NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F029563

Metagenome / Metatranscriptome Family F029563

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F029563
Family Type Metagenome / Metatranscriptome
Number of Sequences 188
Average Sequence Length 58 residues
Representative Sequence MKVYNITFVEECTSQVKIKAKTLEEAKEIVNSGDFSGDEIIERDHFQITESYEESEE
Number of Associated Samples 135
Number of Associated Scaffolds 188

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Viruses
% of genes with valid RBS motifs 67.55 %
% of genes near scaffold ends (potentially truncated) 26.60 %
% of genes from short scaffolds (< 2000 bps) 82.45 %
Associated GOLD sequencing projects 116
AlphaFold2 3D model prediction Yes
3D model pTM-score0.56

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Duplodnaviria (67.553 % of family members)
NCBI Taxonomy ID 2731341
Taxonomy All Organisms → Viruses → Duplodnaviria

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous
(22.872 % of family members)
Environment Ontology (ENVO) Unclassified
(74.468 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Saline → Water (saline)
(86.170 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 11.76%    β-sheet: 30.59%    Coil/Unstructured: 57.65%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.56
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 188 Family Scaffolds
PF13730HTH_36 1.06
PF12957DUF3846 1.06
PF03237Terminase_6N 0.53
PF00271Helicase_C 0.53
PF03592Terminase_2 0.53
PF00166Cpn10 0.53
PF137592OG-FeII_Oxy_5 0.53

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 188 Family Scaffolds
COG0234Co-chaperonin GroES (HSP10)Posttranslational modification, protein turnover, chaperones [O] 0.53
COG3728Phage terminase, small subunitMobilome: prophages, transposons [X] 0.53


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms86.17 %
UnclassifiedrootN/A13.83 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000101|DelMOSum2010_c10116872All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC024P1061Open in IMG/M
3300000101|DelMOSum2010_c10263566All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC024P534Open in IMG/M
3300000115|DelMOSum2011_c10185368All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes590Open in IMG/M
3300000116|DelMOSpr2010_c10076797All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes1336Open in IMG/M
3300000116|DelMOSpr2010_c10095533All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC024P1135Open in IMG/M
3300000116|DelMOSpr2010_c10183458All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes684Open in IMG/M
3300000116|DelMOSpr2010_c10208295All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC204P621Open in IMG/M
3300000116|DelMOSpr2010_c10233003All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes570Open in IMG/M
3300000117|DelMOWin2010_c10111791All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes974Open in IMG/M
3300000117|DelMOWin2010_c10247648All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes523Open in IMG/M
3300001450|JGI24006J15134_10134332All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes834Open in IMG/M
3300001450|JGI24006J15134_10193746All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes626Open in IMG/M
3300001460|JGI24003J15210_10009487Not Available3983Open in IMG/M
3300001846|ACM22_1077055All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes1077Open in IMG/M
3300004097|Ga0055584_101291836All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes760Open in IMG/M
3300004448|Ga0065861_1036463All Organisms → cellular organisms → Bacteria2272Open in IMG/M
3300004448|Ga0065861_1107147Not Available1687Open in IMG/M
3300004951|Ga0068513_1003198All Organisms → Viruses → Predicted Viral1718Open in IMG/M
3300005521|Ga0066862_10056515Not Available1376Open in IMG/M
3300005747|Ga0076924_1259170All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes570Open in IMG/M
3300006025|Ga0075474_10018222All Organisms → Viruses → Predicted Viral2574Open in IMG/M
3300006025|Ga0075474_10033216All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp.1806Open in IMG/M
3300006025|Ga0075474_10043209All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes1544Open in IMG/M
3300006026|Ga0075478_10104555All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes902Open in IMG/M
3300006027|Ga0075462_10094122All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes933Open in IMG/M
3300006164|Ga0075441_10107910Not Available1065Open in IMG/M
3300006403|Ga0075514_1625543All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes505Open in IMG/M
3300006735|Ga0098038_1066230Not Available1284Open in IMG/M
3300006735|Ga0098038_1097703All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes1015Open in IMG/M
3300006735|Ga0098038_1222522Not Available604Open in IMG/M
3300006735|Ga0098038_1233090Not Available586Open in IMG/M
3300006749|Ga0098042_1076925All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes868Open in IMG/M
3300006752|Ga0098048_1191165All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes605Open in IMG/M
3300006802|Ga0070749_10168217All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes1268Open in IMG/M
3300006802|Ga0070749_10290832Not Available918Open in IMG/M
3300006802|Ga0070749_10411659All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes745Open in IMG/M
3300006802|Ga0070749_10635061All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes574Open in IMG/M
3300006810|Ga0070754_10062558All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes1923Open in IMG/M
3300006810|Ga0070754_10534709All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes502Open in IMG/M
3300006869|Ga0075477_10064831All Organisms → Viruses1608Open in IMG/M
3300006874|Ga0075475_10138784All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes1073Open in IMG/M
3300006916|Ga0070750_10374798All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes597Open in IMG/M
3300006919|Ga0070746_10045311All Organisms → cellular organisms → Bacteria2311Open in IMG/M
3300006920|Ga0070748_1109112All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes1050Open in IMG/M
3300006920|Ga0070748_1278224All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes598Open in IMG/M
3300006922|Ga0098045_1079528All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes784Open in IMG/M
3300006928|Ga0098041_1018457All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae2284Open in IMG/M
3300006929|Ga0098036_1139321All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → uncultured Mediterranean phage uvDeep-CGR2-KM22-C255742Open in IMG/M
3300006990|Ga0098046_1065130Not Available834Open in IMG/M
3300007074|Ga0075110_1102675Not Available597Open in IMG/M
3300007231|Ga0075469_10082543Not Available919Open in IMG/M
3300007276|Ga0070747_1097464All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes1087Open in IMG/M
3300007276|Ga0070747_1138859All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes879Open in IMG/M
3300007345|Ga0070752_1007465Not Available6149Open in IMG/M
