPTRLTAALKKYPDLRIQETGREI |
| Ga0102828_10007161 | 3300007559 | Estuarine | MSNFMDGYVDVATRLKLAFEKYPDLRIQETAREVVEMPDKSCFIRCTVTI |
| Ga0102828_10007571 | 3300007559 | Estuarine | MSFSLENYVDVPTRLTLALKKYPDLRIQETHRELVEMPDKSCFIRCIVTVW |
| Ga0102828_11096203 | 3300007559 | Estuarine | MDNYVDVATRLKWAFEKYPDLRIQETHREVIEMPDKSCFIR |
| Ga0070751_13071093 | 3300007640 | Aqueous | MTGFMDNYVDVATRLKMAFAKYPDLRIQETGREVIEMPDKSCFIRCVVTIWRDA |
| Ga0105745_13312951 | 3300007972 | Estuary Water | MAIVVTGFNLDNYVDVPTRLGMALKKYPDLRIQETHREIIEMPDKS |
| Ga0105747_13213861 | 3300007974 | Estuary Water | MTFSLDNYVDVPTRLGMALKKYPDLRIQETHREIIEMPDKSCFIR |
| Ga0114918_103623503 | 3300009149 | Deep Subsurface | MSGYSLENYVDVPTRLTAALKKYSDLRIQETGREIIEMPDKSCFIRCTVTVWRDA |
| Ga0114967_101541064 | 3300010160 | Freshwater Lake | MTGFMDNYVDVATRLKMAFERWPELRIQETHREVIEMPDKSCFIRCVV |
| Ga0114967_104490201 | 3300010160 | Freshwater Lake | MNNFMDNYVDVATRLKMAFERWPDLRIQETHREIIEMPDKSCFIR |
| Ga0129333_112629921 | 3300010354 | Freshwater To Marine Saline Gradient | VNLDNYVDVATRLKLALEKYPNLRVSERGHEIATF |
| Ga0129324_101757961 | 3300010368 | Freshwater To Marine Saline Gradient | MTGFNLDNYVDVPTRLGMALQKYPDLRIQETQREIIEMPDK |
| Ga0133913_102983381 | 3300010885 | Freshwater Lake | MSNFMDGYVDVATRLKLAFEKYPDLRIQETQREVIEMPDKSCFIRCTVT |
| Ga0133913_112959771 | 3300010885 | Freshwater Lake | MSFAMDNYVDVATRLQMAFKRWPELRIQETAREVIEMPDKTCFIR |
| Ga0129318_103338791 | 3300011009 | Freshwater To Marine Saline Gradient | MTGFNLDNYVDVPTRLGMALQKYPDLRIQETQREIIEMPDKSCFIRCTVTVW |
| Ga0139557_10532042 | 3300011010 | Freshwater | MGFSLDNYVDVATRLRLAFDKYPDLRIQETGREIVEMPDKSCFI |
| Ga0153799_10569871 | 3300012012 | Freshwater | VTGFNLDNYVDVPTRLGMALKKYPDLRIQETHREIIEMPDKSCFIR |
| Ga0153805_10138551 | 3300012013 | Surface Ice | MTQNFMDNYVDVATRLKIAFERWPEMRIQETAREVIEMPDKS |
| Ga0153805_10894111 | 3300012013 | Surface Ice | MSGFNLDNYVDVPTRLGMALKKYPDLRIQETHREIIEMPDKSCFIRCTVT |
| Ga0153801_10912821 | 3300012017 | Freshwater | MTGFNLDNYVDVPTRLGMALQKYPDLRIQETQREIIEMPDKSCFIRCTV |
| Ga0157498_10243111 | 3300012666 | Freshwater, Surface Ice | MMTGFNLDNYVDVPTRLGMALKKYPDLRIQETHREIIEM |
| Ga0177922_101406703 | 3300013372 | Freshwater | MSGFNLDNYVDVPTRLGMALKKYPDLRIQETHREIIEMPDKSCFIRCTVTVWRDQA |
| Ga0177922_101532323 | 3300013372 | Freshwater | MSFAMDNYVDVATRLQMAFKRWPELRIQETAREVIEMPD |
