| Basic Information | |
|---|---|
| Family ID | F029327 |
| Family Type | Metagenome |
| Number of Sequences | 188 |
| Average Sequence Length | 48 residues |
| Representative Sequence | MGFYKDIEIEIMEWQARGRSQAETYIYFKDYVTQEDVARIFARDCDEETV |
| Number of Associated Samples | 120 |
| Number of Associated Scaffolds | 188 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Viruses |
| % of genes with valid RBS motifs | 89.36 % |
| % of genes near scaffold ends (potentially truncated) | 20.74 % |
| % of genes from short scaffolds (< 2000 bps) | 75.53 % |
| Associated GOLD sequencing projects | 105 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.58 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Duplodnaviria (85.638 % of family members) |
| NCBI Taxonomy ID | 2731341 |
| Taxonomy | All Organisms → Viruses → Duplodnaviria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake (28.192 % of family members) |
| Environment Ontology (ENVO) | Unclassified (83.511 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (87.234 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 46.15% β-sheet: 0.00% Coil/Unstructured: 53.85% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.58 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 188 Family Scaffolds |
|---|---|---|
| PF05488 | PAAR_motif | 2.66 |
| PF14743 | DNA_ligase_OB_2 | 2.66 |
| PF00268 | Ribonuc_red_sm | 1.60 |
| PF07486 | Hydrolase_2 | 1.06 |
| PF01068 | DNA_ligase_A_M | 1.06 |
| PF00462 | Glutaredoxin | 1.06 |
| PF12705 | PDDEXK_1 | 0.53 |
| PF00383 | dCMP_cyt_deam_1 | 0.53 |
| PF01592 | NifU_N | 0.53 |
| PF12708 | Pectate_lyase_3 | 0.53 |
| PF04055 | Radical_SAM | 0.53 |
| PF00012 | HSP70 | 0.53 |
| PF13385 | Laminin_G_3 | 0.53 |
| PF13394 | Fer4_14 | 0.53 |
| PF10263 | SprT-like | 0.53 |
| PF12224 | Amidoligase_2 | 0.53 |
| PF03796 | DnaB_C | 0.53 |
| PF03477 | ATP-cone | 0.53 |
| COG ID | Name | Functional Category | % Frequency in 188 Family Scaffolds |
|---|---|---|---|
| COG4104 | Zn-binding Pro-Ala-Ala-Arg (PAAR) domain, involved in Type VI secretion | Intracellular trafficking, secretion, and vesicular transport [U] | 2.66 |
| COG0208 | Ribonucleotide reductase beta subunit, ferritin-like domain | Nucleotide transport and metabolism [F] | 1.60 |
| COG1423 | ATP-dependent RNA circularization protein, DNA/RNA ligase (PAB1020) family | Replication, recombination and repair [L] | 1.06 |
| COG1793 | ATP-dependent DNA ligase | Replication, recombination and repair [L] | 1.06 |
| COG3773 | Cell wall hydrolase CwlJ, involved in spore germination | Cell cycle control, cell division, chromosome partitioning [D] | 1.06 |
| COG0305 | Replicative DNA helicase | Replication, recombination and repair [L] | 0.53 |
| COG0443 | Molecular chaperone DnaK (HSP70) | Posttranslational modification, protein turnover, chaperones [O] | 0.53 |
| COG0822 | Fe-S cluster assembly scaffold protein IscU, NifU family | Posttranslational modification, protein turnover, chaperones [O] | 0.53 |
| COG1066 | DNA repair protein RadA/Sms, contains AAA+ ATPase domain | Replication, recombination and repair [L] | 0.53 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 92.02 % |
| Unclassified | root | N/A | 7.98 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300002092|JGI24218J26658_1001999 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5585 | Open in IMG/M |
| 3300002092|JGI24218J26658_1020225 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 909 | Open in IMG/M |
| 3300002098|JGI24219J26650_1003254 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3826 | Open in IMG/M |
| 3300002476|metazooDRAFT_10777939 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 559 | Open in IMG/M |
| 3300002933|G310J44882_10016123 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2033 | Open in IMG/M |
| 3300003375|JGI26470J50227_1079132 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 510 | Open in IMG/M |
| 3300003852|Ga0031655_10048064 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1882 | Open in IMG/M |
| 3300003852|Ga0031655_10302224 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 598 | Open in IMG/M |
| 3300004095|Ga0007829_10058780 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 749 | Open in IMG/M |
| 3300004770|Ga0007804_1003101 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5489 | Open in IMG/M |
| 3300004770|Ga0007804_1150946 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 583 | Open in IMG/M |
| 3300004772|Ga0007791_10046694 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1418 | Open in IMG/M |
| 3300004772|Ga0007791_10130754 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 743 | Open in IMG/M |
| 3300004772|Ga0007791_10136852 | Not Available | 722 | Open in IMG/M |
| 3300004772|Ga0007791_10210938 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 552 | Open in IMG/M |
| 3300004774|Ga0007794_10139275 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 725 | Open in IMG/M |
| 3300004774|Ga0007794_10142143 | Not Available | 717 | Open in IMG/M |
| 3300004776|Ga0007800_10161461 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 552 | Open in IMG/M |
| 3300004804|Ga0007796_10079356 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1036 | Open in IMG/M |
| 3300005527|Ga0068876_10639491 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 573 | Open in IMG/M |
| 3300005581|Ga0049081_10134471 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 911 | Open in IMG/M |
| 3300005582|Ga0049080_10003981 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5145 | Open in IMG/M |
