| Basic Information | |
|---|---|
| Family ID | F029529 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 188 |
| Average Sequence Length | 47 residues |
| Representative Sequence | MNVQYLLFVIAILLVLIFWELSKINSRLKKTLVPPQDIMKDNKHKEP |
| Number of Associated Samples | 132 |
| Number of Associated Scaffolds | 188 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 79.26 % |
| % of genes near scaffold ends (potentially truncated) | 18.62 % |
| % of genes from short scaffolds (< 2000 bps) | 73.40 % |
| Associated GOLD sequencing projects | 114 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.41 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (75.532 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (14.894 % of family members) |
| Environment Ontology (ENVO) | Unclassified (29.255 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (44.681 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 40.00% β-sheet: 0.00% Coil/Unstructured: 60.00% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.41 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 188 Family Scaffolds |
|---|---|---|
| PF07075 | DUF1343 | 6.91 |
| PF02405 | MlaE | 3.72 |
| PF13181 | TPR_8 | 1.60 |
| PF07238 | PilZ | 1.60 |
| PF04228 | Zn_peptidase | 1.06 |
| PF01738 | DLH | 1.06 |
| PF00144 | Beta-lactamase | 1.06 |
| PF03721 | UDPG_MGDP_dh_N | 1.06 |
| PF12681 | Glyoxalase_2 | 1.06 |
| PF08323 | Glyco_transf_5 | 0.53 |
| PF01192 | RNA_pol_Rpb6 | 0.53 |
| PF00069 | Pkinase | 0.53 |
| PF13649 | Methyltransf_25 | 0.53 |
| PF13563 | 2_5_RNA_ligase2 | 0.53 |
| PF00248 | Aldo_ket_red | 0.53 |
| PF04989 | CmcI | 0.53 |
| PF02195 | ParBc | 0.53 |
| PF12244 | DUF3606 | 0.53 |
| PF02954 | HTH_8 | 0.53 |
| PF01548 | DEDD_Tnp_IS110 | 0.53 |
| PF12697 | Abhydrolase_6 | 0.53 |
| PF07690 | MFS_1 | 0.53 |
| PF04014 | MazE_antitoxin | 0.53 |
| PF01865 | PhoU_div | 0.53 |
| PF02894 | GFO_IDH_MocA_C | 0.53 |
| PF12867 | DinB_2 | 0.53 |
| PF01425 | Amidase | 0.53 |
| PF13185 | GAF_2 | 0.53 |
| PF05598 | DUF772 | 0.53 |
| PF00072 | Response_reg | 0.53 |
| PF00106 | adh_short | 0.53 |
| PF05193 | Peptidase_M16_C | 0.53 |
| PF00293 | NUDIX | 0.53 |
| PF14622 | Ribonucleas_3_3 | 0.53 |
| PF00034 | Cytochrom_C | 0.53 |
| PF13592 | HTH_33 | 0.53 |
| PF12680 | SnoaL_2 | 0.53 |
| PF16355 | DUF4982 | 0.53 |
| PF00557 | Peptidase_M24 | 0.53 |
| PF00892 | EamA | 0.53 |
| PF13646 | HEAT_2 | 0.53 |
| PF16576 | HlyD_D23 | 0.53 |
| PF14319 | Zn_Tnp_IS91 | 0.53 |
| PF16363 | GDP_Man_Dehyd | 0.53 |
| PF13507 | GATase_5 | 0.53 |
| PF13620 | CarboxypepD_reg | 0.53 |
| PF00011 | HSP20 | 0.53 |
| COG ID | Name | Functional Category | % Frequency in 188 Family Scaffolds |
|---|---|---|---|
| COG3876 | Exo-beta-N-acetylmuramidase YbbC/NamZ, DUF1343 family | Cell wall/membrane/envelope biogenesis [M] | 6.91 |
| COG0767 | Permease subunit MlaE of the ABC-type intermembrane phospholipid transporter Mla | Cell wall/membrane/envelope biogenesis [M] | 3.72 |
| COG0515 | Serine/threonine protein kinase | Signal transduction mechanisms [T] | 2.13 |
| COG1250 | 3-hydroxyacyl-CoA dehydrogenase | Lipid transport and metabolism [I] | 1.06 |
| COG2367 | Beta-lactamase class A | Defense mechanisms [V] | 1.06 |
| COG2321 | Predicted metalloprotease | General function prediction only [R] | 1.06 |
| COG1893 | Ketopantoate reductase | Coenzyme transport and metabolism [H] | 1.06 |
| COG1686 | D-alanyl-D-alanine carboxypeptidase | Cell wall/membrane/envelope biogenesis [M] | 1.06 |
| COG1680 | CubicO group peptidase, beta-lactamase class C family | Defense mechanisms [V] | 1.06 |
| COG1004 | UDP-glucose 6-dehydrogenase | Cell wall/membrane/envelope biogenesis [M] | 1.06 |
| COG0677 | UDP-N-acetyl-D-mannosaminuronate dehydrogenase | Cell wall/membrane/envelope biogenesis [M] | 1.06 |
| COG0240 | Glycerol-3-phosphate dehydrogenase | Energy production and conversion [C] | 1.06 |
| COG0071 | Small heat shock protein IbpA, HSP20 family | Posttranslational modification, protein turnover, chaperones [O] | 0.53 |
| COG1392 | Phosphate transport regulator YkaA, distantly related to PhoU, UPF0111/DUF47 family | Inorganic ion transport and metabolism [P] | 0.53 |
| COG0673 | Predicted dehydrogenase | General function prediction only [R] | 0.53 |
| COG1758 | DNA-directed RNA polymerase, subunit K/omega | Transcription [K] | 0.53 |
| COG0438 | Glycosyltransferase involved in cell wall bisynthesis | Cell wall/membrane/envelope biogenesis [M] | 0.53 |
| COG0297 | Glycogen synthase | Carbohydrate transport and metabolism [G] | 0.53 |
| COG3510 | Cephalosporin hydroxylase | Defense mechanisms [V] | 0.53 |
| COG3547 | Transposase | Mobilome: prophages, transposons [X] | 0.53 |
| COG0154 | Asp-tRNAAsn/Glu-tRNAGln amidotransferase A subunit or related amidase | Translation, ribosomal structure and biogenesis [J] | 0.53 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 75.53 % |
| Unclassified | root | N/A | 24.47 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2170459003|FZN2CUW02GDX9O | Not Available | 502 | Open in IMG/M |
| 2228664022|INPgaii200_c1043871 | Not Available | 726 | Open in IMG/M |
| 3300000364|INPhiseqgaiiFebDRAFT_101439089 | All Organisms → cellular organisms → Bacteria | 1226 | Open in IMG/M |
| 3300001166|JGI12694J13545_1001206 | All Organisms → cellular organisms → Bacteria | 3106 | Open in IMG/M |
| 3300001174|JGI12679J13547_1004832 | Not Available | 775 | Open in IMG/M |
| 3300001546|JGI12659J15293_10032125 | All Organisms → cellular organisms → Bacteria | 1285 | Open in IMG/M |
| 3300001593|JGI12635J15846_10086194 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2285 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_100339199 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | 1384 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_100405278 | Not Available | 1242 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_100446018 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1172 | Open in IMG/M |
| 3300003368|JGI26340J50214_10131792 | Not Available | 630 | Open in IMG/M |
| 3300004103|Ga0058903_1508865 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | 693 | Open in IMG/M |
| 3300004472|Ga0068974_1335215 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 623 | Open in IMG/M |
| 3300004475|Ga0068969_1404534 | Not Available | 700 | Open in IMG/M |
| 3300004612|Ga0068961_1284577 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 570 | Open in IMG/M |
| 3300004618|Ga0068963_1385638 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 550 | Open in IMG/M |