3300007346|Ga0070753_1178843All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes793Open in IMG/M
3300007519|Ga0105055_10620588All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes864Open in IMG/M
3300007640|Ga0070751_1393028All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes500Open in IMG/M
3300008012|Ga0075480_10288619All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes837Open in IMG/M
3300009000|Ga0102960_1023442All Organisms → cellular organisms → Bacteria2310Open in IMG/M
3300009002|Ga0102810_1181331All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes648Open in IMG/M
3300009149|Ga0114918_10085110All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium TMED362000Open in IMG/M
3300009172|Ga0114995_10102912All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC034P1602Open in IMG/M
3300009173|Ga0114996_10762710All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → uncultured Mediterranean phage uvDeep-CGR2-KM22-C255703Open in IMG/M
3300009469|Ga0127401_1011778All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes2563Open in IMG/M
3300009512|Ga0115003_10476073All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes731Open in IMG/M
3300009703|Ga0114933_10869822All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → uncultured Mediterranean phage uvDeep-CGR2-KM22-C255573Open in IMG/M
3300009785|Ga0115001_10752637All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes589Open in IMG/M
3300010148|Ga0098043_1016762All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes2373Open in IMG/M
3300010148|Ga0098043_1188706All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes573Open in IMG/M
3300010300|Ga0129351_1204998All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes764Open in IMG/M
3300010368|Ga0129324_10214054All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes779Open in IMG/M
3300011118|Ga0114922_11131842All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes634Open in IMG/M
3300012920|Ga0160423_10067502All Organisms → Viruses2563Open in IMG/M
3300012920|Ga0160423_10097828All Organisms → Viruses2077Open in IMG/M
3300012920|Ga0160423_10164447All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes1554Open in IMG/M
3300012920|Ga0160423_10588002Not Available754Open in IMG/M
3300012920|Ga0160423_10633005All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes724Open in IMG/M
3300012920|Ga0160423_10863953Not Available607Open in IMG/M
3300012920|Ga0160423_11079998All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes537Open in IMG/M
3300012920|Ga0160423_11160068All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes516Open in IMG/M
3300014030|Ga0116816_1037273All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes614Open in IMG/M
3300017706|Ga0181377_1009252Not Available2424Open in IMG/M
3300017710|Ga0181403_1008732Not Available2192Open in IMG/M
3300017710|Ga0181403_1035659All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes1047Open in IMG/M
3300017710|Ga0181403_1068691All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes737Open in IMG/M
3300017713|Ga0181391_1046675All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes1029Open in IMG/M
3300017713|Ga0181391_1088937All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes702Open in IMG/M
3300017717|Ga0181404_1096981All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes723Open in IMG/M
3300017717|Ga0181404_1177978All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes509Open in IMG/M
3300017719|Ga0181390_1013062All Organisms → Viruses → Predicted Viral2861Open in IMG/M
3300017719|Ga0181390_1100109All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes777Open in IMG/M
3300017720|Ga0181383_1207376All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC203P520Open in IMG/M
3300017725|Ga0181398_1023301All Organisms → Viruses → Predicted Viral1537Open in IMG/M
3300017732|Ga0181415_1072238All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes779Open in IMG/M
3300017734|Ga0187222_1013086All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Xanthomarina → Xanthomarina gelatinilytica2041Open in IMG/M
3300017737|Ga0187218_1089884All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes741Open in IMG/M
3300017744|Ga0181397_1079590All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes875Open in IMG/M
3300017744|Ga0181397_1176000Not Available540Open in IMG/M
3300017749|Ga0181392_1012237All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes2798Open in IMG/M
3300017752|Ga0181400_1169813All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes612Open in IMG/M
3300017757|Ga0181420_1031627All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes1736Open in IMG/M
3300017757|Ga0181420_1045927All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes1409Open in IMG/M
3300017757|Ga0181420_1152676All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes688Open in IMG/M
3300017758|Ga0181409_1116386All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes791Open in IMG/M
3300017758|Ga0181409_1218706All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes546Open in IMG/M
3300017767|Ga0181406_1046162All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Xanthomarina → Xanthomarina gelatinilytica1350Open in IMG/M
3300017772|Ga0181430_1028880All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes1784Open in IMG/M
3300017772|Ga0181430_1130014All Organisms → Viruses → environmental samples → uncultured Mediterranean phage738Open in IMG/M
3300017772|Ga0181430_1232466All Organisms → Viruses → environmental samples → uncultured Mediterranean phage522Open in IMG/M
3300017776|Ga0181394_1241648All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes542Open in IMG/M
3300017782|Ga0181380_1017799All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes2670Open in IMG/M
3300017950|Ga0181607_10164620All Organisms → Viruses → Predicted Viral1334Open in IMG/M
3300017950|Ga0181607_10473396All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC204P673Open in IMG/M
3300017956|Ga0181580_10250961All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC204P1221Open in IMG/M
3300018036|Ga0181600_10141705All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes1350Open in IMG/M
3300018041|Ga0181601_10213910All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes1122Open in IMG/M
3300018416|Ga0181553_10042010All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC100P3109Open in IMG/M
3300018416|Ga0181553_10293639All Organisms → Viruses → environmental samples → uncultured Mediterranean phage907Open in IMG/M
3300018416|Ga0181553_10297300All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes899Open in IMG/M
3300018416|Ga0181553_10514408All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes638Open in IMG/M
3300019726|Ga0193974_1068502All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes500Open in IMG/M
3300020053|Ga0181595_10100843All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes1412Open in IMG/M
3300020174|Ga0181603_10320489All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes591Open in IMG/M