| Ga0177922_104481661 | 3300013372 | Freshwater | MAIVVSGFNLDNYVDVPTRLGMALKKYPDLRIQETHRE |
| Ga0177922_106229351 | 3300013372 | Freshwater | MTGFMDNYVDVATRLKMAFAKYPDLRIQETGREVI |
| Ga0181338_10673082 | 3300015050 | Freshwater Lake | MSGFNLDNYVDVPTRLNLALKKYPDLRIQETAREVIEMPDKSCFIRCTVTVW |
| Ga0181345_1025971 | 3300017699 | Freshwater Lake | MAIVVSGFNLDNYVDVPTRLGMALKKNPDLGIKEKHRKIIEMPEKQG |
| Ga0181363_10857363 | 3300017707 | Freshwater Lake | MAIAMSGFMDNYVDVATRLKMAFAKYPDLRIQETGREVIEMPD |
| Ga0181350_10408883 | 3300017716 | Freshwater Lake | MMTGFNLDNYVDVPTRLGMALKKYPDLRIQETHREIIEMPDKSCFIRCTVTVWRD |
| Ga0181350_11341691 | 3300017716 | Freshwater Lake | MSGFMDNYVDVATRLKWAFEKYPDLRIQETHREVIEMPDKSCFIRCV |
| Ga0181350_11652182 | 3300017716 | Freshwater Lake | MSNFMDGYLDVATRLKMAFEKYPDLRIQETHREIVEMPDKSCFIRCTVTIWRTADDL |
| Ga0181347_11426821 | 3300017722 | Freshwater Lake | MSGFNLDNYVDVPTRLGMALKKYPDLRIQETHREIIEM |
| Ga0181347_11448541 | 3300017722 | Freshwater Lake | MGFSLDNYVDVATRLQLAHAKYPEIRIQETHREIIEMPDKTC |
| Ga0181347_11457163 | 3300017722 | Freshwater Lake | MSFNLDNYVDVPTRLNLALKKYPDLRIQETAREVIEMPDKSCFIRCT |
| Ga0181362_11154451 | 3300017723 | Freshwater Lake | MSGFNLDNYVDVPTRLGMALKKYPDLRIQETHREIIEMPDKSCFIRCTV |
| Ga0181365_10738843 | 3300017736 | Freshwater Lake | MTGFNLDNYVDVPTRLSMALKKYPDLRIQETHREIIEMPDKSCFIRCTVTVW |
| Ga0181365_11211573 | 3300017736 | Freshwater Lake | MAIAVSGFNLDNYVDVPTRLGMALKKYPDLRIQETHREIIEMPDKSCFIR |
| Ga0181365_11390863 | 3300017736 | Freshwater Lake | MAIVVSGFNLDNYVDVPTRLGMALKKYPDLRIQET |
| Ga0181365_11491763 | 3300017736 | Freshwater Lake | MTGFMDNYVDVATRLKLAFERWPELRIQETHREVIEM |
| Ga0181365_11675002 | 3300017736 | Freshwater Lake | MAIVVSGFNLDNYVDVATRLKMAFERWPELRIQETHREVIEMPDKSCFIRCVVTI |
| Ga0181365_11726081 | 3300017736 | Freshwater Lake | MGFSLDNYVDVATRLQLAHAKYPEIRIQETHREVIEMPDKTCF |
| Ga0181352_10991973 | 3300017747 | Freshwater Lake | MSGFMDNYVDVATRLKMAFAKYPDLRIQETGREVIE |
| Ga0181352_11162353 | 3300017747 | Freshwater Lake | MAVAMSGFMDNYVDVATRLKMAFAKYPDLRIQETGREVIE |
| Ga0181352_11896062 | 3300017747 | Freshwater Lake | MNNFMDNYVDVATRLKMAFERWPDLRIQETHREVIEMPDK |
| Ga0181352_11957403 | 3300017747 | Freshwater Lake | VSGFNLDNYVDVPTRLGMALQKYPDLRIQETQREIIEMPDK |
| Ga0181356_11557231 | 3300017761 | Freshwater Lake | MSFAMDNYVDVATRLQMAFKRWPELRIQETAREVIEMPDKTC |