| 3300004631|Ga0058899_10026266 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | 1210 | Open in IMG/M |
| 3300004631|Ga0058899_12252481 | All Organisms → cellular organisms → Bacteria | 571 | Open in IMG/M |
| 3300004633|Ga0066395_10015401 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2935 | Open in IMG/M |
| 3300004633|Ga0066395_10024504 | All Organisms → cellular organisms → Bacteria | 2441 | Open in IMG/M |
| 3300005332|Ga0066388_100318327 | Not Available | 2201 | Open in IMG/M |
| 3300005434|Ga0070709_10068874 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA117 | 2277 | Open in IMG/M |
| 3300005434|Ga0070709_10342659 | All Organisms → cellular organisms → Bacteria | 1102 | Open in IMG/M |
| 3300005436|Ga0070713_100084094 | All Organisms → cellular organisms → Bacteria | 2722 | Open in IMG/M |
| 3300005436|Ga0070713_100815640 | All Organisms → cellular organisms → Bacteria | 895 | Open in IMG/M |
| 3300005436|Ga0070713_101842521 | Not Available | 587 | Open in IMG/M |
| 3300005436|Ga0070713_102466279 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 503 | Open in IMG/M |
| 3300005445|Ga0070708_100130973 | All Organisms → cellular organisms → Bacteria | 2321 | Open in IMG/M |
| 3300005446|Ga0066686_10150437 | All Organisms → cellular organisms → Bacteria | 1538 | Open in IMG/M |
| 3300005468|Ga0070707_100589415 | Not Available | 1074 | Open in IMG/M |
| 3300005533|Ga0070734_10113052 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1588 | Open in IMG/M |
| 3300005538|Ga0070731_10041643 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 3077 | Open in IMG/M |
| 3300005542|Ga0070732_10518300 | Not Available | 722 | Open in IMG/M |
| 3300005545|Ga0070695_100570513 | Not Available | 884 | Open in IMG/M |
| 3300005569|Ga0066705_10379488 | Not Available | 888 | Open in IMG/M |
| 3300005764|Ga0066903_100265936 | All Organisms → cellular organisms → Bacteria | 2668 | Open in IMG/M |
| 3300006028|Ga0070717_10020681 | All Organisms → cellular organisms → Bacteria | 5180 | Open in IMG/M |
| 3300006052|Ga0075029_100551859 | Not Available | 765 | Open in IMG/M |
| 3300006059|Ga0075017_100263996 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1262 | Open in IMG/M |
| 3300006059|Ga0075017_100899259 | Not Available | 687 | Open in IMG/M |
| 3300006102|Ga0075015_100832504 | Not Available | 556 | Open in IMG/M |
| 3300006162|Ga0075030_100060054 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3155 | Open in IMG/M |
| 3300006162|Ga0075030_100967769 | Not Available | 670 | Open in IMG/M |
| 3300006173|Ga0070716_100211338 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1297 | Open in IMG/M |
| 3300006174|Ga0075014_100282742 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 868 | Open in IMG/M |
| 3300006175|Ga0070712_101576725 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | 574 | Open in IMG/M |
| 3300006893|Ga0073928_10015835 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 8177 | Open in IMG/M |
| 3300006893|Ga0073928_10043627 | All Organisms → cellular organisms → Bacteria | 4117 | Open in IMG/M |
| 3300006893|Ga0073928_10050058 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3777 | Open in IMG/M |
| 3300006893|Ga0073928_10727264 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 690 | Open in IMG/M |
| 3300006893|Ga0073928_11226212 | All Organisms → cellular organisms → Bacteria | 504 | Open in IMG/M |
| 3300007982|Ga0102924_1151156 | All Organisms → cellular organisms → Bacteria | 1072 | Open in IMG/M |
| 3300007982|Ga0102924_1282729 | Not Available | 668 | Open in IMG/M |
| 3300009038|Ga0099829_10084242 | All Organisms → cellular organisms → Bacteria | 2441 | Open in IMG/M |
| 3300009038|Ga0099829_10122272 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2050 | Open in IMG/M |
| 3300009089|Ga0099828_10222024 | All Organisms → cellular organisms → Bacteria | 1689 | Open in IMG/M |
| 3300009090|Ga0099827_10024972 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 4221 | Open in IMG/M |
| 3300009090|Ga0099827_11977894 | Not Available | 507 | Open in IMG/M |
| 3300009683|Ga0116224_10515555 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 570 | Open in IMG/M |
| 3300010046|Ga0126384_10388315 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | 1175 | Open in IMG/M |
| 3300010048|Ga0126373_13232544 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | 507 | Open in IMG/M |
| 3300010341|Ga0074045_10156835 | All Organisms → cellular organisms → Bacteria | 1543 | Open in IMG/M |
| 3300010361|Ga0126378_10006282 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 9315 | Open in IMG/M |
| 3300010361|Ga0126378_10160934 | Not Available | 2295 | Open in IMG/M |
| 3300010361|Ga0126378_11069769 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | 908 | Open in IMG/M |
| 3300010362|Ga0126377_11967704 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 660 | Open in IMG/M |
| 3300010366|Ga0126379_10005705 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | 8325 | Open in IMG/M |
| 3300010366|Ga0126379_10597007 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1189 | Open in IMG/M |
| 3300010379|Ga0136449_100217613 | All Organisms → cellular organisms → Bacteria | 3600 | Open in IMG/M |
| 3300010379|Ga0136449_100386354 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2493 | Open in IMG/M |
| 3300011075|Ga0138555_1092324 | Not Available | 835 | Open in IMG/M |
| 3300011120|Ga0150983_13698282 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 526 | Open in IMG/M |
| 3300011120|Ga0150983_14785811 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 549 | Open in IMG/M |
| 3300012189|Ga0137388_10041826 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 3657 | Open in IMG/M |
| 3300012200|Ga0137382_10207416 | Not Available | 1348 | Open in IMG/M |
| 3300012200|Ga0137382_10397211 | All Organisms → cellular organisms → Bacteria | 971 | Open in IMG/M |
| 3300012201|Ga0137365_10342457 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1105 | Open in IMG/M |
| 3300012206|Ga0137380_10220862 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1714 | Open in IMG/M |
| 3300012206|Ga0137380_10512424 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1056 | Open in IMG/M |
| 3300012207|Ga0137381_10170064 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1881 | Open in IMG/M |
| 3300012207|Ga0137381_10806448 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 814 | Open in IMG/M |
| 3300012208|Ga0137376_10850962 | All Organisms → cellular organisms → Bacteria | 784 | Open in IMG/M |
| 3300012209|Ga0137379_11655714 | Not Available | 537 | Open in IMG/M |