3300020188|Ga0181605_10267569All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes732Open in IMG/M
3300020191|Ga0181604_10085996All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Woesearchaeota → Candidatus Woesearchaeota archaeon1719Open in IMG/M
3300020403|Ga0211532_10147376All Organisms → Viruses968Open in IMG/M
3300020436|Ga0211708_10096736All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Fowlmouthvirus → Fowlmouthvirus fowlmouth1154Open in IMG/M
3300020439|Ga0211558_10288168All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes771Open in IMG/M
3300020469|Ga0211577_10618981All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes643Open in IMG/M
3300020472|Ga0211579_10052650All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes2521Open in IMG/M
3300021335|Ga0213867_1123710Not Available907Open in IMG/M
3300021371|Ga0213863_10197516All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes888Open in IMG/M
3300021373|Ga0213865_10128760All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC204P1320Open in IMG/M
3300021375|Ga0213869_10031496All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes2885Open in IMG/M
3300021958|Ga0222718_10022285All Organisms → Viruses4372Open in IMG/M
3300021958|Ga0222718_10271280All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes892Open in IMG/M
3300021959|Ga0222716_10091742All Organisms → Viruses2068Open in IMG/M
3300022053|Ga0212030_1009629All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes1183Open in IMG/M
3300022057|Ga0212025_1034165All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes863Open in IMG/M
3300022065|Ga0212024_1058954Not Available678Open in IMG/M
3300022069|Ga0212026_1021858All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes908Open in IMG/M
3300022074|Ga0224906_1107007All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes820Open in IMG/M
3300022183|Ga0196891_1065060All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes653Open in IMG/M
3300022183|Ga0196891_1083208All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes566Open in IMG/M
3300022187|Ga0196899_1012424Not Available3318Open in IMG/M
3300022822|Ga0222646_100040All Organisms → cellular organisms → Bacteria54255Open in IMG/M
3300022843|Ga0222631_1019231All Organisms → Viruses → Predicted Viral1039Open in IMG/M
3300022925|Ga0255773_10240423All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC204P783Open in IMG/M
3300022926|Ga0255753_1120021All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes1244Open in IMG/M
3300022927|Ga0255769_10172264All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes987Open in IMG/M
3300022928|Ga0255758_10315351All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes658Open in IMG/M
3300024262|Ga0210003_1155810All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes974Open in IMG/M
3300024433|Ga0209986_10363261All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes668Open in IMG/M
3300025086|Ga0208157_1091264All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes745Open in IMG/M
3300025101|Ga0208159_1020918All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes1583Open in IMG/M
3300025110|Ga0208158_1007394Not Available3084Open in IMG/M
3300025120|Ga0209535_1029206All Organisms → Viruses → Predicted Viral2631Open in IMG/M
3300025120|Ga0209535_1039078All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Mediterranean phage uvDeep-CGR2-KM24-C1652142Open in IMG/M
3300025120|Ga0209535_1194389All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes579Open in IMG/M
3300025128|Ga0208919_1149381Not Available725Open in IMG/M
3300025168|Ga0209337_1328835All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes536Open in IMG/M
3300025508|Ga0208148_1044287All Organisms → Viruses → Predicted Viral1129Open in IMG/M
3300025508|Ga0208148_1099298All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes629Open in IMG/M
3300025671|Ga0208898_1064322All Organisms → Viruses → Predicted Viral1252Open in IMG/M
3300025810|Ga0208543_1153748All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes537Open in IMG/M
3300025853|Ga0208645_1010302All Organisms → cellular organisms → Bacteria5781Open in IMG/M
3300025853|Ga0208645_1232514All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes628Open in IMG/M
3300025889|Ga0208644_1362157All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes548Open in IMG/M
3300026138|Ga0209951_1078132All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes691Open in IMG/M
3300026187|Ga0209929_1068630All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes969Open in IMG/M
3300026263|Ga0207992_1036739Not Available1464Open in IMG/M
3300027687|Ga0209710_1209452All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes658Open in IMG/M
(restricted) 3300027861|Ga0233415_10092052All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED1971324Open in IMG/M
(restricted) 3300027861|Ga0233415_10238676All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes847Open in IMG/M
(restricted) 3300027861|Ga0233415_10414658All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC024P646Open in IMG/M
3300027983|Ga0209284_10002014All Organisms → cellular organisms → Bacteria29008Open in IMG/M
3300029309|Ga0183683_1000084All Organisms → cellular organisms → Bacteria56835Open in IMG/M
3300029309|Ga0183683_1029432Not Available982Open in IMG/M
3300029318|Ga0185543_1044350Not Available963Open in IMG/M
3300029448|Ga0183755_1029583Not Available1633Open in IMG/M
3300031565|Ga0307379_11232826All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes617Open in IMG/M
3300031676|Ga0302136_1086558All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC034P1033Open in IMG/M
3300032277|Ga0316202_10570951All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes532Open in IMG/M
3300032462|Ga0335396_10022667All Organisms → Viruses → Predicted Viral4628Open in IMG/M
3300034374|Ga0348335_079510All Organisms → Viruses → Predicted Viral1110Open in IMG/M
3300034375|Ga0348336_029605All Organisms → Viruses → Predicted Viral2607Open in IMG/M
3300034375|Ga0348336_053604All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Mediterranean phage uvDeep-CGR2-KM24-C1651639Open in IMG/M
3300034375|Ga0348336_053856All Organisms → Viruses → Predicted Viral1632Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous22.87%
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine17.55%
SeawaterEnvironmental → Aquatic → Marine → Strait → Unclassified → Seawater15.96%
Salt MarshEnvironmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh9.04%
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine5.32%
MarineEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine5.32%
Surface SeawaterEnvironmental → Aquatic → Marine → Oceanic → Photic Zone → Surface Seawater4.26%
Deep SubsurfaceEnvironmental → Aquatic → Marine → Oceanic → Sediment → Deep Subsurface2.13%
SeawaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Seawater2.13%
FreshwaterEnvironmental → Aquatic → Freshwater → Ice → Glacial Lake → Freshwater1.60%