| Ga0181356_11849633 | 3300017761 | Freshwater Lake | VSGFNLDNYVDVPTRLGMALKKYPDLRIQETHREIIEMPDK |
| Ga0181356_12504733 | 3300017761 | Freshwater Lake | MSNFMDGYVDVATRLKLAFEKYPDLRIQETAREIIEMPDKSCFIRCTVTIWRTGDD |
| Ga0181358_11876673 | 3300017774 | Freshwater Lake | MSGFMDGYLDVATRLKMAFDKYPDLRIQETHREIVEMPD |
| Ga0181358_12193903 | 3300017774 | Freshwater Lake | MAIVVSGFNLDNYVDVPTRLGMALKKYPDLRIQETHREIIEMPDKSCF |
| Ga0181358_12784541 | 3300017774 | Freshwater Lake | MAIVVSGFNLDNYVDVPTRLGMALKKYPDLRIQETHREIIEMPDKSC |
| Ga0181358_12870391 | 3300017774 | Freshwater Lake | MSGFMDGYLDVATRLKMAFDKYPDLRIQETHREVVE |
| Ga0181357_10791415 | 3300017777 | Freshwater Lake | MSNFMDNYVDVATRLKWAFEKYPDLRIQETHREIIEMPDKS |
| Ga0181357_10857451 | 3300017777 | Freshwater Lake | MSNFMDGYLDVATRLKMAFDKYPDLRIQETHREIVEMPDKSCFIRC |
| Ga0181357_12425333 | 3300017777 | Freshwater Lake | MSGFMDGYLDVATRLKMAFDKYPDLRIQETHREIVEMPDK |
| Ga0181357_12844301 | 3300017777 | Freshwater Lake | MTGFNLDNYVDVPTRLVMALKKYPDLRIQETHREIIEMPD |
| Ga0181357_13125851 | 3300017777 | Freshwater Lake | MSFAMDNYVDVATRLQMAFKRWPELRIQETAREVIEMPDKTCFIRATVTIW |
| Ga0181349_11127781 | 3300017778 | Freshwater Lake | MSGFMDGYLDVATRLKMAFDKYPDLRIQETHREIVEMPDKSCFIRCTVTI |
| Ga0181346_11008101 | 3300017780 | Freshwater Lake | MSGFMDGYLDVATRLKMAFDKYPDLRIQETHREIVEMPDKSCFIRCTVTIW |
| Ga0181346_11161794 | 3300017780 | Freshwater Lake | MSGFMDGYLDVATRLKMAFDKYPDLRIQETHREIVEMPDKSCFIRCTVTIWRTAD |
| Ga0181346_11378991 | 3300017780 | Freshwater Lake | MSGFMDGYLDVATRLKMAFDKYPDLRIQETHREIVEMPDKSCFIRCT |
| Ga0181346_12022163 | 3300017780 | Freshwater Lake | MTGFMDNYVDVATRLKIAFERWPELRIQETHREIV |
| Ga0181346_12714573 | 3300017780 | Freshwater Lake | MSFAMDNYVDVATRLQMAFKRWPELRIQETAREVIEMPDKTCFIRATVTIWR |
| Ga0181346_12902701 | 3300017780 | Freshwater Lake | MSNFMDNYVDVATRLKWAFDKYPDLRIQETLREVVEMPDKSCFIRCTVTI |
| Ga0181348_12018401 | 3300017784 | Freshwater Lake | MSFSLENYVDVPTRLTLALKKYPDLRIQETHRELVEMPDKSCFIR |
| Ga0181348_12313333 | 3300017784 | Freshwater Lake | MTGFMDNYVDVATRLKWAFEKYPDLRIQETHREVIEMPDKSCFIRCVVTIWR |
| Ga0181355_11171174 | 3300017785 | Freshwater Lake | MSGFNLDNYVDVPTRLNLALKKYPDLRIQETAREVIEMPDKSCFIRCTVTVWRD |
| Ga0181355_13471811 | 3300017785 | Freshwater Lake | MGFSLDNYVDVATRLQLAHAKYPEIRIQETAREVIEMPDKTCFI |