| 3300012210|Ga0137378_10064081 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3327 | Open in IMG/M |
| 3300012211|Ga0137377_10660720 | All Organisms → cellular organisms → Bacteria | 981 | Open in IMG/M |
| 3300012351|Ga0137386_11062372 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 573 | Open in IMG/M |
| 3300012357|Ga0137384_10882681 | Not Available | 721 | Open in IMG/M |
| 3300012357|Ga0137384_11148566 | Not Available | 620 | Open in IMG/M |
| 3300012362|Ga0137361_10546673 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1063 | Open in IMG/M |
| 3300012582|Ga0137358_10062155 | All Organisms → cellular organisms → Bacteria | 2497 | Open in IMG/M |
| 3300012683|Ga0137398_11158495 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 530 | Open in IMG/M |
| 3300012924|Ga0137413_11642803 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | 526 | Open in IMG/M |
| 3300012929|Ga0137404_10325275 | All Organisms → cellular organisms → Bacteria | 1339 | Open in IMG/M |
| 3300014164|Ga0181532_10005442 | All Organisms → cellular organisms → Bacteria | 10809 | Open in IMG/M |
| 3300014501|Ga0182024_10000505 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 100432 | Open in IMG/M |
| 3300014501|Ga0182024_10024698 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 10664 | Open in IMG/M |
| 3300014501|Ga0182024_10025146 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 10535 | Open in IMG/M |
| 3300014501|Ga0182024_11050812 | All Organisms → cellular organisms → Bacteria | 966 | Open in IMG/M |
| 3300015242|Ga0137412_10828387 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 677 | Open in IMG/M |
| 3300015264|Ga0137403_10223247 | All Organisms → cellular organisms → Bacteria | 1806 | Open in IMG/M |
| 3300017936|Ga0187821_10031344 | All Organisms → cellular organisms → Bacteria | 1877 | Open in IMG/M |
| 3300018006|Ga0187804_10286027 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | 716 | Open in IMG/M |
| 3300019888|Ga0193751_1002813 | All Organisms → cellular organisms → Bacteria | 10463 | Open in IMG/M |
| 3300020580|Ga0210403_10053365 | All Organisms → cellular organisms → Bacteria | 3234 | Open in IMG/M |
| 3300020580|Ga0210403_10189635 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1686 | Open in IMG/M |
| 3300020581|Ga0210399_10234854 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1527 | Open in IMG/M |
| 3300020581|Ga0210399_10316404 | All Organisms → cellular organisms → Bacteria | 1303 | Open in IMG/M |
| 3300020582|Ga0210395_10234372 | All Organisms → cellular organisms → Bacteria | 1378 | Open in IMG/M |
| 3300021171|Ga0210405_10028426 | All Organisms → cellular organisms → Bacteria | 4492 | Open in IMG/M |
| 3300021344|Ga0193719_10032270 | All Organisms → cellular organisms → Bacteria | 2260 | Open in IMG/M |
| 3300021344|Ga0193719_10351570 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 613 | Open in IMG/M |
| 3300021403|Ga0210397_10322917 | Not Available | 1138 | Open in IMG/M |
| 3300021407|Ga0210383_11734319 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | 511 | Open in IMG/M |
| 3300021420|Ga0210394_10356088 | All Organisms → cellular organisms → Bacteria | 1286 | Open in IMG/M |
| 3300021420|Ga0210394_11707854 | Not Available | 527 | Open in IMG/M |
| 3300021433|Ga0210391_10617584 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | 851 | Open in IMG/M |
| 3300021477|Ga0210398_11120554 | All Organisms → cellular organisms → Bacteria | 624 | Open in IMG/M |
| 3300021477|Ga0210398_11140666 | Not Available | 618 | Open in IMG/M |
| 3300021477|Ga0210398_11220589 | All Organisms → cellular organisms → Bacteria | 593 | Open in IMG/M |
| 3300021560|Ga0126371_10010400 | All Organisms → cellular organisms → Bacteria | 8381 | Open in IMG/M |
| 3300021560|Ga0126371_10098795 | All Organisms → cellular organisms → Bacteria | 2903 | Open in IMG/M |
| 3300021860|Ga0213851_1908718 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | 755 | Open in IMG/M |
| 3300022518|Ga0224548_1019643 | All Organisms → cellular organisms → Bacteria | 740 | Open in IMG/M |
| 3300022557|Ga0212123_10008184 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 16120 | Open in IMG/M |
| 3300022557|Ga0212123_10025020 | All Organisms → cellular organisms → Bacteria | 6460 | Open in IMG/M |
| 3300022557|Ga0212123_10171866 | All Organisms → cellular organisms → Bacteria | 1643 | Open in IMG/M |
| 3300022557|Ga0212123_10332784 | All Organisms → cellular organisms → Bacteria | 1046 | Open in IMG/M |
| 3300022557|Ga0212123_10776396 | Not Available | 579 | Open in IMG/M |
| 3300025910|Ga0207684_10098726 | Not Available | 2494 | Open in IMG/M |
| 3300025915|Ga0207693_10483731 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 967 | Open in IMG/M |
| 3300025928|Ga0207700_10500391 | Not Available | 1075 | Open in IMG/M |
| 3300025928|Ga0207700_11414742 | All Organisms → cellular organisms → Bacteria | 618 | Open in IMG/M |
| 3300025929|Ga0207664_10602441 | Not Available | 987 | Open in IMG/M |
| 3300026490|Ga0257153_1026710 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1188 | Open in IMG/M |
| 3300026920|Ga0208575_1016575 | Not Available | 672 | Open in IMG/M |
| 3300027527|Ga0209684_1082944 | Not Available | 503 | Open in IMG/M |
| 3300027575|Ga0209525_1140273 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | 557 | Open in IMG/M |
| 3300027591|Ga0209733_1000516 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 7391 | Open in IMG/M |
| 3300027591|Ga0209733_1094412 | Not Available | 758 | Open in IMG/M |
| 3300027619|Ga0209330_1015477 | All Organisms → cellular organisms → Bacteria | 1704 | Open in IMG/M |
| 3300027635|Ga0209625_1064598 | Not Available | 818 | Open in IMG/M |
| 3300027648|Ga0209420_1005095 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 5322 | Open in IMG/M |
| 3300027652|Ga0209007_1001855 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 6093 | Open in IMG/M |
| 3300027660|Ga0209736_1026215 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1754 | Open in IMG/M |
| 3300027745|Ga0209908_10093323 | All Organisms → cellular organisms → Bacteria | 735 | Open in IMG/M |
| 3300027812|Ga0209656_10011116 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 5668 | Open in IMG/M |
| 3300027826|Ga0209060_10024217 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3126 | Open in IMG/M |
| 3300027846|Ga0209180_10142350 | All Organisms → cellular organisms → Bacteria | 1380 | Open in IMG/M |
| 3300027874|Ga0209465_10467336 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | 631 | Open in IMG/M |