SeawaterEnvironmental → Aquatic → Marine → Inlet → Unclassified → Seawater1.60%
Estuarine WaterEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water1.60%
Pond WaterEnvironmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Pond Water1.60%
Freshwater To Marine Saline GradientEnvironmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient1.06%
MarineEnvironmental → Aquatic → Marine → Coastal → Unclassified → Marine1.06%
Saline WaterEnvironmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Water1.06%
SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Sediment0.53%
Marine PlanktonEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine Plankton0.53%
Marine WaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine Water0.53%
Microbial MatEnvironmental → Aquatic → Marine → Coastal → Sediment → Microbial Mat0.53%
EstuarineEnvironmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine0.53%
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine0.53%
Pelagic MarineEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine0.53%
Deep SubsurfaceEnvironmental → Aquatic → Marine → Volcanic → Unclassified → Deep Subsurface0.53%
Saline LakeEnvironmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Lake0.53%
Meromictic PondEnvironmental → Aquatic → Unclassified → Unclassified → Unclassified → Meromictic Pond0.53%
SoilEnvironmental → Terrestrial → Soil → Clay → Unclassified → Soil0.53%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000101Marine microbial communities from Delaware Coast, sample from Delaware MO Early Summer May 2010EnvironmentalOpen in IMG/M
3300000115Marine microbial communities from Delaware Coast, sample from Delaware MO Summer July 2011EnvironmentalOpen in IMG/M
3300000116Marine microbial communities from Delaware Coast, sample from Delaware MO Spring March 2010EnvironmentalOpen in IMG/M
3300000117Marine microbial communities from Delaware Coast, sample from Delaware MO Winter December 2010EnvironmentalOpen in IMG/M
3300001450Marine viral communities from the Pacific Ocean - LP-53EnvironmentalOpen in IMG/M
3300001460Marine viral communities from the Pacific Ocean - LP-28EnvironmentalOpen in IMG/M
3300001846Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - ACM22, ROCA_DNA119_0.2um_25bEnvironmentalOpen in IMG/M
3300004097Pelagic marine sediment microbial communities from the LTER site Helgoland, North Sea, for post-phytoplankton bloom and carbon turnover studies - OSD3 (Helgoland) metaGEnvironmentalOpen in IMG/M
3300004448Marine viral communities from Newfoundland, Canada BC-1EnvironmentalOpen in IMG/M
3300004951Marine water microbial communities from the East Sea, Korea with extracellular vesicles - East-Sea-EVsEnvironmentalOpen in IMG/M
3300005521Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP2014F10-02SV255EnvironmentalOpen in IMG/M
3300005747Seawater microbial communities from Vineyard Sound, MA, USA - control T14EnvironmentalOpen in IMG/M
3300006025Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_<0.8_DNAEnvironmentalOpen in IMG/M
3300006026Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_<0.8_DNAEnvironmentalOpen in IMG/M
3300006027Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_<0.8_DNAEnvironmentalOpen in IMG/M
3300006164Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG002-DNAEnvironmentalOpen in IMG/M
3300006403Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_<0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006735Marine viral communities from the Subarctic Pacific Ocean - 5B_ETSP_OMZ_AT15132_CsCl metaGEnvironmentalOpen in IMG/M
3300006749Marine viral communities from the Subarctic Pacific Ocean - 9_ETSP_OMZ_AT15188 metaGEnvironmentalOpen in IMG/M
3300006752Marine viral communities from the Subarctic Pacific Ocean - 13_ETSP_OMZ_AT15268 metaGEnvironmentalOpen in IMG/M
3300006802Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18EnvironmentalOpen in IMG/M
3300006810Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01EnvironmentalOpen in IMG/M
3300006869Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_N_>0.8_DNAEnvironmentalOpen in IMG/M
3300006874Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_>0.8_DNAEnvironmentalOpen in IMG/M
3300006916Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24EnvironmentalOpen in IMG/M
3300006919Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21EnvironmentalOpen in IMG/M
3300006920Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12EnvironmentalOpen in IMG/M
3300006922Marine viral communities from the Subarctic Pacific Ocean - 11_ETSP_OMZ_AT15265 metaGEnvironmentalOpen in IMG/M
3300006928Marine viral communities from the Subarctic Pacific Ocean - 8_ETSP_OMZ_AT15162 metaGEnvironmentalOpen in IMG/M
3300006929Marine viral communities from the Subarctic Pacific Ocean - 4_ETSP_OMZ_AT15127 metaGEnvironmentalOpen in IMG/M
3300006990Marine viral communities from the Subarctic Pacific Ocean - 11B_ETSP_OMZ_AT15265_CsCl metaGEnvironmentalOpen in IMG/M
3300007074Saline lake microbial communities from Ace Lake, Antarctica - Antarctic Ace Lake Metagenome 02UK8EnvironmentalOpen in IMG/M
3300007231Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_30_>0.8_DNAEnvironmentalOpen in IMG/M
3300007276Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31EnvironmentalOpen in IMG/M
3300007345Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_30EnvironmentalOpen in IMG/M
3300007346Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_31EnvironmentalOpen in IMG/M
3300007519Freshwater microbial communities from Lake Bonney liftoff mats and glacier meltwater in Antarctica - BON-03EnvironmentalOpen in IMG/M
3300007640Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_28EnvironmentalOpen in IMG/M
3300008012Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_<0.8_DNAEnvironmentalOpen in IMG/M
3300009000Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_B_H2O_MGEnvironmentalOpen in IMG/M
3300009002Estuarine microbial communities from the Columbia River estuary - Ebb tide ETM metaG S.573EnvironmentalOpen in IMG/M
3300009149Deep subsurface microbial communities from Baltic Sea to uncover new lineages of life (NeLLi) - Landsort_02402 metaGEnvironmentalOpen in IMG/M
3300009172Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_154EnvironmentalOpen in IMG/M
3300009173Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_134EnvironmentalOpen in IMG/M
3300009469Aquatic microbial communities from different depth of meromictic Siders Pond, Falmouth, Massachusetts; Cast 1, 6m depth; DNA IDBA-UDEnvironmentalOpen in IMG/M
3300009512Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB11_88EnvironmentalOpen in IMG/M
3300009703Deep subsurface microbial communities from Kolumbo volcano to uncover new lineages of life (NeLLi) - 4SBTROV12_W25 metaGEnvironmentalOpen in IMG/M
3300009785Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_130EnvironmentalOpen in IMG/M
3300010148Marine viral communities from the Subarctic Pacific Ocean - 9B_ETSP_OMZ_AT15188_CsCl metaGEnvironmentalOpen in IMG/M
3300010300Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.2_DNAEnvironmentalOpen in IMG/M