| Ga0181359_10730134 | 3300019784 | Freshwater Lake | MAVAMTGFNLDNYVDVPTRLGMALQKYPDLRIQETH |
| Ga0181359_11429011 | 3300019784 | Freshwater Lake | MTGFNLDNYVDVPTRLGMALQKYPDLRIQETQREIIEMPDKSCFIRCTVTVWRD |
| Ga0181359_12100163 | 3300019784 | Freshwater Lake | MSGFMDGYLDVATRLKMAFDKYPDLRIQETHREIVEMPDKSCFI |
| Ga0181359_12437982 | 3300019784 | Freshwater Lake | MTGFMDNYVDVATRLKWAFEKYPDLRIQETHREVIEMPDKSCFIRC |
| Ga0181359_12581811 | 3300019784 | Freshwater Lake | VSGFNLDNYVDVPTRLGMALKKYPDLRIQETHREIIEMPDKSCFI |
| Ga0211733_105315903 | 3300020160 | Freshwater | MSFAMDNYVDVATRLQMAFKRWPELRIQETHREVIEMPDKSCFIRCVVTIWRSP |
| Ga0194115_103468051 | 3300020183 | Freshwater Lake | MTFSLDNYVDVPTRLSMAFAKYPDLRIQETLREVVKMPDESCYIRCQVTVW |
| Ga0194120_101137251 | 3300020198 | Freshwater Lake | MSFSLDNYVDVPTRLTMAFAKYPDLRIQETLREVVKMP |
| Ga0194121_105903573 | 3300020200 | Freshwater Lake | VSFSLDNYVDVPTRLTMAFAKYPDLRIQETLREVVK |
| Ga0211731_116688841 | 3300020205 | Freshwater | MSFSLENYVDVPTRLTLALKKYPDLRIQETHRELVEMPDKSCFIRCVVTVWRDSI |
| Ga0222714_103492253 | 3300021961 | Estuarine Water | MGFSLDNYVDVATRLRLAFEKYPDLRIQETAREVIEMPDKSCFIR |
| Ga0222713_105512251 | 3300021962 | Estuarine Water | MTGFNLDNYVDVPTRLGMALKKYPDLRIQETHREI |
| Ga0222712_105576181 | 3300021963 | Estuarine Water | MAIVVSGFNLDNYVDVPTRLGMALKKYPDLRIQETHREIIEMPDK |
| Ga0222712_105853983 | 3300021963 | Estuarine Water | MAIVVSGFNLDNYVDVPTRLGMALKKYPDLRIQETHREIIEMPDKS |
| Ga0181353_10387884 | 3300022179 | Freshwater Lake | MNNFMDNYVDVATRLKMAFERWPDLRIQETHREII |
| Ga0181353_10393414 | 3300022179 | Freshwater Lake | MAVAMSGFMDNYVDVATRLKMAFAKYPDLRIQETGREVIV |
| Ga0181353_11104231 | 3300022179 | Freshwater Lake | MNNFMDNYVDVATRLKMAFERWPDLRIQETHREIIEMP |
| Ga0181353_11359271 | 3300022179 | Freshwater Lake | MSGFMDNYVDVATRLKMAFAKYPDLRIQETGREVIEMPDK |
| Ga0181353_11532972 | 3300022179 | Freshwater Lake | MTGFMDNYVDVATRLKIAFERWPELRIQETHREIVEMPDKTCFIRCVVTIWRTA |
| Ga0181354_11534191 | 3300022190 | Freshwater Lake | MSGFNLDNYVDVPTRLGMALKKYPDLRIQETHREIIEMPDKSCFIRCTVTV |
| Ga0196905_10941961 | 3300022198 | Aqueous | MTGFNLDNYVDVPTRLGMALKKYPDLRIQETQREIIEMPDKSCFIRCTGD |
| Ga0196905_11578283 | 3300022198 | Aqueous | MTGFNLDNYVDVPTRLGMALKKYPDLRIQETQREIIEMPD |
| Ga0196901_12813361 | 3300022200 | Aqueous | MTGFNLDNYVDVPTRLGMALQKYPDLRIQETQREIIEMPDKSCFIRCTVTV |