| 3300027898|Ga0209067_10397994 | Not Available | 771 | Open in IMG/M |
| 3300027898|Ga0209067_10904833 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 518 | Open in IMG/M |
| 3300027908|Ga0209006_10610892 | Not Available | 900 | Open in IMG/M |
| 3300027911|Ga0209698_10069671 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3010 | Open in IMG/M |
| 3300027911|Ga0209698_10591963 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | 853 | Open in IMG/M |
| 3300028800|Ga0265338_10051431 | All Organisms → cellular organisms → Bacteria | 3709 | Open in IMG/M |
| 3300028906|Ga0308309_10177887 | All Organisms → cellular organisms → Bacteria | 1735 | Open in IMG/M |
| 3300030548|Ga0210252_10968943 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | 559 | Open in IMG/M |
| 3300030853|Ga0075372_10822448 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 693 | Open in IMG/M |
| 3300030945|Ga0075373_10603984 | Not Available | 523 | Open in IMG/M |
| 3300030991|Ga0073994_11375218 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1008 | Open in IMG/M |
| 3300031057|Ga0170834_109265148 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | 739 | Open in IMG/M |
| 3300031057|Ga0170834_111830146 | Not Available | 608 | Open in IMG/M |
| 3300031057|Ga0170834_113056313 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1166 | Open in IMG/M |
| 3300031128|Ga0170823_13896048 | All Organisms → cellular organisms → Bacteria | 1148 | Open in IMG/M |
| 3300031231|Ga0170824_107881173 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 660 | Open in IMG/M |
| 3300031231|Ga0170824_108973746 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 654 | Open in IMG/M |
| 3300031231|Ga0170824_115287877 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | 2114 | Open in IMG/M |
| 3300031231|Ga0170824_120766347 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1691 | Open in IMG/M |
| 3300031344|Ga0265316_10898629 | Not Available | 619 | Open in IMG/M |
| 3300031446|Ga0170820_15071326 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1650 | Open in IMG/M |
| 3300031469|Ga0170819_10024122 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 954 | Open in IMG/M |
| 3300031469|Ga0170819_14228404 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 625 | Open in IMG/M |
| 3300031474|Ga0170818_103923619 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1124 | Open in IMG/M |
| 3300031708|Ga0310686_111571776 | All Organisms → cellular organisms → Bacteria | 5823 | Open in IMG/M |
| 3300031715|Ga0307476_10108311 | Not Available | 1967 | Open in IMG/M |
| 3300031715|Ga0307476_10197561 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1459 | Open in IMG/M |
| 3300031715|Ga0307476_11207336 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | 553 | Open in IMG/M |
| 3300031718|Ga0307474_10167550 | All Organisms → cellular organisms → Bacteria | 1663 | Open in IMG/M |
| 3300031720|Ga0307469_10214078 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1517 | Open in IMG/M |
| 3300031720|Ga0307469_11758560 | Not Available | 598 | Open in IMG/M |
| 3300031754|Ga0307475_10999168 | Not Available | 658 | Open in IMG/M |
| 3300031962|Ga0307479_11642939 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 597 | Open in IMG/M |
| 3300032160|Ga0311301_10507292 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1785 | Open in IMG/M |
| 3300032160|Ga0311301_10683555 | Not Available | 1449 | Open in IMG/M |
| 3300032160|Ga0311301_11177070 | Not Available | 986 | Open in IMG/M |
| 3300032174|Ga0307470_10054244 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2071 | Open in IMG/M |
| 3300033977|Ga0314861_0000489 | All Organisms → cellular organisms → Bacteria | 62964 | Open in IMG/M |
| 3300033977|Ga0314861_0367409 | Not Available | 636 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 14.89% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 11.17% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 10.11% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 8.51% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 6.38% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 6.38% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 5.85% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 5.85% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 5.32% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 4.79% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 3.19% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.13% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 2.13% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 2.13% |
| Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost | 2.13% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 1.06% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 1.06% |
| Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland | 1.06% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 1.06% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 1.06% |
| Watersheds | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Watersheds | 0.53% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 0.53% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil | 0.53% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.53% |
| Thawing Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Thawing Permafrost | 0.53% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.53% |
| Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 0.53% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2170459003 | Grass soil microbial communities from Rothamsted Park, UK - March 2009 indirect MP BIO 1O1 lysis 0-21cm | Environmental | Open in IMG/M |
| 2228664022 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300001166 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_O2 | Environmental | Open in IMG/M |
| 3300001174 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M1 | Environmental | Open in IMG/M |
| 3300001546 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O1 | Environmental | Open in IMG/M |
| 3300001593 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 | Environmental | Open in IMG/M |
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300003368 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM2 | Environmental | Open in IMG/M |