| 3300005662|Ga0078894_10348539 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1341 | Open in IMG/M |
| 3300005662|Ga0078894_10447761 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1164 | Open in IMG/M |
| 3300005662|Ga0078894_11279494 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 618 | Open in IMG/M |
| 3300005662|Ga0078894_11683893 | Not Available | 521 | Open in IMG/M |
| 3300005805|Ga0079957_1077203 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1899 | Open in IMG/M |
| 3300006071|Ga0007876_1066560 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 957 | Open in IMG/M |
| 3300006072|Ga0007881_1089053 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 777 | Open in IMG/M |
| 3300006100|Ga0007806_1007526 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2689 | Open in IMG/M |
| 3300008267|Ga0114364_1001293 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 32557 | Open in IMG/M |
| 3300008267|Ga0114364_1011716 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5694 | Open in IMG/M |
| 3300008267|Ga0114364_1154292 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 627 | Open in IMG/M |
| 3300009068|Ga0114973_10004940 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 9170 | Open in IMG/M |
| 3300009068|Ga0114973_10006417 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 7914 | Open in IMG/M |
| 3300009151|Ga0114962_10000483 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 35451 | Open in IMG/M |
| 3300009151|Ga0114962_10057441 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2537 | Open in IMG/M |
| 3300009155|Ga0114968_10005623 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 9291 | Open in IMG/M |
| 3300009155|Ga0114968_10007512 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 7981 | Open in IMG/M |
| 3300009155|Ga0114968_10676129 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 542 | Open in IMG/M |
| 3300009158|Ga0114977_10052876 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2513 | Open in IMG/M |
| 3300009158|Ga0114977_10204005 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1158 | Open in IMG/M |
| 3300009158|Ga0114977_10356867 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 822 | Open in IMG/M |
| 3300009158|Ga0114977_10362532 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 814 | Open in IMG/M |
| 3300009159|Ga0114978_10001240 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 21580 | Open in IMG/M |
| 3300009159|Ga0114978_10211829 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1220 | Open in IMG/M |
| 3300009159|Ga0114978_10725945 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Chlorobi → unclassified Chlorobiota → Chlorobiota bacteirum | 565 | Open in IMG/M |
| 3300009160|Ga0114981_10202329 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1089 | Open in IMG/M |
| 3300009161|Ga0114966_10251416 | All Organisms → Viruses → Predicted Viral | 1091 | Open in IMG/M |
| 3300009163|Ga0114970_10727963 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 525 | Open in IMG/M |
| 3300009181|Ga0114969_10539852 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 647 | Open in IMG/M |
| 3300009182|Ga0114959_10107308 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1524 | Open in IMG/M |
| 3300009183|Ga0114974_10000631 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 28928 | Open in IMG/M |
| 3300009183|Ga0114974_10018727 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4918 | Open in IMG/M |
| 3300009183|Ga0114974_10171991 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1341 | Open in IMG/M |
| 3300009502|Ga0114951_10005275 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 12008 | Open in IMG/M |
| 3300009502|Ga0114951_10190104 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1106 | Open in IMG/M |
| 3300009502|Ga0114951_10249305 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 930 | Open in IMG/M |
| 3300009502|Ga0114951_10250874 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 926 | Open in IMG/M |
| 3300009502|Ga0114951_10512548 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 584 | Open in IMG/M |
| 3300009502|Ga0114951_10602063 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 527 | Open in IMG/M |
| 3300010157|Ga0114964_10217994 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 914 | Open in IMG/M |
| 3300010158|Ga0114960_10252192 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 901 | Open in IMG/M |
| 3300010158|Ga0114960_10385629 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Chlorobi → unclassified Chlorobiota → Chlorobiota bacteirum | 687 | Open in IMG/M |
| 3300010158|Ga0114960_10595934 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Chlorobi → unclassified Chlorobiota → Chlorobiota bacteirum | 523 | Open in IMG/M |
| 3300010334|Ga0136644_10624702 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 591 | Open in IMG/M |
| 3300010334|Ga0136644_10744946 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Chlorobi → unclassified Chlorobiota → Chlorobiota bacteirum | 530 | Open in IMG/M |
| 3300010354|Ga0129333_11725094 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 509 | Open in IMG/M |
| 3300010885|Ga0133913_11039629 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 2115 | Open in IMG/M |
| 3300010885|Ga0133913_11601480 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1643 | Open in IMG/M |
| 3300010885|Ga0133913_11653161 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1613 | Open in IMG/M |