| Ga0181351_10673955 | 3300022407 | Freshwater Lake | MSGFNLDNYVDVPTRLNLALKKYPDLRIQETAREVIEMPDKSCFIRCTVTVWRDH |
| Ga0181351_10977511 | 3300022407 | Freshwater Lake | MSGFMDNYVDVATRLKLAFERWPELRIQETHREVI |
| Ga0181351_11653993 | 3300022407 | Freshwater Lake | MTFAMDNYVDVATRLQMAFKRWPELRIQETGREVIEMPDKSC |
| Ga0181351_11785831 | 3300022407 | Freshwater Lake | MAIVVSGFNLDNYVDVPTRLGMALKKYPDLRIQETHREIIEMP |
| Ga0255752_103336321 | 3300022929 | Salt Marsh | MTQNFMDNYVDVATRLKIAFERWPELRIQETSREIVEMPDKSCFIRC |
| Ga0255752_103463411 | 3300022929 | Salt Marsh | MTQNFMDNYVDVATRLKIAFERWPELRIQETSREI |
| Ga0214921_103611913 | 3300023174 | Freshwater | MSGYNLDNYVDVPTRLTAALKKYPDLRIQETAREIIEMPDKSCF |
| Ga0214923_102362911 | 3300023179 | Freshwater | MSGYNLDNYVDVPTRLTAALKKYPDLRIQETAREI |
| Ga0214923_103383321 | 3300023179 | Freshwater | MDNYVDVATRLKIAFERWPELRIQETSREIVEMPDKSCFIRCTVTI |
| Ga0210003_12507601 | 3300024262 | Deep Subsurface | MGFSLDNYVDVATRLRLAFEKYPDLRIQETAREVIEMPDKSCFIRCTVTVWRNA |
| Ga0244775_105707901 | 3300024346 | Estuarine | MDGYVDVATRLKLAFDKYPDLRIQETHREVIEMPDKSCFIRCTV |
| Ga0255203_10272671 | 3300024491 | Freshwater | MSGYNLDNYVDVPTRLTEALKKYPDLRIQETGREIIEMPDKSCFIRCTVT |
| Ga0208303_10310431 | 3300025543 | Aqueous | MTGFNLDNYVDVPTRLGMALKKYPDLRIQETQREIIEMPDKSCFIRCTVTVW |
| Ga0208161_10089701 | 3300025646 | Aqueous | MSFAMDNYVDVATRLQMAFKRWPELRIQETAREVI |
| Ga0208161_11488941 | 3300025646 | Aqueous | MSFSLENYVDVPTRLTLALKKYPDLRIQETHRELVEMPDKSCFIRCIVT |
| Ga0208161_11634232 | 3300025646 | Aqueous | VTGFNLDNYVDVPTRLGMALKKYPDLRIQETQREIIEMPDKSCFIRCTVT |
| Ga0208162_11156133 | 3300025674 | Aqueous | MSGYNLDNYVDVPTRLTAALKKYPDLRIQETAREII |
| Ga0208427_11664073 | 3300025771 | Aqueous | MTGFNLDNYVDVPTRLGMALKKYPDLRIQETQREIIEMPDKSCFIRCTVTVWRD |
| Ga0208427_12472491 | 3300025771 | Aqueous | MTGFNLDNYVDVPTRLGMALKKYPDLRIQETQREI |
| Ga0208542_10710001 | 3300025818 | Aqueous | MGFSLDNYVDVATRLRLAFEKYPDLRIQETAREVVEMPDKSCFIRCTVT |
| Ga0208644_10898271 | 3300025889 | Aqueous | MGFSLDNYVDVATRLRLAFEKYPDLRIQETAREVIEMPD |
| Ga0208644_11715391 | 3300025889 | Aqueous | MTGFNLDNYVDVPTRLGMALQKYPDLRIQETQREIIEMPDKSCFIRCTVTVWRDAA |
| Ga0208644_11972563 | 3300025889 | Aqueous | MTQNFMDNYVDVATRLKTAFERWPEMRIQETAREVIEMPDKSCFIRCTVTIWRNPD |
| Ga0208644_12777463 | 3300025889 | Aqueous | MTGFMDNYVDVATRLKMAFAKYPDLRIQETGREVIEMPDKSCFIRC |