| 3300004103 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF242 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004472 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 71 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004475 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 62 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004612 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 53 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004618 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 55 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004631 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF234 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004633 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
| 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005446 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 | Environmental | Open in IMG/M |
| 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
| 3300005533 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1 | Environmental | Open in IMG/M |
| 3300005538 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 | Environmental | Open in IMG/M |
| 3300005542 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 | Environmental | Open in IMG/M |
| 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Environmental | Open in IMG/M |
| 3300005569 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006052 | Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013 | Environmental | Open in IMG/M |
| 3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
| 3300006102 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2013 | Environmental | Open in IMG/M |
| 3300006162 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 | Environmental | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006174 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2014 | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006893 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG | Environmental | Open in IMG/M |
| 3300007982 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPM 11 metaG | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009683 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_b_LC metaG | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010341 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM2 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300011075 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 36 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
| 3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
| 3300012924 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300014164 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_30_metaG | Environmental | Open in IMG/M |
| 3300014501 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300015242 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015264 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300017936 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_1 | Environmental | Open in IMG/M |
| 3300018006 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_4 | Environmental | Open in IMG/M |
| 3300019888 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1c2 | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
| 3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
| 3300021344 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2a2 | Environmental | Open in IMG/M |
| 3300021403 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O | Environmental | Open in IMG/M |
| 3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
| 3300021477 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300021860 | Metatranscriptome of freshwater sediment microbial communities from post-fracked creek in Pennsylvania, United States - ABR_2014 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300022518 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 P2 20-24 | Environmental | Open in IMG/M |
| 3300022557 | Paint Pots_combined assembly | Environmental | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026490 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-10-A | Environmental | Open in IMG/M |
| 3300026920 | Forest soil microbial communities from Willamette National Forest, Oregon, USA, amended with Nitrogen - NN397 (SPAdes) | Environmental | Open in IMG/M |
| 3300027527 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 6 MoBio (SPAdes) | Environmental | Open in IMG/M |
| 3300027575 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027591 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027619 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027635 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027648 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027652 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027660 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027745 | Thawing permafrost microbial communities from the Arctic, studying carbon transformations - Permafrost 812P2M | Environmental | Open in IMG/M |
| 3300027812 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027826 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027874 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes) | Environmental | Open in IMG/M |
| 3300027898 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 (SPAdes) | Environmental | Open in IMG/M |
| 3300027908 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027911 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Host-Associated | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300030548 | Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO133-ANR016SO (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030853 | Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - OA8 Emin (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030945 | Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - FA10 EcM (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030991 | Metatranscriptome of forest soil microbial communities from Montana, USA - Site 5 -Soil GP-1A (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031057 | Oak Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031128 | Oak Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Host-Associated | Open in IMG/M |
| 3300031446 | Fir Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031469 | Fir Spring Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031474 | Fir Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
| 3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300033977 | Tropical peat soil microbial communities from peatlands in Loreto, Peru - SJ75 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| E4A_02208110 | 2170459003 | Grass Soil | ELKLMIIQFLLFVISILLILIFWELSKINSRLKKTLVPPDIMKHNKHKE |
| INPgaii200_10438712 | 2228664022 | Soil | MSVQFLLFVIAILLLLIFWELSKINSRLKKTLVLPKDITKDTERKEP |