3300010368Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_15_0.2_DNAEnvironmentalOpen in IMG/M
3300011118Deep subsurface microbial communities from Aarhus Bay to uncover new lineages of life (NeLLi) - Aarhus_00045 metaGEnvironmentalOpen in IMG/M
3300012920Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St8 metaGEnvironmentalOpen in IMG/M
3300014030Marine hypoxic microbial communities from the Gulf of Mexico, USA - 11m_Station1_GOM_MetagenomeEnvironmentalOpen in IMG/M
3300017706Marine viral communities from the Subarctic Pacific Ocean - Lowphox_13 viral metaGEnvironmentalOpen in IMG/M
3300017710Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 26 SPOT_SRF_2011-09-28EnvironmentalOpen in IMG/M
3300017713Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 14 SPOT_SRF_2010-08-11EnvironmentalOpen in IMG/M
3300017717Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 27 SPOT_SRF_2011-10-25EnvironmentalOpen in IMG/M
3300017719Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 13 SPOT_SRF_2010-07-21EnvironmentalOpen in IMG/M
3300017720Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 6 SPOT_SRF_2009-12-23EnvironmentalOpen in IMG/M
3300017725Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 21 SPOT_SRF_2011-04-29EnvironmentalOpen in IMG/M
3300017732Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 38 SPOT_SRF_2012-12-11EnvironmentalOpen in IMG/M
3300017734Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 4 SPOT_SRF_2009-09-24 (version 2)EnvironmentalOpen in IMG/M
3300017737Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 14 SPOT_SRF_2010-08-11 (version 2)EnvironmentalOpen in IMG/M
3300017744Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 20 SPOT_SRF_2011-02-23EnvironmentalOpen in IMG/M
3300017749Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 15 SPOT_SRF_2010-09-15EnvironmentalOpen in IMG/M
3300017752Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 23 SPOT_SRF_2011-06-22EnvironmentalOpen in IMG/M
3300017757Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 43 SPOT_SRF_2013-05-22EnvironmentalOpen in IMG/M
3300017758Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 32 SPOT_SRF_2012-05-30EnvironmentalOpen in IMG/M
3300017767Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 29 SPOT_SRF_2011-12-20EnvironmentalOpen in IMG/M
3300017772Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 53 SPOT_SRF_2014-04-10EnvironmentalOpen in IMG/M
3300017776Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 17 SPOT_SRF_2010-11-23EnvironmentalOpen in IMG/M
3300017782Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 3 SPOT_SRF_2009-08-19EnvironmentalOpen in IMG/M
3300017950Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041413US metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300017956Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071403BT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018036Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041406US metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018041Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041407BS metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018416Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011502XT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300019726Sediment microbial communities from the Broadkill River, Lewes, Delaware, United States ? BRT_10-11_MGEnvironmentalOpen in IMG/M
3300020053Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041401AS metaG (spades assembly)EnvironmentalOpen in IMG/M
3300020174Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041409US metaG (spades assembly)EnvironmentalOpen in IMG/M
3300020188Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041411US metaG (spades assembly)EnvironmentalOpen in IMG/M
3300020191Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041410US metaG (spades assembly)EnvironmentalOpen in IMG/M
3300020403Marine microbial communities from Tara Oceans - TARA_B100000085 (ERX556015-ERR599145)EnvironmentalOpen in IMG/M
3300020436Marine microbial communities from Tara Oceans - TARA_B100000424 (ERX556009-ERR598984)EnvironmentalOpen in IMG/M
3300020439Marine microbial communities from Tara Oceans - TARA_B100001939 (ERX556062-ERR599029)EnvironmentalOpen in IMG/M
3300020469Marine microbial communities from Tara Oceans - TARA_B100001093 (ERX555967-ERR599052)EnvironmentalOpen in IMG/M
3300020472Marine microbial communities from Tara Oceans - TARA_B100001250 (ERX556017-ERR598995)EnvironmentalOpen in IMG/M
3300021335Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO540EnvironmentalOpen in IMG/M
3300021371Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO497EnvironmentalOpen in IMG/M
3300021373Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO282EnvironmentalOpen in IMG/M
3300021375Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO132EnvironmentalOpen in IMG/M
3300021958Estuarine water microbial communities from San Francisco Bay, California, United States - C33_27DEnvironmentalOpen in IMG/M
3300021959Estuarine water microbial communities from San Francisco Bay, California, United States - C33_13DEnvironmentalOpen in IMG/M
3300022053Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG (v2)EnvironmentalOpen in IMG/M
3300022057Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_28 (v2)EnvironmentalOpen in IMG/M
3300022065Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 (v2)EnvironmentalOpen in IMG/M
3300022069Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_30 (v2)EnvironmentalOpen in IMG/M
3300022074Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 56 SPOT_SRF_2014-09-10 (v2)EnvironmentalOpen in IMG/M
3300022183Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 (v3)EnvironmentalOpen in IMG/M
3300022187Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 (v3)EnvironmentalOpen in IMG/M
3300022822Saline water microbial communities from Ace Lake, Antarctica - #293EnvironmentalOpen in IMG/M
3300022843Saline water microbial communities from Ace Lake, Antarctica - #5EnvironmentalOpen in IMG/M
3300022925Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011502XT metaGEnvironmentalOpen in IMG/M
3300022926Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041412US metaGEnvironmentalOpen in IMG/M
3300022927Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041413US metaGEnvironmentalOpen in IMG/M
3300022928Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011513CT metaGEnvironmentalOpen in IMG/M
3300024262Deep subsurface microbial communities from Baltic Sea to uncover new lineages of life (NeLLi) - Landsort_02402 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300024433Deep subsurface microbial communities from Black Sea to uncover new lineages of life (NeLLi) - Black_00105 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025086Marine viral communities from the Subarctic Pacific Ocean - 5_ETSP_OMZ_AT15132 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025101Marine viral communities from the Subarctic Pacific Ocean - 9_ETSP_OMZ_AT15188 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025110Marine viral communities from the Subarctic Pacific Ocean - 8_ETSP_OMZ_AT15162 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025120Marine viral communities from the Pacific Ocean - LP-28 (SPAdes)EnvironmentalOpen in IMG/M