| Ga0255074_10212481 | 3300027121 | Freshwater | MAIVVSGFNLDNYVDVPTRLGMALKKYPDLRIQETHREIIE |
| Ga0255063_10282181 | 3300027151 | Freshwater | MTGFNLDNYVDVPTRLGMALKKYPDLRIQETHREIIEMPDKSC |
| Ga0208800_10341341 | 3300027193 | Estuarine | MDGYVDVATRLKLAFEKYPDLRIQETAREVVEMPDKSCFIRCTVTI |
| Ga0255087_10533661 | 3300027337 | Freshwater | MAIVVSGFNLDNYVDVPTRLGMALKKYPDLRIQETHREIIEMPDKSCFI |
| Ga0208974_10972713 | 3300027608 | Freshwater Lentic | MTGFNLDNYVDVPTRLGMALQKYPDLRIQETQREIIEMPDKSC |
| Ga0208975_10088651 | 3300027659 | Freshwater Lentic | MTGFNLDNYVDVPTRLGMALQKYPDLRIQETQREII |
| Ga0209033_10658854 | 3300027697 | Freshwater Lake | MTQNFMDNYVDVATRLKIAFERWPEMRIQETTREVVEMPDKSCFI |
| Ga0209443_12645311 | 3300027707 | Freshwater Lake | MTGFMDNYVDVATRLKIAFERWPELRIQETHREIVEMPDKTCFIRCVVTIW |
| Ga0209442_12223603 | 3300027732 | Freshwater Lake | MAIVVSGFNLDNYVDVPTRLGMALKKYPDLRIQETHREIIEMPDKSCFIRCTVTVWR |
| Ga0209246_100981551 | 3300027785 | Freshwater Lake | MTFSLDNYVDVPTRLGMALKKYPDLRIQETHREIIEMPDKSC |
| Ga0209353_102703533 | 3300027798 | Freshwater Lake | MAIVVTGFNLDNYVDVPTRLGMALKKYPDLRIQETHREIIEMPDKSC |
| Ga0209353_103564363 | 3300027798 | Freshwater Lake | VSGFNLDNYVDVPTRLGMALKKYPDLRIQETHREIIE |
| Ga0209354_100659331 | 3300027808 | Freshwater Lake | MDGYLDVATRLKMAFEKYPDLRIQETHREIVEMPDKSCFIRCTVTIWRTA |
| Ga0209354_102614261 | 3300027808 | Freshwater Lake | MTGFMDNYVDVATRLKWAFEKYPDLRIQETHREVIEMPDKSCFIRCVVTI |
| Ga0209354_103036471 | 3300027808 | Freshwater Lake | MSGFNLDNYVDVPTRLGMALKKYPDLRIQETHREII |
| Ga0255201_10399923 | 3300028086 | Freshwater | MGFSLDNYVDVATRLRLAFEKYPDLRIQETAREVIEMPDK |
| Ga0307379_107684291 | 3300031565 | Soil | MSGYNLDNYVDVPTRLTAALKKYPDLRIQETAREIIEMPDKSCFIRCTVT |
| Ga0307379_110255991 | 3300031565 | Soil | MSFSLENYVDVPTRLTLALKKYPDLRIQETAREIIEMP |
| Ga0307379_116472073 | 3300031565 | Soil | MSGYSLENYVDVPTRLTLALKKYPDLRIQETAREIVEMPDKSCFI |
| Ga0307375_108230941 | 3300031669 | Soil | MSFSLDNYVDVPTRLTLALKKYPDLRIQETAREIIEMPDKS |
| Ga0307377_105297721 | 3300031673 | Soil | MSFAMDNYVDVATRLQMAFKRWPELRIQETSREVI |
| Ga0307377_107190623 | 3300031673 | Soil | MSFAMDNYVDVATRLQMAFKRWPELRIQETSREVIEMPDK |
| Ga0315288_111943451 | 3300031772 | Sediment | MSGFNLDNYVDVPTRLGMALKKYPDLRIQETHREIIEMPDKSCFIR |
| Ga0315288_112202651 | 3300031772 | Sediment | MTFSLDNYVDVPTRLGMALKKYPDLRIQETHREIIEMPDKSCFIRCTVTV |