| INPhiseqgaiiFebDRAFT_1014390892 | 3300000364 | Soil | MYVPFLLFIIVIVLVLIFWELSRINSRLKKMLVSTHDSVKDNKNPQP* |
| JGI12694J13545_10012062 | 3300001166 | Forest Soil | MNVQFLLFVIAILLLLIFWELSKIYSHLKKTLLPSPDIAKDDKPKKP* |
| JGI12679J13547_10048322 | 3300001174 | Forest Soil | MNVQFLLFVVAILLVLIFWELSKINSLLKRTLVPRLDINKDNKLKEP* |
| JGI12659J15293_100321252 | 3300001546 | Forest Soil | MNVQLLLFVIAILLLLIFWELSKIYSYLKKTLLPSPDIAKDDKPKKP* |
| JGI12635J15846_100861942 | 3300001593 | Forest Soil | MNVQFLLFVVAILLVLIFWELSKINSLLKRTLIPRPDINKDNKLKEP* |
| JGIcombinedJ26739_1003391992 | 3300002245 | Forest Soil | MNVLFLLFVIAILLVLIFWELSKIYSFLKKTLVPRQDIVKDNQQREP* |
| JGIcombinedJ26739_1004052782 | 3300002245 | Forest Soil | MNVQFLLFVVAILLVLIFWELSKINSLLKKTLVSSLDISKDNKLKEP* |
| JGIcombinedJ26739_1004460182 | 3300002245 | Forest Soil | MNALYLLFVIAILLVLIFWELSKINSFLKKTLVVRRDIATDNKHKEP* |
| JGI26340J50214_101317921 | 3300003368 | Bog Forest Soil | MNVQFLLFVIAILLVLIFWELSKIYSYLKKTLVPLQEVAKANKP* |
| Ga0058903_15088651 | 3300004103 | Forest Soil | AESYPMNVLFLLFVIAILLVLIFWELSKIYSFLKKTLVPRHDIAKDNQQKET* |
| Ga0068974_13352151 | 3300004472 | Peatlands Soil | MYVPFLLFVIVIVLVLIFWELSKINSRLKKSLVSTQDTTKGNNGKQP* |
| Ga0068969_14045341 | 3300004475 | Peatlands Soil | MYVPFLLFVIVIVLVLIFWELSKINSRLKKSLVSTQDTTKGNNDTQPRKSK* |
| Ga0068961_12845772 | 3300004612 | Peatlands Soil | MYVPFLLFVIVIVLVLIFCELSKINSRLKKSLVSTQDTTKGNNDTQPRKSK* |
| Ga0068963_13856382 | 3300004618 | Peatlands Soil | MYIPFLLFVIVIVLILIFWELSKINSRLKKTLVPLPDTMKANKDTQP* |
| Ga0058899_100262661 | 3300004631 | Forest Soil | MNVQLLLFVIAILLLLIFWELSKIYSYLKKTLLPSPGIAKDDQHKKP* |
| Ga0058899_122524811 | 3300004631 | Forest Soil | MNVQFWLFVIAILLLLIFWELSKINSRLKKTLVLPKDITKDTEHKEP* |
| Ga0066395_100154014 | 3300004633 | Tropical Forest Soil | MYVPFLLFVIVIVLVLIFWELSKIHSRLKKILAAPHDTMKGNKDTQP* |
| Ga0066395_100245046 | 3300004633 | Tropical Forest Soil | MYVPFLLFVVVIVLVLIFWELGKIHSRLKQMLAHTHDTMKSNKDTQL* |
| Ga0066388_1003183273 | 3300005332 | Tropical Forest Soil | MYVPFLLFVIVIVLVLIFWELSKIHSRLKKMLGFQHDTMKGNKDTQP* |
| Ga0070709_100688745 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | MYIPFLLFVIVIVLVLIFWELSKIHSRLKKMLALPLDTMKGNKDTHP* |
| Ga0070709_103426593 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | MYVPFLLFVIVIVLVLIFWELSKIHSHLKKTLVSPHDTMKGNKDTQP* |
| Ga0070713_1000840942 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | MYVPFSLFVIAIVLILIFWELSKINSLLKKTLGSFRDNVKDTKTIERP* |
| Ga0070713_1008156402 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | MNVQFLLFVIAILLLLIFWELSKIYSYLKKTLVPSRDVVKDNKP* |
| Ga0070713_1018425212 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | RMNVQFLLFVIAILLVLIFWELSKINSLLKKRLAPPADVKNDNKRNEP* |
| Ga0070713_1024662792 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | MNVQFLLFVIAILLVLIFWELSKINSRLKKTLVLPQGNMKDNKPREP* |
| Ga0070708_1001309732 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MNVQFLLFVIAILLVLVFWELSKINSLLKKRLALAQEVKSDSKQKEP* |
| Ga0066686_101504371 | 3300005446 | Soil | MIVQFLLFVIAILLILIFWELSKINSRLRKSLVPPDIMKDNKH* |
| Ga0070707_1005894152 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | MNVQFLLFVIAILLVLIFWELSKINSLLKKTLAPRQDMATDNKHKEP* |
| Ga0070734_101130522 | 3300005533 | Surface Soil | MYVPFLLFVIVIVLVLIFWELSKIHSRLKRMLAQTHDLVKGNKDMQR* |
| Ga0070731_100416431 | 3300005538 | Surface Soil | MDLLLLGAQTNKMYVPFLLFVIVIVLVLIFWELSKINSRLTKALVVPHDAVKKDRDAQP* |
| Ga0070732_105183002 | 3300005542 | Surface Soil | MNVQFLLFVVAILLVLIFWELSKINSLLKKTLVPRPDIKKDNKLSEP* |
| Ga0070695_1005705131 | 3300005545 | Corn, Switchgrass And Miscanthus Rhizosphere | MNVQFLLFVIAILLVLIFWELSKINSHLKKTLVVPSRDVLKDNKP* |
| Ga0066705_103794881 | 3300005569 | Soil | IAILLVLIFWELSKINSHLKKTLAPRQNMATDNKHKEP* |
| Ga0066903_1002659363 | 3300005764 | Tropical Forest Soil | MYVPFLLFVIVIVLVLIFWELSKIHSRLKKILAAPHETMKGNKDTQP* |
| Ga0070717_100206813 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MNIQFLLFVIAILLVLIFWELSKINSRLKKTLVLPPDIMKDNKDNKDKEP* |
| Ga0075029_1005518591 | 3300006052 | Watersheds | MNVQFLLFVIAILLVLIFWELSKIYSYLKKTLAPSHDVVKSNKP* |
| Ga0075017_1002639962 | 3300006059 | Watersheds | MNVPFLLFVIAILLVLIFWELSKIYSYLKKTLVPSHDVVKANKT* |
| Ga0075017_1008992591 | 3300006059 | Watersheds | MNVLFLLFVIAILLVLIFWELSKIYSHLKKTLVPSHDAVKSNKP* |
| Ga0075015_1008325041 | 3300006102 | Watersheds | MYAPFMLFVIVIVLVLIFWELSKINSRLRKWLVSPQDSANGNKDTQP* |
| Ga0075030_1000600544 | 3300006162 | Watersheds | MNVQLLLFVIAILLVLIFWELSKIHSYLKKTLVPSHDVVKANKA* |
| Ga0075030_1009677691 | 3300006162 | Watersheds | MNVPFLLFVIAILLVLIFWELSKIYSYLKKTLVPSHDVVKANKP* |
| Ga0070716_1002113382 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | MNVQFLLFVIAILLLLIFWELSKINSRLKKTLVLPKEITKDTEHKEP* |
| Ga0075014_1002827422 | 3300006174 | Watersheds | MYVPFLLFIIVIVLVLIFWELSKINSYLKKSLVSRPATAKGSNDTQP* |
| Ga0070712_1015767251 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | PFLLFVIVIVLVLIFWELSKIHSRLKKMLAPPLDTMKGNKDTHP* |
| Ga0073928_100158359 | 3300006893 | Iron-Sulfur Acid Spring | MNVLFLLFVIAILLVLIFWELSKIYSFLKKTLVPRHDIVKDNQQREP* |
| Ga0073928_100436276 | 3300006893 | Iron-Sulfur Acid Spring | LLFVIAILLLLIFWELSKIYSYLKKTLLPSPDIAKDDKHKKP* |
| Ga0073928_100500586 | 3300006893 | Iron-Sulfur Acid Spring | MNVLFLLFVIAILLVLIFWELSKIYSFLKRTLVPRHDIAKDNQRKEP* |
| Ga0073928_107272642 | 3300006893 | Iron-Sulfur Acid Spring | MNVQFLLFVIAILLLLIFWELSKIYSYLKKTLLPSPDIAKDDKHK |
| Ga0073928_112262122 | 3300006893 | Iron-Sulfur Acid Spring | MNVQLLLFVIAILLLLIFWELSKIYSYLKKTLLPSPDIAKDDKHK |
| Ga0102924_11511561 | 3300007982 | Iron-Sulfur Acid Spring | ILFLLFVIAILLVLIFWELSKINSLLKKRLGPLADTIDEKKPV* |
| Ga0102924_12827291 | 3300007982 | Iron-Sulfur Acid Spring | MNILFLLFVIAILLVLIFWELSKINSLLKKRMSPLANLGDEKKPV* |
| Ga0099829_100842423 | 3300009038 | Vadose Zone Soil | MNVQYLLFVIAILLVLIFWELSKINSRLKKTLVPPQDIMKDNKHKEP* |
| Ga0099829_101222723 | 3300009038 | Vadose Zone Soil | MNVQLLLFVIASLLILIFWELSKINSRLKKTLVPQDIMKDNKHKEP* |
| Ga0099828_102220244 | 3300009089 | Vadose Zone Soil | MNVQYLLFVIAILLVLIFWELSKINSRLKKTLVPPQDIMKDNKRKEP* |
| Ga0099827_100249722 | 3300009090 | Vadose Zone Soil | MNVQFLLFVIAILLVLVFWELSKINSLLKKRLALPQEVKSDSKQKEP* |
| Ga0099827_119778942 | 3300009090 | Vadose Zone Soil | MIVQFLLFVIAILLILIFWELSKINSRLKKTLVPPDIMKDNKHKE* |
| Ga0116224_105155551 | 3300009683 | Peatlands Soil | MYIPFLLFVIVIVLVLIFWELSKINSRLKKSLVSTQDTTKGNNGTQP* |
| Ga0126384_103883152 | 3300010046 | Tropical Forest Soil | MYVPFLLFVIVIVLVLIFWELSKIHSRLKKMLGSQHDTMKGNKDTQP* |
| Ga0126373_132325442 | 3300010048 | Tropical Forest Soil | MYVPFLLFVIVIVLVLIFWELSKIHSLFKKMLAPPNMTTMKSNKGTQP* |