| 3300010885|Ga0133913_12401150 | All Organisms → Viruses → Predicted Viral | 1290 | Open in IMG/M |
| 3300010885|Ga0133913_12907338 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1148 | Open in IMG/M |
| 3300011113|Ga0151517_1002 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 320541 | Open in IMG/M |
| 3300011116|Ga0151516_10248 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 31172 | Open in IMG/M |
| 3300012000|Ga0119951_1099461 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 698 | Open in IMG/M |
| 3300012000|Ga0119951_1118288 | Not Available | 609 | Open in IMG/M |
| 3300012012|Ga0153799_1039934 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 880 | Open in IMG/M |
| 3300012017|Ga0153801_1031711 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 934 | Open in IMG/M |
| 3300013004|Ga0164293_10864639 | Not Available | 570 | Open in IMG/M |
| 3300013006|Ga0164294_10351836 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1015 | Open in IMG/M |
| 3300013006|Ga0164294_10415138 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 922 | Open in IMG/M |
| 3300013006|Ga0164294_10542561 | Not Available | 790 | Open in IMG/M |
| 3300013014|Ga0164295_10181883 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1566 | Open in IMG/M |
| 3300013014|Ga0164295_10314554 | Not Available | 1182 | Open in IMG/M |
| 3300013093|Ga0164296_1030344 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3018 | Open in IMG/M |
| 3300013295|Ga0170791_11477117 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 956 | Open in IMG/M |
| 3300017707|Ga0181363_1041450 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 845 | Open in IMG/M |
| 3300017716|Ga0181350_1069734 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 905 | Open in IMG/M |
| 3300017747|Ga0181352_1198443 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 516 | Open in IMG/M |
| 3300017754|Ga0181344_1008490 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3356 | Open in IMG/M |
| 3300017754|Ga0181344_1222007 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 527 | Open in IMG/M |
| 3300017761|Ga0181356_1052313 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1405 | Open in IMG/M |
| 3300017766|Ga0181343_1083864 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 912 | Open in IMG/M |
| 3300017766|Ga0181343_1126915 | Not Available | 716 | Open in IMG/M |
| 3300017778|Ga0181349_1066924 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1383 | Open in IMG/M |
| 3300018790|Ga0187842_1046726 | All Organisms → Viruses → Predicted Viral | 1369 | Open in IMG/M |
| 3300018868|Ga0187844_10192457 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Chlorobi → unclassified Chlorobiota → Chlorobiota bacteirum | 879 | Open in IMG/M |
| 3300019093|Ga0187843_10018002 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3713 | Open in IMG/M |
| 3300019093|Ga0187843_10023314 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 3179 | Open in IMG/M |
| 3300019093|Ga0187843_10051711 | All Organisms → Viruses → Predicted Viral | 1964 | Open in IMG/M |
| 3300019093|Ga0187843_10200991 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 844 | Open in IMG/M |
| 3300019784|Ga0181359_1063560 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1409 | Open in IMG/M |
| 3300019784|Ga0181359_1084557 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1184 | Open in IMG/M |
| 3300019784|Ga0181359_1232367 | Not Available | 572 | Open in IMG/M |
| 3300020048|Ga0207193_1397039 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 923 | Open in IMG/M |
| 3300020141|Ga0211732_1569971 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1426 | Open in IMG/M |
| 3300020151|Ga0211736_10547024 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 879 | Open in IMG/M |
| 3300020159|Ga0211734_11112329 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 923 | Open in IMG/M |
| 3300020159|Ga0211734_11187980 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 752 | Open in IMG/M |
| 3300020160|Ga0211733_10940542 | Not Available | 504 | Open in IMG/M |
| 3300020161|Ga0211726_10436408 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 641 | Open in IMG/M |
| 3300020162|Ga0211735_11545546 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 919 | Open in IMG/M |
| 3300020172|Ga0211729_10095055 | All Organisms → Viruses → Predicted Viral | 1106 | Open in IMG/M |
| 3300020727|Ga0214246_1022907 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1036 | Open in IMG/M |
| 3300021135|Ga0214247_1068459 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 545 | Open in IMG/M |
| 3300021142|Ga0214192_1097961 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 809 | Open in IMG/M |
| 3300021142|Ga0214192_1185202 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 509 | Open in IMG/M |
| 3300021519|Ga0194048_10096843 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1139 | Open in IMG/M |
| 3300022190|Ga0181354_1110587 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 889 | Open in IMG/M |
| 3300022407|Ga0181351_1047732 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1795 | Open in IMG/M |
| 3300022555|Ga0212088_10013015 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 12545 | Open in IMG/M |
| 3300022555|Ga0212088_10048186 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4631 | Open in IMG/M |
| 3300022555|Ga0212088_10156926 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1907 | Open in IMG/M |
| 3300022555|Ga0212088_10175308 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1754 | Open in IMG/M |