3300025128Marine viral communities from the Subarctic Pacific Ocean - 4_ETSP_OMZ_AT15127 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025168Marine viral communities from the Pacific Ocean - LP-53 (SPAdes)EnvironmentalOpen in IMG/M
3300025508Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_<0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025671Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_4 (SPAdes)EnvironmentalOpen in IMG/M
3300025810Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_>0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025853Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 (SPAdes)EnvironmentalOpen in IMG/M
3300025889Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 (SPAdes)EnvironmentalOpen in IMG/M
3300026138Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_A_H2O_MG (SPAdes)EnvironmentalOpen in IMG/M
3300026187Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_C_H2O_MG (SPAdes)EnvironmentalOpen in IMG/M
3300026263Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP2014F10-02SV255 (SPAdes)EnvironmentalOpen in IMG/M
3300027687Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_138 (SPAdes)EnvironmentalOpen in IMG/M
3300027861 (restricted)Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_anoxic_12_MGEnvironmentalOpen in IMG/M
3300027983Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - FRY-03 (SPAdes)EnvironmentalOpen in IMG/M
3300029309Marine viral communities collected during Tara Oceans survey from station TARA_100 - TARA_R100001440EnvironmentalOpen in IMG/M
3300029318Marine giant viral communities collected during Tara Oceans survey from station TARA_038 - TARA_Y100000289EnvironmentalOpen in IMG/M
3300029448Marine viral communities collected during Tara Oceans survey from station TARA_023 - TARA_E500000082EnvironmentalOpen in IMG/M
3300031565Soil microbial communities from Risofladan, Vaasa, Finland - UN-2EnvironmentalOpen in IMG/M
3300031676Marine microbial communities from Western Arctic Ocean, Canada - CBN3_20mEnvironmentalOpen in IMG/M
3300032277Microbial mat bacterial communities from mineral coupon in-situ incubated in ocean water Damariscotta River, Maine, United States - 3-month pyrrhotiteEnvironmentalOpen in IMG/M
3300032462Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - FRY-02 (spades assembly)EnvironmentalOpen in IMG/M
3300034374Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_31 (v4)EnvironmentalOpen in IMG/M
3300034375Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_30 (v4)EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
DelMOSum2010_1011687223300000101MarineMKVYNITFVEECTSQVKIKAETLEKAKEIVNSGDFSGDEIIERDHFQITESYEESEE*
DelMOSum2010_1026356633300000101MarineMKVYNITFVEECTSQVKIKAETLEEAKEIVNSGDFTGDEIIERDHFQITESYEESEGK*
DelMOSum2011_1018536833300000115MarineEECTSQVKIKAETLEKAKEIVNSGDFSGDEIIERDHFQITESYEESEK*
DelMOSpr2010_1007679713300000116MarineMKVYNITFVEECTSQVKIKAETLEXAKEIVXXGXFTGDEIIERDHFQITESYEE
DelMOSpr2010_1009553323300000116MarineMKVYNITFVEECTSQVKIKAKTLEEAEKIVNSGDFTGDEIIERDHFQITESYEESEGK*
DelMOSpr2010_1018345833300000116MarineMKTFNITFTEECTSEVKIKANTLDEAIKIVESGNFVNDEIIDRDHFQITDTYEVK*
DelMOSpr2010_1020829513300000116MarineMKTYVIDFVEEVTSQVKIQAKNLKEAEKIVSSGDFMGDEVIERDHFQITGSYEEG
DelMOSpr2010_1023300313300000116MarineMKTYVIDFVEEVTSQVKIQAKNLKEAEKIVSSGDFMGDEVIERDHFQITGS
DelMOWin2010_1011179153300000117MarineTTKTKREEIKMKVYNITFVEECTSQVKIKAETLDKAKEIVNSGDFTGDEIIERDHFQITESYEESEGK*
DelMOWin2010_1024764823300000117MarineMKVYNITFVEECTSQVKIKAETLEKAKEIVNSGDFSGDEIIERDHFQITESYEESEEINEL*
JGI24006J15134_1013433233300001450MarineMKVYNITFVEECTSQVKIKAETLEKAKEIVNSGDFSDDEIIERDHFQITESYEESEDQ*
JGI24006J15134_1019374623300001450MarineMKVYNITFVEECTSQVKIKAETLEKAKEIVNSGDFSGDEIIERDHFQITESYEESEDQ*
JGI24003J15210_10009487113300001460MarineMKVYNITFVEECTSQVKIKAETLEKAKEIVNSGDFSGDEIVDRDHFQITESYEESKEG*
ACM22_107705533300001846Marine PlanktonMKTYVIDFVEEVKSQVKIKAKNLEEAEKIVNSGDFIGDEVIDRDHFQITNTYEE*
Ga0055584_10129183613300004097Pelagic MarineMSKKMKIFRIKFVEECTSEVLIEAKTLEQAKEIVRSGHFMGDEIIERDHFQITNGYETMKGNK*
Ga0065861_103646363300004448MarineMKTFNITFVEEVTSQVKIDAETLEEAKEMVDFGNFVNDEIIERDHFQITESYEESEKNND
Ga0065861_110714713300004448MarineMKTFNITFVEEVTSQVKIEAETLEEAKEMVDFGNFANDEIIERDHFQITESYEES
Ga0068513_100319833300004951Marine WaterMIFQIEFVEECTSKVKIKADTLEKAKEIVNSGDFTGDEIIERDHFQITQAYPIEEENNDTKG*
Ga0066862_1005651533300005521MarineMKIYKIKFVEECTSSVKVKAQSEKKAREIVESGDFSGDEIIDRDHFQITECYETGLNK*
Ga0076924_125917033300005747MarineMKTYVIDFVEEVTSQVKIQAKNLKEAEKIVSSGDFMGDEVIERDHFQITGSYEESEK*
Ga0075474_1001822253300006025AqueousMKTFNITFTEECTSEVKIKANTLDEAIKIVESGNFVNDEIIDRDHFQITDTYEIESEE*
Ga0075474_1003321673300006025AqueousMKTFNITFVEEVTSQVKIEAETLEKAEQIIESGNFVNDEIIERDHFQITESYEESEVA*
Ga0075474_1004320953300006025AqueousMKTYVIDFVEEVTSQVKIQAKNLKEAEKIVSSGDFMGDEVIERDHFQITGSYEEGEE*
Ga0075478_1010455523300006026AqueousMKVYNITFVEECTSQVKIKAETLEKAKEIVNSGEFTGDEIIERDHFQITEIYEESE*
Ga0075462_1009412243300006027AqueousMKVYNISFVELVTSQVKIKAKTLEEAKEIVNSGDFSGDEVIDRDNFEITESYKESEE*
Ga0075441_1010791053300006164MarineMKIFNITFVEECTSQVKIQAETLEKAKEIVNSGDFMGDEIIERDHFQITKSYEENK*
Ga0075514_162554333300006403AqueousFTEECTSEVKIKANTLDEAIKIVESGNFVNDEIIDRDHFQITDTYEIESEE*
Ga0098038_106623033300006735MarineMKVYNITFVEECTSQVKIKAETLEKAKEIVNSGDFSGDKIIERDHFQITESYEESEEHE*
Ga0098038_109770323300006735MarineMKTYVIDFVEEVTSQVKIKAKNLKEAEEIVNSGDFSGDEVTDRDHFQITNAYEE*
Ga0098038_122252213300006735MarineMKVYNITFVEECTSQVKIKAKTLEEAKEIVKSGDFSGDEIIERDHFQITESYEESEE*
Ga0098038_123309023300006735MarineMKVYNITFVEECTSQVKIKAETLEKAKEIVNSGDFTGDEIIERDHFQITESYEESEDQ*
Ga0098042_107692513300006749MarineVKTFNITFVEECTSQVKIKAKTLEKAKEIVNSGDFTGDEIIERDHFEITESYEESK*
Ga0098048_119116523300006752MarineMKVYNITFVEECTSQVKIKAETLEKAKEIVNSGDFSGDEIIDRDNFQITESYEESEEINAN*
Ga0070749_1016821753300006802AqueousMKVYNITFVEECTSQVKIKAETLEKAKEIVNSGDFTGDEIIERDHFQITESYEESEGK*
Ga0070749_1029083233300006802AqueousMKVYNITFVEECTSQVKIKAETLEKAKEIVNSGDFSGDEIIERDHFQITESYEESE*
Ga0070749_1041165933300006802AqueousTTKTGEKIKMKTFNITFTEECTSEVKIKANTLDEAIKIVESGNFVNDEIIDRDHFQITDTYEIESEE*
Ga0070749_1063506113300006802AqueousLWEIILTTNNKGETMNTKKIFKITFVEEVTSSVKIEANTLEEAIKIVESGDFVGDEIEERDHFQITNSYEV*
Ga0070754_1006255853300006810AqueousMNTKKIFKITFVEEVTSSVKIEANTLEEAIKIVESGDFVGDEIEERDHFQITNSYEV*
Ga0070754_1053470923300006810AqueousMKTYVIDFVEEVTSQVKIQAKNLKEAEKIVSSGDFIGDEVIDRDHFQITGSYEEGEE*
Ga0075477_1006483113300006869AqueousMKVYNITFVEECTSQVKIKAETLEKAKEIVNSGDFTGDEIIERDHFQITESYEE
Ga0075475_1013878413300006874AqueousNNKGETMNTKKIFKITFVEEVTSSVKIEANTLEEAIKIVESGDFVGDEIEERDHFQITNSYEV*
Ga0070750_1037479833300006916AqueousMKTYVIDFVEEVTSQVKIQAKNLKEAEKIVSSGDFMGDEVIERDHFQITGSYEEGEK*
Ga0070746_1004531183300006919AqueousMKIFNITFTEECTSQVKIKANTLEEAKKIVNSGDFTGDEIIERDHFEIIKSYQESEGE*