| Ga0315290_116476033 | 3300031834 | Sediment | MSGFNLDNYVDVPTRLGMALKKYPDLRIQETHREIIEMPDKSCF |
| Ga0315294_114223813 | 3300031952 | Sediment | MAIVVSGFNLDNYVDVPTRLSMALKKYPDLRIQETHREIIEMPDKSCFIRCTV |
| Ga0315289_105085411 | 3300032046 | Sediment | MSFNLGDYVDVRSRLQLALKKYPDLRIQETLREIV |
| Ga0315277_108772571 | 3300032118 | Sediment | MSFNLGDYVDVRSRLQLALKKYPDLRIQETLREIVEMPDKSC |
| Ga0315268_113870301 | 3300032173 | Sediment | MDNYVDVATRLKWAFEKYPELRIQETHREVIEMPDKSYFIRCVVT |
| Ga0315273_104627514 | 3300032516 | Sediment | MGFSLDNYVDVATRLQLAHAKYPEIRIQETHREVIEMPDKT |
| Ga0334979_0254517_1_120 | 3300033996 | Freshwater | MTGFNLDNYVDVPTRLGMALKKYPDLRIQETHREIVEMPD |
| Ga0334986_0150842_1224_1340 | 3300034012 | Freshwater | MSFSLENYVDVPTRLTLALKKYPDLRIQETHRELVEMPD |
| Ga0334986_0330495_659_796 | 3300034012 | Freshwater | MTGFNLDNYVDVPTRLGMALKKYPDLRIQETHREIIEMPDKSCFIR |
| Ga0335001_0473272_1_141 | 3300034064 | Freshwater | MTGFNLDNYVDVPTRLGMALKKYPDLRIQETHREIIEMPDKSCFIRC |
| Ga0335001_0501799_2_157 | 3300034064 | Freshwater | MSGFNLDNYVDVPTRLGMALKKYPDLRIQETHREIIEMPDKSCFIRCTVTVW |
| Ga0335028_0137536_1455_1565 | 3300034071 | Freshwater | MAIVVSGFNLDNYVDVPTRLGMALKKYPDLRIQETHR |
| Ga0335028_0687597_372_536 | 3300034071 | Freshwater | MAIVVSGFNLDNYVDVPTRLGMALKKYPDLRIQETQREIIEMPDKSCFIRCTVTV |
| Ga0335028_0750472_2_109 | 3300034071 | Freshwater | MTGFNLDNYVDVPTRLGMALKKYPDLRIQETHREII |
| Ga0335025_0489013_2_118 | 3300034096 | Freshwater | MTQNFMDNYVDVATRLKIAFERWPEMRIQETAREVIEMP |
| Ga0335066_0258680_842_1003 | 3300034112 | Freshwater | MNNFMDNYVDVATRLKMAFERWPDLRIQETHREIIEMPDKSCFIRCIVTIWRSP |
| Ga0335068_0029632_2_145 | 3300034116 | Freshwater | MTQNFMDNYVDVATRLKIAFDRWPEMRIQETAREVIEMPDKSCFIRCT |
| Ga0335033_0323512_3_140 | 3300034117 | Freshwater | MTGFNLDNYVDVPTRLGMALKKYPDLRIQETHRDIIEMPDKSCFIR |
| Ga0335053_0608095_489_626 | 3300034118 | Freshwater | MSFSLENYVDVPTRLTLALKKYPDLRIQETHRELVEMPDKSCFIRC |
| Ga0335060_0593747_406_558 | 3300034122 | Freshwater | MTQNFMDNYVDVATRLKIAFERWPEMRIQETAREVIEMPDKSCFIRCTVTI |
| Ga0335039_0316417_658_822 | 3300034355 | Freshwater | MTGFMDNYVDVATRLKMAFERWPELRIQETHREVIEMPDKSCFIRCVVTIWRSPE |
| Ga0335048_0541439_1_162 | 3300034356 | Freshwater | MAIVVTGFNLDNYVDVPTRLGMALKKYPDLRIQETHREIIEMPDKSCFIRCTVT |
| Ga0348337_093878_3_125 | 3300034418 | Aqueous | MTGFNLDNYVDVPTRLGMALKKYPDLRIQETQREIIEMPDK |
| ⦗Top⦘ |