| 3300022555|Ga0212088_10700367 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 603 | Open in IMG/M |
| 3300022592|Ga0236342_1047481 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 995 | Open in IMG/M |
| 3300023174|Ga0214921_10000016 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 349716 | Open in IMG/M |
| 3300023174|Ga0214921_10000372 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 85331 | Open in IMG/M |
| 3300023174|Ga0214921_10510526 | Not Available | 568 | Open in IMG/M |
| 3300023184|Ga0214919_10000988 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 48084 | Open in IMG/M |
| 3300025383|Ga0208250_1008336 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2018 | Open in IMG/M |
| 3300025398|Ga0208251_1039175 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 795 | Open in IMG/M |
| 3300025415|Ga0208868_1054338 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 601 | Open in IMG/M |
| 3300025430|Ga0208622_1086029 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 516 | Open in IMG/M |
| 3300025578|Ga0208864_1006983 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3609 | Open in IMG/M |
| 3300025578|Ga0208864_1093183 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 716 | Open in IMG/M |
| 3300025578|Ga0208864_1155097 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 503 | Open in IMG/M |
| 3300025606|Ga0207954_1052123 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1109 | Open in IMG/M |
| 3300027589|Ga0255123_1018552 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1480 | Open in IMG/M |
| 3300027708|Ga0209188_1258277 | Not Available | 598 | Open in IMG/M |
| (restricted) 3300027728|Ga0247836_1053886 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2282 | Open in IMG/M |
| (restricted) 3300027730|Ga0247833_1059910 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1955 | Open in IMG/M |
| 3300027733|Ga0209297_1163242 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 907 | Open in IMG/M |
| 3300027733|Ga0209297_1240428 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 699 | Open in IMG/M |
| 3300027734|Ga0209087_1020949 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3214 | Open in IMG/M |
| 3300027734|Ga0209087_1030996 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 2556 | Open in IMG/M |
| 3300027734|Ga0209087_1235708 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 683 | Open in IMG/M |
| 3300027736|Ga0209190_1122115 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1168 | Open in IMG/M |
| 3300027736|Ga0209190_1382609 | Not Available | 511 | Open in IMG/M |
| 3300027741|Ga0209085_1151724 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Chlorobi → unclassified Chlorobiota → Chlorobiota bacteirum | 977 | Open in IMG/M |
| 3300027747|Ga0209189_1398882 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 511 | Open in IMG/M |
| 3300027749|Ga0209084_1044388 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2179 | Open in IMG/M |
| 3300027754|Ga0209596_1307856 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Chlorobi → unclassified Chlorobiota → Chlorobiota bacteirum | 627 | Open in IMG/M |
| 3300027759|Ga0209296_1001956 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 15100 | Open in IMG/M |
| 3300027759|Ga0209296_1002880 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 11991 | Open in IMG/M |
| 3300027759|Ga0209296_1011340 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5337 | Open in IMG/M |
| 3300027759|Ga0209296_1075367 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1677 | Open in IMG/M |
| 3300027769|Ga0209770_10398851 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 509 | Open in IMG/M |
| 3300027782|Ga0209500_10050531 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2222 | Open in IMG/M |
| 3300027782|Ga0209500_10313429 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 660 | Open in IMG/M |
| 3300027805|Ga0209229_10091858 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1366 | Open in IMG/M |
| 3300027896|Ga0209777_11160242 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 518 | Open in IMG/M |
| 3300027899|Ga0209668_10624076 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 721 | Open in IMG/M |
| 3300027963|Ga0209400_1056729 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1996 | Open in IMG/M |
| (restricted) 3300027970|Ga0247837_1190035 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 864 | Open in IMG/M |
| 3300027971|Ga0209401_1304942 | Not Available | 551 | Open in IMG/M |
| (restricted) 3300027977|Ga0247834_1040123 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2711 | Open in IMG/M |
| (restricted) 3300028044|Ga0247838_1250151 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 603 | Open in IMG/M |
| (restricted) 3300029268|Ga0247842_10517329 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 605 | Open in IMG/M |
| 3300031746|Ga0315293_10865006 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 656 | Open in IMG/M |
| 3300031857|Ga0315909_10009574 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 10464 | Open in IMG/M |
| 3300031951|Ga0315904_10086167 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3347 | Open in IMG/M |
| 3300031951|Ga0315904_10238484 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1751 | Open in IMG/M |
| 3300031951|Ga0315904_10808495 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 771 | Open in IMG/M |
| 3300032050|Ga0315906_10378435 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1242 | Open in IMG/M |