| Ga0074045_101568352 | 3300010341 | Bog Forest Soil | MNVLFLLFVISILLVLIFWELSKIHSYLKKTLVRSQDAVKPDKP* |
| Ga0126378_100062829 | 3300010361 | Tropical Forest Soil | MYVPFLLFVIVIVLVLIFWELSKIHSLFKKMLAPNMTTLKSHKDTAPGRSTPEAE* |
| Ga0126378_101609344 | 3300010361 | Tropical Forest Soil | FLGARDNQMYVPFLLFVIVIVLILIFWELSKIHSLLKKMLAPHMTTMKSNKDTAP* |
| Ga0126378_110697691 | 3300010361 | Tropical Forest Soil | IVIVLVLIFWELSKIHSRLKKILAAPHDTMKGNKDTQP* |
| Ga0126377_119677042 | 3300010362 | Tropical Forest Soil | LLFVVVIVLVLIFWELGKIHSRLKQMLAHTHDTMKSNKDTQL* |
| Ga0126379_100057055 | 3300010366 | Tropical Forest Soil | MYVPFLLFVIVIVLVLIFWELSKIHSRLKKMLGSQHDTMKGNKDTQPLKING* |
| Ga0126379_105970072 | 3300010366 | Tropical Forest Soil | MYVPFLLFVVVIVLVLIFWELGKIHSRLKQMLAHTHDTMKSNKDTQR* |
| Ga0136449_1002176132 | 3300010379 | Peatlands Soil | MYIPFLLFVIVIVLVLIFWELSKINSRLKKTLVPLPDTMKANKDTQP* |
| Ga0136449_1003863542 | 3300010379 | Peatlands Soil | MNVQFLLFVIAILLVLIFWELSKIYSYLKKTLVPSHDVVKANKP* |
| Ga0138555_10923242 | 3300011075 | Peatlands Soil | MYVPFLLFVIVIVLVLIFWELSKINSGLKKSLVSTQDTTKGNNGTQP* |
| Ga0150983_136982822 | 3300011120 | Forest Soil | MYVPFLLFVVVIVLVLIFWELSKIHSRLKQMLAHTHDTMKSNKDTEP* |
| Ga0150983_147858111 | 3300011120 | Forest Soil | MYIPFLLFVIVIVLVLIFWELSKINSRLKKTLVPLHDTMKANKGTQP* |
| Ga0137388_100418265 | 3300012189 | Vadose Zone Soil | MNVQFLLFVIAILLILIFWELSKINSRLKKTLVPQDIMKDNKHKEP* |
| Ga0137382_102074163 | 3300012200 | Vadose Zone Soil | MIVQFLLFVIAILLILIFWELSKINSRLRKALVTPDIMMDNKH* |
| Ga0137382_103972111 | 3300012200 | Vadose Zone Soil | MSVQFFLFVIAILLILIFWELSKINSRLKKTLVPPDIMKDDKHKELTEPRLEK* |
| Ga0137365_103424572 | 3300012201 | Vadose Zone Soil | MIVQFLLFVIAILLILIFWELSKINSRLKKTLVPPDIMKDNKH* |
| Ga0137380_102208622 | 3300012206 | Vadose Zone Soil | MYVPFLLFVIAIVLVVIFWELSKINTRLRKASVPPGDLVKDTSRKEP* |
| Ga0137380_105124242 | 3300012206 | Vadose Zone Soil | MIVQFLLFVIAILLVLVFWELSKINSLLKKRLALPQEVKSDSKQKEP* |
| Ga0137381_101700644 | 3300012207 | Vadose Zone Soil | MIVQFLLFVIAILLILIFWELSKINGRLKKTLVPPDIMKDNKH* |
| Ga0137381_108064481 | 3300012207 | Vadose Zone Soil | KLMIVQFLLFVIAILLILIFWELSKINSRLKKTLVPPDIMKDNKHKE* |
| Ga0137376_108509622 | 3300012208 | Vadose Zone Soil | MSVQFFLFVIAILLILIFWELSKINSRLKKTLVPPDIMKDDKHKELTEPRLVK* |
| Ga0137379_116557141 | 3300012209 | Vadose Zone Soil | MPLVYDSLGANGMNVQFLLFVIALLLLLIFWELSKINSRLKKTLVQNQDIKKDNKHAEF* |
| Ga0137378_100640817 | 3300012210 | Vadose Zone Soil | MYVPFLLFVIAIVLVVIFWELSKINTRLRKASVTPGDLVKDTSRKEP* |
| Ga0137377_106607202 | 3300012211 | Vadose Zone Soil | MNVQFLLFVIAILLILIFWELSKINSRFKKALASLQDSRKDSKPNAS* |
| Ga0137386_110623722 | 3300012351 | Vadose Zone Soil | MNVQFLLFVIAILLVLVFWELSKINSLLKKRLALPQEVKSDSKQKE |
| Ga0137384_108826812 | 3300012357 | Vadose Zone Soil | MIVQFLLFVIAILLILIFWELSKINSRLKKTLVPADIMKDTKHKE* |
| Ga0137384_111485661 | 3300012357 | Vadose Zone Soil | MNVQFLLFVIALLLLLIFWELSKINSRLKKTLVQNQDIRKDNKHAEF* |
| Ga0137361_105466733 | 3300012362 | Vadose Zone Soil | MSVQFFLFVIAILLILIFWELSKINSRLRKTLVPPDIMKDDKHKELTEPRLVK* |
| Ga0137358_100621553 | 3300012582 | Vadose Zone Soil | MSVQFFLFVIAILLILIFWELSKINSRLRKTLVPPDIMKDDKHKELTETRLVK* |
| Ga0137398_111584952 | 3300012683 | Vadose Zone Soil | MNVQFLLFVIAILLVLVFWELSKINSLLKKRLALPLEVKSDNK* |
| Ga0137413_116428032 | 3300012924 | Vadose Zone Soil | MNVQFLLFVIAILLVLVFWELSKINSHLKKTLVSRQDVAKDNKHKEP* |
| Ga0137404_103252751 | 3300012929 | Vadose Zone Soil | PMSVQFFLFVIAILLILIFWELSKINSRLKKTLVPPDIMKDDKHKELTEPRLVK* |
| Ga0181532_100054425 | 3300014164 | Bog | MYVPFLLFVIVIVLVLIFWELSKINSRLKKTLVPTHDSVKDNKSTLP* |
| Ga0182024_1000050559 | 3300014501 | Permafrost | MNVLFLLFVIAILLVLIFWELSKINSRLKKTLVPLPDAAKDKPRN* |
| Ga0182024_100246989 | 3300014501 | Permafrost | MYVPFLLFVIVVVLVLIFWELSKINSRLKKTLVPSHNIMKEIDDPSRK* |
| Ga0182024_100251463 | 3300014501 | Permafrost | MNVLFLLFVIAILLVLIFWELSKINSLLKRTLVTHQDIRKDTNLSNVENPRPKV* |
| Ga0182024_110508122 | 3300014501 | Permafrost | MNVQFLLFVIAILLLLIFWELSKIFSYLKKTLLPSQDIAKDDKHKKP* |
| Ga0137412_108283873 | 3300015242 | Vadose Zone Soil | QFLLFVIAILLILIFWELSKINSHLKKTLVSRQDVAKDNKHKEP* |
| Ga0137403_102232474 | 3300015264 | Vadose Zone Soil | MIVQFLLFVIAILLILIFWELSKINSRLKKTLVPPDIMKDDKHKELTEPRLVK* |
| Ga0187821_100313442 | 3300017936 | Freshwater Sediment | MNVQFLLFVIAILLVLIFWELSKINSRLKKTLTPRQDMATDDKNKKP |
| Ga0187804_102860271 | 3300018006 | Freshwater Sediment | MNVQFLLFVIAILLVLIFWELSKINSRLKKTLVPRQDTAKDNNIKSPEKR |
| Ga0193751_10028138 | 3300019888 | Soil | MNVLFLLFVIAILLVLIFWELSKINSRLKKSLVPREDIAKDNKLKEL |
| Ga0210403_100533652 | 3300020580 | Soil | MNVQLLLFVIAILLLLIFWELSKIYSYLKKTLLPSPDIAKDDKHNKP |
| Ga0210403_101896352 | 3300020580 | Soil | MNVQFLLFVIAILLVLVFWELSKINSLLKKRLALPQEVKSDSKQKEP |
| Ga0210399_102348542 | 3300020581 | Soil | MNVQFLLFVIAILLLLIFWELSKINSRLKKTLVLPKEITKDTEHKEP |
| Ga0210399_103164042 | 3300020581 | Soil | MNVQLLLFVIAILLLLIFWELSKIYSYLKKTLLPSPDIAKDDKHKKP |
| Ga0210395_102343723 | 3300020582 | Soil | MYIPFLLFVIVIVLVLIFWELSKINSRLKKTLVPLHDTMKANKGTQP |
| Ga0210405_100284262 | 3300021171 | Soil | MNVQLLLFVIAILLLLIFWELSKIYSYLKKTLLPSPDLAKDDKHKKP |
| Ga0193719_100322701 | 3300021344 | Soil | MSVQFFLFVIAILLILIFWELSKINSRLKKTLVPPDIMKDDKHKELTEPRLVK |
| Ga0193719_103515702 | 3300021344 | Soil | MIVQFLLFVIAILLVLIFWELSKINSRLKKTLVPLDMMNALSKAHSEH |
| Ga0210397_103229173 | 3300021403 | Soil | MYIPFLLFVIVIVLVLIFWELSKINSRLKKTLFPPHDTMKGNKDTQP |
| Ga0210383_117343191 | 3300021407 | Soil | MNVQFLLFVIAILLLLIFWELSKIYSYLKKTLPPRQDIAKDDKYKKP |
| Ga0210394_103560882 | 3300021420 | Soil | MNVLFLLFVIAILLVLIFWELSKIYSFLKKTLVPRQD |
| Ga0210394_117078541 | 3300021420 | Soil | LGARDNQMYVPFLLFVIVIVLVLIFWELSKINSRLKKSLVSTHDTTKGNNGTQP |
| Ga0210391_106175841 | 3300021433 | Soil | QLLLFVIAILLLLIFWELSKIYSYLKKTLLPSPDIAKDDKHKKP |
| Ga0210398_111205542 | 3300021477 | Soil | MNVQLLLFVIAILLLLIFWELSKIYSYLKKTLLPSPDIAKDDKPKKP |
| Ga0210398_111406661 | 3300021477 | Soil | MNVLFLLFVIAILLVLIFWELSKIYSFLKKTLGPRHDIAKDN |
| Ga0210398_112205892 | 3300021477 | Soil | MNVQFLLFVIAILLLLIFWELSKIHSHLKKTLPPSPDIAKDDKHKP |
| Ga0126371_100104005 | 3300021560 | Tropical Forest Soil | MYVPFLLFVIVIVLVLIFWELSKIHSRLKKILAAPHDTMKGNKDTQP |
| Ga0126371_100987954 | 3300021560 | Tropical Forest Soil | MYVPFLLFVVVIVLVLIFWELGKIHSRLKQMLAHTHDTMKSNKDTQL |
| Ga0213851_19087182 | 3300021860 | Watersheds | MNVQFLLFVIAILLVLIFWELSKIYSYLKKTLAPSHDVVKTDKP |
| Ga0224548_10196432 | 3300022518 | Soil | MNVLFLLFVIAILLVLIFWELSKINSRLKKTLVPLPDAAKDKPRN |
| Ga0212123_100081849 | 3300022557 | Iron-Sulfur Acid Spring | MNVLFLLFVIAILLVLIFWELSKIYSFLKKTLVPRHDIVKDNQQREP |
| Ga0212123_100250201 | 3300022557 | Iron-Sulfur Acid Spring | MNVLFLLFVIAILLVLIFWELSKIYSFLKKALVPRHDIAKDNQRKEP |