Ga0070748_110911263300006920AqueousFVEECTSQVKIKAKTLEEAEKIVNSGDFTGDEIIERDHFQITESYEESEDHE*
Ga0070748_127822433300006920AqueousMKVYNITFVEECTSQVKIKAETLEKAKEIVNSGDFSGDEIIERDHFQITESYEESE
Ga0098045_107952843300006922MarineKKVYNITFVEECTSQVKIKAETLEKAKEIVNSGDFSGDEIIDRDNFQITESYEESEEINAN*IRNKT*
Ga0098041_101845773300006928MarineMKVYNITFVEECTSQVKIKAKTLEEAKEIVNSGDFSGDEIIDRDNFQITESYEESEEINAN*
Ga0098036_113932113300006929MarineMKKYVIHFVEECTSEVEIKAKSKKKAKEIVESGDFSGDKIIDRNHFQITECFKL*
Ga0098046_106513033300006990MarineMKVYNITFVEECTSQVKIKAETLEKAKEIVNSGDFSGDKIIERDHFQITESYEESEE*
Ga0075110_110267513300007074Saline LakeMKLYEITFTEECTSRVKIEANSLEEATKIIESGDFVNDEIVDRDHFQIININEA*
Ga0075469_1008254343300007231AqueousMKVYNITFVEECTSQVKIKAETLEKAKEIVNSGDFSGDEIIERDHFQITESYEESEK*
Ga0070747_109746443300007276AqueousMKVYNITFVEECTSQVKIKAETLEKAKEIVNSGDFTGDEIIERDHFQITESYEESEDHE*
Ga0070747_113885943300007276AqueousMKVYNITFVEECTSQVKIKAKTLEEAKEIVNSGDFTGDEIIERDHFQITESYEESEGK*
Ga0070752_100746563300007345AqueousMKTFNITFVEEVTSQVKIEAETLEKAEQIIESGNFVNDEIKERDHFQITESYEESEVA*
Ga0070753_117884333300007346AqueousMKVYNITFVEECTSQVKIKAKTLEEAEKIVNSGDFTGDEIIERDHFQITESYEESEE*
Ga0105055_1062058823300007519FreshwaterVVKWLNLKGRINKMKIYEITFIEECTSKVKIEANSLEEATKIVESGDFVNDEIVDRDHFQITNINEA*
Ga0070751_139302813300007640AqueousMKVYNITFVEECTSQVKIKAETLEEAKEIVNSGDFTGDKIIERDHFQITESYEESEGK*
Ga0075480_1028861943300008012AqueousMKVYNITLVEECTSQVKIKAETLEKAKEIVNSGEFTGDEIIERDHFQITEIYEESE*
Ga0102960_102344243300009000Pond WaterMSKKMKIFRIKFVEECTSEVLINAETLEQAKEIVRSGHFMGDEIIERDHFQITNGYETMKGNK*
Ga0102810_118133123300009002EstuarineMKVYNITFVEECTSQVKIKAKTLEEAKEIVNSGDFSGDEIIERDHFQITESYEESEE*
Ga0114918_1008511033300009149Deep SubsurfaceMKTYVIDFVEEVTSQVKIQAKNLKEAEKIVSSGDFMGDEVIERDHFQITGSYEEGKE*
Ga0114995_1010291253300009172MarineMKTFNITFVEEVTSQVKIKAKTLEKAEEIVESGNFANDEIIERDHFQITESYEEIENFVHKYKNFIRN*
Ga0114996_1076271023300009173MarineMKIYQINFVEECTSEVKIKAKSENEARKIVESGDFIGDEIIDRDHFQITECFKL*
Ga0127401_101177823300009469Meromictic PondMNTKKIFKITFVEEVTSSVKIEANTLEEAIKIVESGDFVGDEIEDRDHFQITNSYEV*
Ga0115003_1047607313300009512MarineKMKTFNITFVEEVTSQVKIEAETLEKAVEMVESGNFANDEIIERDHFQITESYEESEE*
Ga0114933_1086982223300009703Deep SubsurfaceMKTYEIEFVEECTSKVKIKAKSEKKAREIVESGDFIGDKIIDRDHFQITECFKL*
Ga0115001_1075263743300009785MarineMKTFNITFVEEVTSQVKIKAKTLEKAEEIVESGNFANDEIIERDHFQITESYE
Ga0098043_101676263300010148MarineMKTFNITFVEECTSQVKIKAETLEKAKEIVNSGDFTGDEIIERDHFQITESYEEEREDQ*
Ga0098043_118870633300010148MarineMKTYVIDFIEEVTSQVKIQAKNLKEAEKIVSSGDFMGDEVIDRDHFQIAGSYEEGKE*
Ga0129351_120499813300010300Freshwater To Marine Saline GradientTFVEEVTSQVKIEAETLEKAEQIIESGNFVNDEIIERDHFQITESYEESEVA*
Ga0129324_1021405433300010368Freshwater To Marine Saline GradientMKVYNISFVELVTSQVKIKAKTLEEAKEIVNSGDFTGDEVIDRDNFEITESYEES*
Ga0114922_1113184233300011118Deep SubsurfaceMKTFNITFVEEVTSQVKIKAETLEEAKEMVDFGNFANDEIIERDHFQITESYEESEEINDK*
Ga0160423_1006750213300012920Surface SeawaterMKIYNITFVEECTSQVKIKAKTLEKAKEIVNSGDFSGDEVIDRDHFQITESYEESEE*
Ga0160423_1009782873300012920Surface SeawaterMKVYNITFVEECTSQVKIKAETLEKAKEIVNSGDFSGDEVIDRDHFQITE
Ga0160423_1016444713300012920Surface SeawaterMKTYIIDFVEEVTSQVKIKAKSLKEAEEIVNSGDFSGDEVTDRDHFQIIDSYEESEE*
Ga0160423_1058800223300012920Surface SeawaterMAVYKVTFVEETTNVVLIKAETEEKAREMVNSGDFSGDEVTDRDHFEITKVDKEGS*
Ga0160423_1063300543300012920Surface SeawaterMKTYVIDFVEEVTSQVKIKAKNLEEAKEIVNRGDFIGDEVTDRDYFQITNAYEE*
Ga0160423_1086395323300012920Surface SeawaterMAVYKVTFVEETTNVVLVKAETEEKAREMVNSGDFSGDEVTDRDHFEITKVDKEGS*
Ga0160423_1107999833300012920Surface SeawaterMKIFNITFTEECTSQVKIKANTLEEAKKIVNSGDFTGDEIIDRDHFEIIESYQESEE*
Ga0160423_1116006823300012920Surface SeawaterMKTYVIDFVEEVTSQVKIKAKTLKEAEEILNSGDFTGDEVIDRDHFQIINIYEESEE*
Ga0116816_103727333300014030MarineMKTYVIDFVEEVTSQVKIKANTLEEAKKIVNSGDFTGDEIIDRDHFEIIKSYQESEGE*
Ga0181377_100925233300017706MarineMKVFNITFVEECTSQVKIKAETLEKAKEIVNSGDFSGDEIIDRDHFQITESYEESEE
Ga0181403_100873253300017710SeawaterMKVYNITFVEECTSQVKIKAETLEKAKEIVNSGDFSGDEIIERDHFQITKSYEESEEINDTI
Ga0181403_103565923300017710SeawaterMKVYNITFVEECTSQVKIKAKTLEEAKEIVSSGDFSGDEIIERDHFQITESYEESEE
Ga0181403_106869113300017710SeawaterMKVYNITFVEECTSQVKIKAKTLEEAKEIVNSGDFSGDEIIERDHFQITESYEESEDQ
Ga0181391_104667513300017713SeawaterMKVYNITFVEECTSQVKIKAETLEKAKEIVNSGDFSGDEIVDRDHFQITESYEESEE
Ga0181391_108893713300017713SeawaterMKVYNITFVEECTSQVKIKAKTLEEAKKIVNSGDFSGDEIIERDHFQITE
Ga0181404_109698133300017717SeawaterMKTYVIDFVEEVTSQVKIQAKNLKEAEKIVSSGDFMGDEVIERDQFQITGSYEEGEE
Ga0181404_117797823300017717SeawaterMKVYNITFVEECTSQVKIKAETLEKAKEIVNSGDFSGDEIIDRDHFQITESYEESKEG
Ga0181390_1013062103300017719SeawaterMKVYNITFVEECTSQVKIKAETLEKAKEIVNSGDFSGDEIIDRDHFQITESYKESEE
Ga0181390_110010933300017719SeawaterMKVYNITFVEECKSQVKIKAETLEKAKEIVNSGDFSGDEIIERDHFQITESYEESEE
Ga0181383_120737613300017720SeawaterMKVYNITFVEECTSQVKIKAKTLEEAKEIVNSGDFSGDEIIERDHFQITESYEESEK
Ga0181398_102330143300017725SeawaterMKVYNITFVEECTSQIKIKAETLEKAKEIVNSGDFSGDEIIERDHFQITESYEGSEE
Ga0181415_107223823300017732SeawaterMKVYNITFVEECTSQVKIKAKTLEEAKEIVNSGDFSGDEIIERDHFQITESYEESEAINDXAEQVPCLW
Ga0187222_101308683300017734SeawaterMKVYNITFVEECTSQVKIKAETLEKAKEIVNSGDFSGDEIIERDHFQITKSYEESEEINDTIXKTTSI
Ga0187218_108988413300017737SeawaterMKVYNITFVEECTSQVKIKAKTLEEAKKIVNSGDFSGDEIIERDHFQITESYEESEE
Ga0181397_107959013300017744SeawaterMKVYNITFVEECTSQVKIKAKTLEEAKEIVNSGDFSGDEIIERDHFQITESY
Ga0181397_117600033300017744SeawaterMKVYNITFVEECTSQVKIKAETLEKAIEIVNSGDFSGDEIIERDHFQITESYEESEE
Ga0181392_101223783300017749SeawaterMKVYNITFVEECTSQVKIKAKTLEEAKEIVNSGDFSGDEIIERDHFQI
Ga0181400_116981313300017752SeawaterMKVYNITFVEECTSQVKIKAKTLEEAKEIVSSGDFSGDEIIERDHFQITESYEGSEE
Ga0181420_103162713300017757SeawaterMKVYNITFVEECKSQVKIKAETLEKAKEIVNSGDFSGDEIIERDHFQITESYE
Ga0181420_104592763300017757SeawaterMKVYNITFVEECTSQVKIKAETLEKAKEIVNSGDFSGDEIIERDHFQITESYE
Ga0181420_115267613300017757SeawaterMKTYEIQFVEECTSRVKVKAQSEKKAREIVESGDFSGDKIIDRDHFQITEVYEEGE
Ga0181409_111638633300017758SeawaterMKVYNITFVEECKSQVKIKAETLEKAKEIVNSGDFSGDEIIERDHFQ
Ga0181409_121870613300017758SeawaterMKVYNITFVEECTSQVKIKAKTLEEAKEIVNSGDFIGDEIIERDHFQITESYEESEE
Ga0181406_104616213300017767SeawaterMKVYNITFVEECTSQVKIKAETLEKAKEIVNSSDFSGDEIIERDHFQITKSYEESEEINDTI
Ga0181430_102888063300017772SeawaterMKVYNITFVEECTSQVKIKAKTLEEAKEIVNSGDFSGDEIIERDHFQITESYEESEATND
Ga0181430_113001423300017772SeawaterMKTYEIQFVEECTSRVKVKAQSEKKAREIVESGDFSGDEIIDRDHFQITEVYEEGE
Ga0181430_123246613300017772SeawaterMKTYEIQFVEECTSRIKIKAKSEKEAKEIVESGDFSGDKIIDRDHFQITECYETELNK
Ga0181394_124164833300017776SeawaterMKVYNITFVEECTSQVKIKAKTLEEAKEIVSSGDFSGDEIIERDHFQITESYEESEK
Ga0181380_101779923300017782SeawaterMKVYNITFVEECTSQVKIKAETLEKAKEIVNSGDFSGDEIIDRDHFQITESYEESEK
Ga0181607_1016462053300017950Salt MarshMKTFNITFTEECTSEVKIKANTLDEAIKIVESGNFVNDEIIDRDHFQITDTYEIESEDK
Ga0181607_1047339633300017950Salt MarshMKVYNISFVELVTSQVKIKAKTLEEAKEIVNSGDFSGDEVIDRDNFEITESYEESEGK
Ga0181580_1025096143300017956Salt MarshMKTYVIDFVEEVTSQVKIQAKNLKEAEKIVSSGDFMGDEVIERDHFQITGSYEEGEK
Ga0181600_1014170563300018036Salt MarshMKVYNISFVELVTSQVKIKAKTLEEAKEIVNSGDFTGDEVIDRDNFEITESYEESEEIK
Ga0181601_1021391023300018041Salt MarshMKVYNISFVELVTSQVKIKAKTLEEAKEIVNSGDFTGDEVIDRDNFEITESYEESEEIKXHQQKKKV