| 3300032050|Ga0315906_10572090 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 938 | Open in IMG/M |
| 3300032561|Ga0316222_1207846 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 688 | Open in IMG/M |
| 3300032562|Ga0316226_1399643 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 501 | Open in IMG/M |
| 3300032665|Ga0316221_1272291 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 537 | Open in IMG/M |
| 3300034012|Ga0334986_0042481 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2931 | Open in IMG/M |
| 3300034022|Ga0335005_0584048 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 608 | Open in IMG/M |
| 3300034061|Ga0334987_0572145 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 673 | Open in IMG/M |
| 3300034062|Ga0334995_0121507 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1936 | Open in IMG/M |
| 3300034062|Ga0334995_0527150 | Not Available | 704 | Open in IMG/M |
| 3300034101|Ga0335027_0649855 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 634 | Open in IMG/M |
| 3300034102|Ga0335029_0044678 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3276 | Open in IMG/M |
| 3300034111|Ga0335063_0311335 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 831 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 28.19% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 14.89% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 13.30% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater | 12.23% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 10.64% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater | 3.19% |
| Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 3.19% |
| Freshwater Lake Hypolimnion | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake Hypolimnion | 2.66% |
| Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment | 2.13% |
| Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Lentic | 1.60% |
| Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 1.60% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 1.06% |
| Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 1.06% |
| Lake | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Lake | 0.53% |
| Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater And Sediment | 0.53% |
| Anoxic Zone Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Anoxic Zone Freshwater | 0.53% |
| Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Lake | 0.53% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 0.53% |
| Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Lake Sediment | 0.53% |
| Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 0.53% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 0.53% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300002092 | Lentic bog actinobacteria communities from Grosse Fuchskuhle, Germany - Sample acI-B2 co-culture F-B6 metagenome | Environmental | Open in IMG/M |
| 3300002098 | Lentic bog actinobacteria communities from Grosse Fuchskuhle, Germany - Sample acI-B2 co-culture F-B7 metagenome | Environmental | Open in IMG/M |
| 3300002476 | Freshwater microbial communities from San Paulo Zoo lake, Brazil - NOV 2012 | Environmental | Open in IMG/M |
| 3300002933 | Combined Assembly of freshwater hypolimnion microbial communities from Trout Bog Lake, Wisconsin, USA | Environmental | Open in IMG/M |
| 3300003375 | Freshwater actinobacteria microbial communities from Trout Bog Lake, Wisconsin, USA - enrichment TB-E6 | Environmental | Open in IMG/M |
| 3300003852 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies -HBP12 HB | Environmental | Open in IMG/M |
| 3300004095 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE03Jun09 | Environmental | Open in IMG/M |
| 3300004770 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE25Aug07 | Environmental | Open in IMG/M |
| 3300004772 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - MA0.5M | Environmental | Open in IMG/M |
| 3300004774 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - MA5M | Environmental | Open in IMG/M |
| 3300004776 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - MA14M | Environmental | Open in IMG/M |
| 3300004804 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - MA0M | Environmental | Open in IMG/M |
| 3300005527 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG | Environmental | Open in IMG/M |
| 3300005581 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF | Environmental | Open in IMG/M |
| 3300005582 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF | Environmental | Open in IMG/M |
| 3300005662 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 4) | Environmental | Open in IMG/M |
| 3300005805 | Microbial and algae communities from Cheney Reservoir in Wichita, Kansas, USA | Environmental | Open in IMG/M |
| 3300006071 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH24Aug09 | Environmental | Open in IMG/M |
| 3300006072 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH12Aug09 | Environmental | Open in IMG/M |
| 3300006100 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE18Aug09 | Environmental | Open in IMG/M |
| 3300008267 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0024-100-LTR | Environmental | Open in IMG/M |
| 3300009068 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_MF_MetaG | Environmental | Open in IMG/M |
| 3300009151 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_MF_MetaG | Environmental | Open in IMG/M |
| 3300009155 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaG | Environmental | Open in IMG/M |