| Ga0212123_101718664 | 3300022557 | Iron-Sulfur Acid Spring | MNVQFLLFVIAILLLLIFWELSKIYSYLKKTLLPSPDIAKDDKHKKP |
| Ga0212123_103327841 | 3300022557 | Iron-Sulfur Acid Spring | LFVIAILLVLIFWELSKINSLLKKRLGPLADTIDEKKPV |
| Ga0212123_107763961 | 3300022557 | Iron-Sulfur Acid Spring | PRKMNILFLLFVIAILLVLIFWELSKINSLLKKRMSPLANLGDEKKPV |
| Ga0207684_100987261 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MNVQFLLFVIAILLVLVFWELSKINSLLKKRLALAQEVKSDSKQKEP |
| Ga0207693_104837311 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | MNIQFLLFVIAILLVLIFWELSKINSRLKKTLVLPPDIMKDNKDNKDKEP |
| Ga0207700_105003912 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | MNVQFLLFVIAILLVLIFWELSKINSRLKKTLVLPQGNMKDNKPREP |
| Ga0207700_114147422 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | MYVPFSLFVIAIVLILIFWELSKINSLLKKTLGSFRDNVKDTKTVERP |
| Ga0207664_106024411 | 3300025929 | Agricultural Soil | MNVQFLLFVIAILLLLIFWELSKIYSHLKRTLAPSRDVVKDNKP |
| Ga0257153_10267102 | 3300026490 | Soil | MNVQFLLFVIAILLVLVFWELSKINSLLKKRLALPQEIKSDSKQREP |
| Ga0208575_10165751 | 3300026920 | Soil | MNVEFLLFVIAILLVLIFWELSKILSHLKKTLAPRQDIVTDNKRKEP |
| Ga0209684_10829441 | 3300027527 | Tropical Forest Soil | MYVPFLLFVIVIVLVLIFWELGKIHSRLKQMLAHTHDTMKSNKDTQL |
| Ga0209525_11402731 | 3300027575 | Forest Soil | MNVLFLLFVIAILLVLIFWELSKIYSFLKKTLVPRQDIVKDNQQREP |
| Ga0209733_10005167 | 3300027591 | Forest Soil | MNVQFLLFVVAILLVLIFWELSKINSLLKRTLVPRLDINKDNKLKEP |
| Ga0209733_10944121 | 3300027591 | Forest Soil | MNVQFLLFVIAILLVLIFWELSKINSLLKKTLVPRPDINKDNKLKEP |
| Ga0209330_10154772 | 3300027619 | Forest Soil | MNVQLLLFVIAILLLLIFWELSKIYSYLKKTLLPSPDIAKDDKPK |
| Ga0209625_10645982 | 3300027635 | Forest Soil | MNVQFLLFVVAILLVLIFWELSKINSLLKKTLVSSLDISKDNKLKEP |
| Ga0209420_10050959 | 3300027648 | Forest Soil | GNHQMNVQLLLFVIAILLLLIFWELSKIYSYLKKTLLPSPDIAKDDKPKKP |
| Ga0209007_10018554 | 3300027652 | Forest Soil | MNVQFLLFVIAILLLLIFWELSKIYSHLKKTLLPSPDSAKDDKPKKP |
| Ga0209736_10262154 | 3300027660 | Forest Soil | MNVLFLLFVIAILLVLIFWELSKINSRLKKSLVPRQDIAADNKHKEP |
| Ga0209908_100933232 | 3300027745 | Thawing Permafrost | MNVQFLLFVIAILLLLIFWELSKIHSHLRKTLPPSQDMAKDDKPKKP |
| Ga0209656_100111166 | 3300027812 | Bog Forest Soil | MNVQFLLFVIAILLVLIFWELSKIYSYLKKTLVPLQEVAKANKP |
| Ga0209060_100242175 | 3300027826 | Surface Soil | MYVPFLLFVIVIVLVLIFWELSKIHSRLKRMLAQTHDLVKGNKDMQR |
| Ga0209180_101423502 | 3300027846 | Vadose Zone Soil | MNVQYLLFVIAILLVLIFWELSKINSRLKKTLVPPQDIMKDNKHKEP |
| Ga0209465_104673361 | 3300027874 | Tropical Forest Soil | VSSGAQDNQMYVPFLLFVIVIVLVLIFWELSKIHSRLKKMLGFQHDTMKGNKDTQP |
| Ga0209067_103979941 | 3300027898 | Watersheds | MNVQFLLFVIAILLVLIFWELSKIYSYLKKTLAPSHDVVKSNKP |
| Ga0209067_109048333 | 3300027898 | Watersheds | LLFVITIVLIVIFWELSKINSRLKKALATARDITKDNKPAQP |
| Ga0209006_106108922 | 3300027908 | Forest Soil | MNVLFLLFVIAILLVLIFWELSKIYSFLKKTLGPRHDIAKDNQPKES |
| Ga0209698_100696714 | 3300027911 | Watersheds | MNVQLLLFVIAILLVLIFWELSKIHSYLKKTLVPSHDVVKANKA |
| Ga0209698_105919632 | 3300027911 | Watersheds | MNVPFLLFVIAILLVLIFWELSKIYSYLKKTLVPSHDVVKANKT |
| Ga0265338_100514313 | 3300028800 | Rhizosphere | MYVPFLLFIIVIVLVLIFWELSKINSRLKKALISSHNIMKEIDDPSRK |
| Ga0308309_101778872 | 3300028906 | Soil | MNVQFWLFVIAILLLLIFWELSKINSRLKKTLVLPKDITKDTEHKEP |
| Ga0210252_109689433 | 3300030548 | Soil | QFLLFVIAILLLLIFWELSKIHSHLKKTLPPSQDIAKDDKHKP |
| Ga0075372_108224482 | 3300030853 | Soil | MNVQFLLFVISILLVLVFWELSKINSLLKKRLALPQEAKSDSKPKES |
| Ga0075373_106039841 | 3300030945 | Soil | MYVPFLLFVIAIVLVVIFWELSKINSRLRKASVAPGDLVKDTS |
| Ga0073994_113752182 | 3300030991 | Soil | MNALYLLFVIAILLVLIFWELSKINSFLKKTLVVRRDIATDNKHKEP |
| Ga0170834_1092651484 | 3300031057 | Forest Soil | LFVIAILLVLIFWELSKIYSFLKKTLVPRHDIVKDNQQREP |
| Ga0170834_1118301462 | 3300031057 | Forest Soil | MNIQFLLFVIAILLVLIFWELSKINSRLKNSLPLQNVRSDNKHDEPW |
| Ga0170834_1130563132 | 3300031057 | Forest Soil | MNVQFLLFVIAILLVLIFWELSKINSLLKKRLVLPDVKKDNKQNEP |
| Ga0170823_138960481 | 3300031128 | Forest Soil | MYIPFLLFIIVIVLVLIFWELSKINSRLKKALVPPPDTMKGNKDTQP |
| Ga0170824_1078811731 | 3300031231 | Forest Soil | RMNVQFLLFVIAILLVLVFWELSKINSLLKKRLALPQEVKSDSKQKEP |
| Ga0170824_1089737462 | 3300031231 | Forest Soil | VQFLLFVIAILLVLIFWELSKINSLLKKRLVLPPDVKNDKQT |
| Ga0170824_1152878771 | 3300031231 | Forest Soil | MYTPFLLFVIVIVLILIFWELSKINGRLKKTLVTPYDSVKGNKDTQR |
| Ga0170824_1207663472 | 3300031231 | Forest Soil | MNVQFLLFVIAILLVLIFWELSKINSVLKKRLVPPPDVKNDNKPNEP |
| Ga0265316_108986292 | 3300031344 | Rhizosphere | MYVPFLLFVIVVVLVLIFWELSKINSRLKKTLVPSHNIMKEIDDPSRK |
| Ga0170820_150713262 | 3300031446 | Forest Soil | MNVQFLLFVIAILLVLIFWELSKINSLLKKRLVPPADVKNYKQT |
| Ga0170819_100241222 | 3300031469 | Forest Soil | MNVQFLLFVIAILLVLVFWELSKINSVLKKRLALPQEVKSDSKQKEP |
| Ga0170819_142284042 | 3300031469 | Forest Soil | LLFVIAILLVLVFWELSKINSLLKKRLALPQEAKSDSKPKES |
| Ga0170818_1039236192 | 3300031474 | Forest Soil | REAVGFQRAKMNVQFWLFVIAILLLLIFWELSKINSLLKKRLVLPPDVKNDKQT |
| Ga0310686_1115717763 | 3300031708 | Soil | MNVQFLLFVIAILLLLIFWELSKIYGYLKKTLLPSPDIAKDDKHKKP |
| Ga0307476_101083111 | 3300031715 | Hardwood Forest Soil | MNVLFLLFVIAILLVLIFWELSKIYSFLKKTIGLRHDIAKDSQQKES |
| Ga0307476_101975611 | 3300031715 | Hardwood Forest Soil | MNVQFLLFVIAILLVLVFWELSKINSLLKKRLALPQEVKSDSKPKEP |
| Ga0307476_112073361 | 3300031715 | Hardwood Forest Soil | MNVLFLLFVIAILLVLIFWELSKIYSFLKKTLGPRHDIAKDNQQKES |
| Ga0307474_101675501 | 3300031718 | Hardwood Forest Soil | MNVQFLLFVVAILLVLIFWELSKINSLLKKTLVPRPDIKKDNKLSEP |
| Ga0307469_102140782 | 3300031720 | Hardwood Forest Soil | MSVQFFLFVIAILLILIFWELSKINSRLKKTLVPPDIRKDDKHKELTEPRLVK |
| Ga0307469_117585602 | 3300031720 | Hardwood Forest Soil | MSVQFFLFVIAILLILIFWELSKINSHLKKTLVPPDIMKDNKHKE |
| Ga0307475_109991682 | 3300031754 | Hardwood Forest Soil | MNVQFLLFVIAILLVLIFWELSKINSLLKKTLAPRQDAATDNKHKEP |
| Ga0307479_116429391 | 3300031962 | Hardwood Forest Soil | MNVLFLLFVIAILLVLIFWELSKINGRLKKSLVPREDVAKDNKLKEV |
| Ga0311301_105072923 | 3300032160 | Peatlands Soil | MNVQFLLFVIAILLVLIFWELSKIYSYLKKTLVPSHDVVKANKP |
| Ga0311301_106835552 | 3300032160 | Peatlands Soil | MYVPFLLFVIVIVLVLIFWELSKINSRLKKSLVSTQDTTKGNNGTQP |
| Ga0311301_111770702 | 3300032160 | Peatlands Soil | MYIPFLLFVIVIVLVLIFWELSKINSRLKKTLVPPPDTMKANKDTQP |
| Ga0307470_100542443 | 3300032174 | Hardwood Forest Soil | MNVLFLLFVISILLVLVFWELSKINSLLKKRLALPAEAKSDSKPKES |
| Ga0314861_0000489_56707_56850 | 3300033977 | Peatland | MIVQFLLFVIAILLLLIFWELSKINSRLKKALVPSPEHSEGHKPKEP |
| Ga0314861_0367409_20_139 | 3300033977 | Peatland | VIAILLLLIFWELSKIHGRIKKALVPLPEHPEEHKQKEP |
| ⦗Top⦘ |