Ga0181553_1004201093300018416Salt MarshMKVYNISFVELVTSQVKIKAKTLEEAKEIVNSGDFTGDEVIDRDNFEITESYEESE
Ga0181553_1029363953300018416Salt MarshMKTYVIDFVEEVTSQVKIKAKNLEEAEKIVNHGYFNNEEIIERDHLQI
Ga0181553_1029730013300018416Salt MarshNISFVELVTSQVKIKAKTLEEAKEIVNSGDFTGDEVIDRDNFEITESYEESKGK
Ga0181553_1051440833300018416Salt MarshMKTYVIDFVEEVTSQVKIQAKTLEEAKEIVNNGDFSGDEVIDRDNFEITESYEESE
Ga0193974_106850223300019726SedimentMKVYNITFVEECTSQVKIKAETLEKAKEIVNSGDFSGDEIIERDHFQITESYEESEE
Ga0181595_1010084343300020053Salt MarshMKTFNITFTEECTSEVKIKANTLDEAIKIVESGNFVNDEIIDRDHFQITDTYEIESEDKXKNNIHFGVMLISE
Ga0181603_1032048933300020174Salt MarshTLQQCKKFKRIQATTKTKREEIKMKVYNISFVELVTSQVKIKAKTLEEAKEIVNSGDFTGDEVIDRDNFEITESYEESEEIK
Ga0181605_1026756913300020188Salt MarshEECTSQVKIKAKTLEEAEEIVNSGDFTGDEIIERDHFQITESYEESEGK
Ga0181604_1008599663300020191Salt MarshMKTFNITFTEECTSEVKIKANTLDEAIKIVESGNFVNDEIIDRDHFQITDT
Ga0211532_1014737633300020403MarineMIFEIKFVEECTSKVKIKADNLEKAKEIVNSGDFTGDEIIERDHFEITQAYPIEEENNDAKR
Ga0211708_1009673623300020436MarineMKEYSITFVEEVTSEVKIKANTLEEAKKIVNSGDFKGEEIIDRDHFEITEAYEEEGEISKGYVPPYSEGEE
Ga0211558_1028816833300020439MarineMKTYVIDFVEEVTSQVKIKAKNLEEAEKIVNSGDFIGDEVIDRDHFQITNIYEE
Ga0211577_1061898133300020469MarineMKVYNITFVEECTSQVKIKAETLEKAKEIVNSGDFSGDEIIDRDHFQITESYEESEE
Ga0211579_1005265023300020472MarineMKIFNITFTEECTSQVKIKANTLEEAKKIVNSGDFMGDEIIDRDHFEIIESYQESEGE
Ga0213867_112371013300021335SeawaterMKVYNITFVEECTSQVKIKAETLEKAKEIVNSGDFTGDEIIERDHFQITESYEESEDHE
Ga0213863_1019751643300021371SeawaterATTKTKREEIKMKVYNITFVEECTSQVKIKAKTLEEAEKIVNSGDFTGDEIIERDHFQITESYEESEGK
Ga0213865_1012876043300021373SeawaterMKTYVIDFVEEVTSQVKIQAKTLEEAKEIVNSGDFSGDEVIDRDNFEITESYEESEGK
Ga0213869_1003149673300021375SeawaterMKVYNITFVEECTSQVKIKAETLEKAKEIVNSGDFSGDEIIERDHFQITESYEESEEINE
Ga0222718_1002228573300021958Estuarine WaterMKTYVIDFIEEVTSQVKIQAKNLKEAEKIVSSGDFMGDEVIERDHFQITGSYEEGEE
Ga0222718_1027128033300021958Estuarine WaterMKTYVIDFVEEVTSQVKIQAKNLKEAEKIVSSGDFMGDEVIERDHFQITGSYEEGEE
Ga0222716_1009174283300021959Estuarine WaterMKTYVIDFIEEVTSQVKIQAKNLKEAEKIVSSGDFMGDEVIERDHFQITGSYEEG
Ga0212030_100962913300022053AqueousMKTFNITFVEEVTSQVKIEAETLEEAKEMVDFGNFVNDEIIERDHFQITESYEESEKNND
Ga0212025_103416533300022057AqueousMKTFNITFTEECTSEVKIKANTLDEAIKIVESGNFVNDEIIDRDHFQITDTYEIESEE
Ga0212024_105895433300022065AqueousMKVYNITFVEECTSQVKIKAKTLEEAKEIVNSGDFTGDEIIERDHFQITESYEESEGK
Ga0212026_102185833300022069AqueousMKVYNITFVEECTSQVKIKAETLEKAKEIVNSGDFTGDEIIERDHFQITESYEESEGK
Ga0224906_110700723300022074SeawaterMKVYNITFVEECTSQVKIKAKTLEEAKEIVNSGDFSGDEIIERDHFQITESYEESEAIND
Ga0196891_106506043300022183AqueousVEECTSQVKIKAETLEKAKEIVNSGDFSGDEIIERDHFQITESYEESEE
Ga0196891_108320833300022183AqueousNITFVEECTSQVKIKAETLEKAKEIVNSGDFTGDEIIERDHFQITESYEESEDHE
Ga0196899_101242413300022187AqueousSVMKTYVIDFVEEVTSQVKIQAKNLKEAEKIVSSGDFMGDEVIERDHFQITGSYEEGEE
Ga0222646_100040883300022822Saline WaterMKIYEITFIEECTSKVKIEANSLEEATKIVESGDFVNDEIVDRDHFQITNINEA
Ga0222631_101923153300022843Saline WaterMNKMKIYEITFIEECTSKVKIEANSLEEATKIVESGDFVNDEIVDRDHFQITNINEA
Ga0255773_1024042313300022925Salt MarshMKTYVIDFVEEVTSQVKIQAKTLEEAKEIVNNGDFSGDEVIDRDNFEITESYEE
Ga0255753_112002153300022926Salt MarshKKFKRIQATTKTKREEIKMKVYNISFVELVTSQVKIKAKTLEEAKEIVNSGDFTGDEVIDRDNFEITESYEESEEIK
Ga0255769_1017226413300022927Salt MarshKMKVYNISFVELVTSQVKIKAKTLEEAKEIVNSGDFTGDEVIDRDNFEITESYEESEEIK
Ga0255758_1031535143300022928Salt MarshIDFVEEVTSQVKIQAKNLKEAEKIVSSGDFMGDEVIERDHFQITGSYEEGEK
Ga0210003_115581013300024262Deep SubsurfaceIDFVEEVTSQVKIQAKNLKEAEKIVSSGDFMGDEVIERDHFQITGSYEEGKE
Ga0209986_1036326113300024433Deep SubsurfaceMKTYVIDFVEEVTSQVKIQAKNLKEAEKIVYSGDFIGDEVIDRDHFQITGSYEE
Ga0208157_109126413300025086MarineMKVYNITFVEECTSQVKIKAETLEKAKEIVNSGDFTGDEIIERDHFQITESYEESEDQ
Ga0208159_102091823300025101MarineVKTFNITFVEECTSQVKIKAKTLEKAKEIVNSGDFTGDEIIERDHFEITESYEESK
Ga0208158_100739433300025110MarineMKVYNITFVEECTSQVKIKAKTLEEAKEIVNSGDFSGDEIIDRDNFQITESYEESEEINA
Ga0209535_1029206103300025120MarineMKVYNITFVEECTSQVKIKAETLEKAKEIVNSGDFSGDEIVDRDHFQITESYEESKEG
Ga0209535_103907823300025120MarineMKVYNITFVEECTSQVKIKAETLEKAKEIVNSGDFSDDEIIERDHFQITESYEESEDQ
Ga0209535_119438923300025120MarineMKVYNITFVEECTSQVKIKAETLEKAKEIVNSGDFSGDEIIERDHFQITESYEESEDQ
Ga0208919_114938123300025128MarineMKVYNITFVEECTSQVKIKAKTLEEAKEIVKSGDFSGDEIIERDHFQITESYEESEE
Ga0209337_132883523300025168MarineMKVYNITFVEECTSQVKIKAKTLEEAKEIVNSGDFSGDEIIERDHFQITESYEESEE
Ga0208148_104428723300025508AqueousMKVYNITFVEECTSQVKIKAETLEKAKEIVNSGDFSGDEIIERDHFQITENYEESEE
Ga0208148_109929813300025508AqueousMKVYNITFVEECTSQVKIKAETLEKAKEIVNSGDFSGDEIIERDHFQITESYEEREE
Ga0208898_106432223300025671AqueousMNTKKIFKITFVEEVTSSVKIEANTLEEAIKIVESGDFVGDEIEERDHFQITNSYEV
Ga0208543_115374813300025810AqueousNITFVEECTSQVKIKAKTLEEAKEIVNSGDFTGDEIIERDHFQITESYEESEGK
Ga0208645_101030283300025853AqueousMKTFNITFVEEVTSQVKIEAETLEKAEQIIERDHFQITESYEESEVA
Ga0208645_123251443300025853AqueousMKVYNITFVEECTSQVKIKAKTLEEAEKIVNSGDFTGDEIIERDHFQITESYEESEE
Ga0208644_136215723300025889AqueousMGNKWRFVMKTYVIDFVEEVTSQVKIQAKNLKEAEKIVSSGDFMGDEVIERDHFQITGSYEEGEE
Ga0209951_107813233300026138Pond WaterNATKISGGIMKTYVIDFIEEVTSQVKIQAKNLKEAEKIVSSGDFMGDEVIERDHFQITGSYEEGEE
Ga0209929_106863033300026187Pond WaterMSKKMKIFRIKFVEECTSEVLINAETLEQAKEIVRSGHFMGDEIIERDHFQITNGYETMKGNK
Ga0207992_103673943300026263MarineMKIYKIKFVEECTSSVKVKAQSEKKAREIVESGDFSGDEIIDRDHFQITECYETGLNK
Ga0209710_120945213300027687MarineMKTFNITFVEEVTSQVKIKAKTLEKAEEIVESGNFANDEIIERDHFQITESYEEIENFVHKYKNFIRN
(restricted) Ga0233415_1009205253300027861SeawaterMKTYVIDFVEEVTSQVKIQAKNLKEAEKIVSSGDFMGDEVIERDHFQITGSYEEGKE
(restricted) Ga0233415_1023867633300027861SeawaterMKVYNITFVEECTSQVKIKAKTLEEAEEIVNSGDFTGDEIIERDHFQITESYEESEK
(restricted) Ga0233415_1041465833300027861SeawaterMKVYNITFVEECTSQVKIKAETLEKAKEIVNSGDFSGDEIIERDHFQITESYEESEK
Ga0209284_1000201413300027983FreshwaterKMKIYEITFIEECTSKVKIEANSLEEATKIVESGDFVNDEIVDRDHFQITNINEA
Ga0183683_1000084643300029309MarineMKTFNITFVEETKSQVRIEAETLEKAKEIVNSGNFSGDEIIDRDHFEITDAYEDEGEDQ
Ga0183683_102943233300029309MarineMKVYNITFIEECTSQVKIKAETLEKAKEIVNSGDFSGDEIIERDHFQITESYEESEE
Ga0185543_104435023300029318MarineMAVYKVTFVEETTNVVLVKAETEEKAREMVNSGDFSGDEVTDRDHFEITKVDKEGS
Ga0183755_102958333300029448MarineMKVYNITFVEECTSQVKIKAETLEKAKEIVNSGNFSGDEIIERDHFQITESYEESEE
Ga0307379_1123282633300031565SoilITFVEKVTSQVKIEAETLEEAKEMVDFGNFANDEIIERDHFQITESYEESEE
Ga0302136_108655843300031676MarineKTFNITFVEEVTSQVKIKAKTLEKAEEIVESGNFANDEIIERDHFQITESYEEIENFVHKYKNFIRN
Ga0316202_1057095133300032277Microbial MatIQTTTKTKREEIKMKVYNITFVEECTSQVKIKAKTLEEAKEIVNSGDFTGDEIIERDHFQITESYEESEGK
Ga0335396_1002266713300032462FreshwaterNKMKIYEITFIEECTSKVKIEANSLEEATKIVESGDFVNDEIVDRDHFQITNINEA
Ga0348335_079510_55_2703300034374AqueousLWEIILTTNNKGETMNTKKIFKITFVEEVTSSVKIEANTLEEAIKIVESGDFVGDEIEERDHFQITNSYEV
Ga0348336_029605_2072_22423300034375AqueousMKVYNITFVEECTSQVKIKAETLEKAKEIVNSGEFTGDEIIERDHFQITEIYEESE
Ga0348336_053604_1012_11883300034375AqueousMKTFNITFVEEVTSQVKIEAETLEKAEQIIESGNFVNDEIIERDHFQITESYEESEVA
Ga0348336_053856_1345_15213300034375AqueousMKVYNISFVELVTSQVKIKAKTLEEAKEIVNSGDFTGDEVIDRDNFEITESYEESEGK


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.