| 3300009158 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG | Environmental | Open in IMG/M |
| 3300009159 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG | Environmental | Open in IMG/M |
| 3300009160 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_MF_MetaG | Environmental | Open in IMG/M |
| 3300009161 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130207_XF_MetaG | Environmental | Open in IMG/M |
| 3300009163 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140205_XF_MetaG | Environmental | Open in IMG/M |
| 3300009181 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_MF_MetaG | Environmental | Open in IMG/M |
| 3300009182 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130625_EF_MetaG | Environmental | Open in IMG/M |
| 3300009183 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG | Environmental | Open in IMG/M |
| 3300009502 | Freshwater microbial communities from Finland to study Microbial Dark Matter (Phase II) - AM7a DNA metaG | Environmental | Open in IMG/M |
| 3300010157 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_MF_MetaG | Environmental | Open in IMG/M |
| 3300010158 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130625_MF_MetaG | Environmental | Open in IMG/M |
| 3300010334 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_EF_MetaG (v2) | Environmental | Open in IMG/M |
| 3300010354 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNA | Environmental | Open in IMG/M |
| 3300010885 | northern Canada Lakes Co-assembly | Environmental | Open in IMG/M |
| 3300011113 | Freshwater viral communities from Lake Soyang, Gangwon-do, South Korea - SYL_2015Sep | Environmental | Open in IMG/M |
| 3300011116 | Freshwater viral communities from Lake Soyang, Gangwon-do, South Korea - SYL_2015Nov | Environmental | Open in IMG/M |
| 3300012000 | Freshwater microbial communities from Lake Lanier in Georgia, USA - LL_1007A | Environmental | Open in IMG/M |
| 3300012012 | Freshwater microbial communities from Eastern Basin Lake Erie, Ontario, Canada - Station 879 - Top - Depth 1m | Environmental | Open in IMG/M |
| 3300012017 | Freshwater microbial communities from Central Basin Lake Erie, Ontario, Canada - Station 1208 - Top - Depth 1m | Environmental | Open in IMG/M |
| 3300013004 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES118 metaG | Environmental | Open in IMG/M |
| 3300013006 | Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - GEODES005 metaG | Environmental | Open in IMG/M |
| 3300013014 | Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - GEODES006 metaG | Environmental | Open in IMG/M |
| 3300013093 | Dystrophic lake water microbial communities from Trout Bog Lake, Wisconsin, USA - GEODES057 metaG | Environmental | Open in IMG/M |
| 3300013295 | northern Canada Lakes metatranscriptome co-assembly | Environmental | Open in IMG/M |
| 3300017707 | Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MLB.S.N | Environmental | Open in IMG/M |
| 3300017716 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.DCM.D | Environmental | Open in IMG/M |
| 3300017747 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MLB.S.N | Environmental | Open in IMG/M |
| 3300017754 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.D.D | Environmental | Open in IMG/M |
| 3300017761 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.N | Environmental | Open in IMG/M |
| 3300017766 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.S.D | Environmental | Open in IMG/M |
| 3300017778 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.D | Environmental | Open in IMG/M |
| 3300018790 | Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - SP09_SKY_41 | Environmental | Open in IMG/M |
| 3300018868 | Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - SP09_SKY_50 | Environmental | Open in IMG/M |
| 3300019093 | Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - SP09_SKY_43 | Environmental | Open in IMG/M |
| 3300019784 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.D | Environmental | Open in IMG/M |
| 3300020048 | Microbial communities from Manganika and McQuade lakes, Minnesota, USA Combined Assembly of Gp0225457, Gp0225456, Gp0225455, Gp0225454, Gp0225453, Gp0224915 | Environmental | Open in IMG/M |
| 3300020141 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_104 megahit1 | Environmental | Open in IMG/M |
| 3300020151 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_202 megahit1 | Environmental | Open in IMG/M |
| 3300020159 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_108 megahit1 | Environmental | Open in IMG/M |
| 3300020160 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_105 megahit1 | Environmental | Open in IMG/M |
| 3300020161 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_101 megahit1 | Environmental | Open in IMG/M |
| 3300020162 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_201 megahit1 | Environmental | Open in IMG/M |
| 3300020172 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_102 megahit1 | Environmental | Open in IMG/M |
| 3300020727 | Freshwater microbial communities from Trout Bog Lake, WI - 29MAY2009 hypolimnion | Environmental | Open in IMG/M |
| 3300021135 | Freshwater microbial communities from Trout Bog Lake, WI - 03JUN2009 hypolimnion | Environmental | Open in IMG/M |
| 3300021142 | Freshwater microbial communities from Trout Bog Lake, WI - 29JUL2008 epilimnion | Environmental | Open in IMG/M |
| 3300021519 | Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Jun2016-L222-5m | Environmental | Open in IMG/M |
| 3300022190 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.N | Environmental | Open in IMG/M |
| 3300022407 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.S.D | Environmental | Open in IMG/M |
| 3300022555 | Alinen_combined assembly | Environmental | Open in IMG/M |
| 3300022592 | Freshwater microbial communities from thermokarst lake SAS2a, Kuujjuarapick, Canada - Sample Summer S3 | Environmental | Open in IMG/M |
| 3300023174 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1505 | Environmental | Open in IMG/M |
| 3300023184 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1503 | Environmental | Open in IMG/M |
| 3300025383 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE18Aug09 (SPAdes) | Environmental | Open in IMG/M |
| 3300025398 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE15Jun09 (SPAdes) | Environmental | Open in IMG/M |
| 3300025415 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE23Oct07 (SPAdes) | Environmental | Open in IMG/M |
| 3300025430 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH12Jul09 (SPAdes) | Environmental | Open in IMG/M |
| 3300025578 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - MA0.5M (SPAdes) | Environmental | Open in IMG/M |
| 3300025606 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - MA0M (SPAdes) | Environmental | Open in IMG/M |
| 3300027589 | Freshwater microbial communities from St. Lawrence River, New York, United States - Law_Cont_RepA_8d | Environmental | Open in IMG/M |
| 3300027708 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130625_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027728 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_14m | Environmental | Open in IMG/M |
| 3300027730 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_8m | Environmental | Open in IMG/M |
| 3300027733 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027734 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027736 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140205_XF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027741 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027747 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027749 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027754 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027759 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027769 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.DD (SPAdes) | Environmental | Open in IMG/M |
| 3300027782 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027805 | Freshwater and sediment microbial communities from dead zone in Sandusky Bay, Ohio, USA (SPAdes) | Environmental | Open in IMG/M |
| 3300027896 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies -HBP12 HB (SPAdes) | Environmental | Open in IMG/M |
| 3300027899 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - PLP11 PL (SPAdes) | Environmental | Open in IMG/M |
| 3300027963 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027970 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_14.5m | Environmental | Open in IMG/M |
| 3300027971 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027977 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_12m | Environmental | Open in IMG/M |
| 3300028044 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_15m | Environmental | Open in IMG/M |
| 3300029268 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_19m | Environmental | Open in IMG/M |
| 3300031746 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_20 | Environmental | Open in IMG/M |
| 3300031857 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125 | Environmental | Open in IMG/M |
| 3300031951 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA120 | Environmental | Open in IMG/M |
| 3300032050 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA122 | Environmental | Open in IMG/M |
| 3300032561 | Freshwater microbial communities from Trout Bog Lake, Wisconsin, USA - TBH18011 | Environmental | Open in IMG/M |
| 3300032562 | Freshwater microbial communities from Trout Bog Lake, Wisconsin, USA - TBH18017 | Environmental | Open in IMG/M |
| 3300032665 | Freshwater microbial communities from Trout Bog Lake, Wisconsin, USA - TBH18007 | Environmental | Open in IMG/M |
| 3300034012 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Aug2017-rr0027 | Environmental | Open in IMG/M |
| 3300034022 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Apr2018-rr0058 | Environmental | Open in IMG/M |
| 3300034061 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Sep2004-rr0028 | Environmental | Open in IMG/M |
| 3300034062 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Jul2012-rr0045 | Environmental | Open in IMG/M |
| 3300034101 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME19Sep2005-rr0107 | Environmental | Open in IMG/M |
| 3300034102 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Jul2002-rr0112 | Environmental | Open in IMG/M |
| 3300034111 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME03Oct2011-rr0186 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI24218J26658_10019998 | 3300002092 | Lentic | MGFYKNIEIEIMEWQARGRSVEDTYIYFKDYATHKDVVRIFARDCDEKTV* |
| JGI24218J26658_10202255 | 3300002092 | Lentic | GDGVMGFYKNIEIEIMEWQARGRSVDDTYIYFKDYVTHEDVVRIFARDCDEATV* |
| JGI24219J26650_10032542 | 3300002098 | Lentic | MGFYKNIEIEIMEWQARGRSVDDTYIYFKDYVTHEDVVRIFARDCDEATV* |
| metazooDRAFT_107779392 | 3300002476 | Lake | MGFFKDIEIEIMEWQARGCSIDDTYIYFKDYVSREDVERIFARECDEDLV* |
| G310J44882_100161234 | 3300002933 | Freshwater | MGSFKHIEIEIMHWQACGRTVEETYIYWKDYVTHEDVVRIFSQETV* |
| JGI26470J50227_10791321 | 3300003375 | Freshwater | MGFYKNIDIEIQEWQARGRSVEETYIYFKDYVTHEDVIRIFARETV* |
| Ga0031655_100480645 | 3300003852 | Freshwater Lake Sediment | MGFYKNIDIEIQEWQARGRSVEETYIYFKDYATYEDVVRIFARETV* |
| Ga0031655_103022241 | 3300003852 | Freshwater Lake Sediment | MGFFKNIEIEIMEWQARGRSIEDTYIYFKDYVTHEDVIRIFA |
| Ga0007829_100587801 | 3300004095 | Freshwater | MGFYKDIEIEIMEWQARGRSVEETYIYFKDYVTHEDVRRIFARECDEETA* |
| Ga0007804_10031018 | 3300004770 | Freshwater | MGFYKNIDIEIQEWQARGRSVEETYIYFKDYVTYEDVVRIFARETV* |
| Ga0007804_11509462 | 3300004770 | Freshwater | MGFYKNIEIEIMEWQARGRSVEDTYIYFKDYATLEDVVRIFARDCDEETV* |
| Ga0007791_100466943 | 3300004772 | Freshwater | MGFYKNIEIEIQEWQARGCGIEETYIYFKDYATYEDVVRIFAKETV* |
| Ga0007791_101307542 | 3300004772 | Freshwater | MGFYKNIEIEILEWRAFGRSVEDTYIYFKDYVTHEDVIRIFAGDLDEETV* |
| Ga0007791_101368522 | 3300004772 | Freshwater | MGSFKDIEIDIMEWQSLGRSINETYIYFKDYVTYEDVVRIFAREEIL* |
| Ga0007791_102109383 | 3300004772 | Freshwater | MGFYKNIEIEIMEWQARGRGIEETYIYFKDYVTHEDVARIFARDCDEETV* |
| Ga0007794_101392753 | 3300004774 | Freshwater | IMGFYKNIDIEIQEWQARGRSVEETYIYFKDYATYEDVVRIFARETV* |
| Ga0007794_101421432 | 3300004774 | Freshwater | MGSFKDIEIDIMEWQSMGRSINETYIYFKDYVTYEDVVRIFAREEIL* |
| Ga0007800_101614611 | 3300004776 | Freshwater | MGSFKHIEIEIMHWQACGRTVEETYIYWKDYVTHEAVVRIFSQETV* |
| Ga0007796_100793563 | 3300004804 | Freshwater | MGFFKNIHFEILEWQGRGCSVEDTYIYFKDYVTYQDVVRIFAEETV* |
| Ga0068876_106394912 | 3300005527 | Freshwater Lake | MGFYKDIEIEIMSWQARGRSPEETYIYFKDYVTQEDVARIFARDCDEETV* |
| Ga0049081_101344711 | 3300005581 | Freshwater Lentic | FKDIEIEIMHWQALGRTQAETFIYFKDYVTQEDVARIFARDCDEETV* |
| Ga0049080_100039812 | 3300005582 | Freshwater Lentic | MGSFKHIETEIMHWQACGRTQAETYIYWKDYVTQEDVARIFARDCDEETV* |
| Ga0078894_103485393 | 3300005662 | Freshwater Lake | MGFYKDIEIEIMHWQALGRTQAETYIYFKDYVTQEDVARIFARDCDEETV* |
| Ga0078894_104477614 | 3300005662 | Freshwater Lake | MGFYKNIEIEIMEWQARGRTVEDTYIYFKDYVTYEDVIRIFDKETA* |
| Ga0078894_112794942 | 3300005662 | Freshwater Lake | MGFYKDIEIEIMEWQARGRSAEETYIYFKDYVTQEDVARIFARECDEDVV*PKSKFARLL |
| Ga0078894_116838932 | 3300005662 | Freshwater Lake | MGFFKDIEIEIMHWQALGRSQDETYIYFKDYVTQEDVARIFARDCDEETV* |
| Ga0079957_10772032 | 3300005805 | Lake | MGFYKDIEIEIMHWQALGRSQAETYIYFKDYVTQEDVARIFARDCDEETV* |
| Ga0007876_10665603 | 3300006071 | Freshwater | MGFYKNIDIEIQEWQARGCSVEETYIYFKDYATYEDVVCIFARETV* |
| Ga0007881_10890532 | 3300006072 | Freshwater | MGSFKHIEIEIMHWQACGRTVEETYIYWKEYVTHEDVVRIFSQETV* |
| Ga0007806_10075263 | 3300006100 | Freshwater | MGFFKDIHYEILEWQARGSSVEDTYIYFKDYVTYEDVVCIFNEATV* |
| Ga0114364_100129331 | 3300008267 | Freshwater, Plankton | MGSFKHIETEIMHWQACGRTQEETYIYWKDYVTQEDVARIFARDCDEETV* |
| Ga0114364_10117169 | 3300008267 | Freshwater, Plankton | MGFFKDIEIEIMHWQALGRTQAETYIYFKDYVTQEDVARIFARDCDEETV* |
| Ga0114364_11542923 | 3300008267 | Freshwater, Plankton | MGFFKDIEIEIMHWQALGRTQAETYIYFKDYVTQEDVARIFARDCDE |
| Ga0114973_1000494010 | 3300009068 | Freshwater Lake | MGFYKNIEIEIMEWQARGRSIEDTYIYFKDYVTHEDVIRIFARDCDEETA* |
| Ga0114973_1000641710 | 3300009068 | Freshwater Lake | MGFYKNIEIEIMHWQARGRSVEDTYIYFKDYVTHEDVIRIFARECDEETV* |
| Ga0114962_1000048317 | 3300009151 | Freshwater Lake | MGSFKDIEIDIMEWQSLGRSIDETYIYFKDYVTLEDVVRIFAREEIL* |
| Ga0114962_100574414 | 3300009151 | Freshwater Lake | MGFYKNIEIKILEWRAFGRSVDDTYIYFKDYVTYEDVERIFAGDLDEETV* |
| Ga0114968_1000562316 | 3300009155 | Freshwater Lake | MGSFKDIEIDIMEWQYRGCSIEDTYIYFKDYVTLEDVVRIFAREEIL* |
| Ga0114968_1000751213 | 3300009155 | Freshwater Lake | MGSFKDIEIDIMEWQSLGRSIDETYIYFKDYVTYEDVVRIFAREEIL* |
| Ga0114968_106761291 | 3300009155 | Freshwater Lake | EIEILEWRACGRSIEDTYIYFKDYATYEDIKRIFAGDFDEETV* |
| Ga0114977_100528767 | 3300009158 | Freshwater Lake | MGFYKNIEIEIMEWQARGRTVEETYIYFKDYVTHEDVIRIFARECDEETV* |
| Ga0114977_102040054 | 3300009158 | Freshwater Lake | MGFYKNIEIEIMEWQARGRSIEDTYIYFKDYVTHEDVIRIFARDCDEETAK* |
| Ga0114977_103568671 | 3300009158 | Freshwater Lake | MGFYKDIEIEIMEWQALGRSQEGTYIYFKDYVTQEDVARIFARDCNEETV* |
| Ga0114977_103625323 | 3300009158 | Freshwater Lake | MGFYKDIHIEMLEWRARGCSLDEIYIYFKDYVTYEDVVRIFAGDFDEETA* |
| Ga0114978_1000124011 | 3300009159 | Freshwater Lake | MGFYKNIEIEIMEWQARGRSVEDTYIYFKDYVTHEDVIRIFARDCDEETV* |
| Ga0114978_102118294 | 3300009159 | Freshwater Lake | MGFYKDIHIEMLEWQARGCSIEETYIYFKDYVTYEDVVRIFAEETV* |
| Ga0114978_107259452 | 3300009159 | Freshwater Lake | MGFFKDIEIEIMDWQDQGRSIQDTYIYFKDYVTLEDVVRIFARDCDEATV* |
| Ga0114981_102023291 | 3300009160 | Freshwater Lake | IMGFYKNIEIEIMEWQARGRTVEETYIYFKDYVTHEDVIRIFARECDEETV* |
| Ga0114966_102514163 | 3300009161 | Freshwater Lake | MGSFKDIEIDIMEWQSLGRGIDETYIYFKDYVTYEDVVRIFSREEIL* |
| Ga0114970_107279631 | 3300009163 | Freshwater Lake | MGFYKNIEIEIMEWQARGRSIEDTYIYFKDYVTHEDVIRIFAR |
| Ga0114969_105398522 | 3300009181 | Freshwater Lake | MGSFKDIEIDIMEWQYRGCSIEDTYIYFKDYVTYEDVVRIFSREEIL* |
| Ga0114959_101073085 | 3300009182 | Freshwater Lake | MGSFKDIEIDIMEWQSLGCSIDETYIYFKDYVTYEDVVRIFSREEIL* |
| Ga0114974_1000063141 | 3300009183 | Freshwater Lake | MGSFKDIEIDIMEWQSMGRGINETYIYFKDYVTYEDVVRIFAREEIL* |
| Ga0114974_100187277 | 3300009183 | Freshwater Lake | MGFYKDIEIEIMQWQARGRTQAETYIYFKDYVTQEDVARIFARDCDEETV* |
| Ga0114974_101719912 | 3300009183 | Freshwater Lake | MGFFKDIELEIMEWQARGRTVEDTYIYFKDYVTHEDVIRIFARDCDEEIA* |
| Ga0114951_1000527517 | 3300009502 | Freshwater | MGFYKNIEIEIMEWQARGRSVEDTYIYFKDYVTHEDVVRIFARDCDEAAV* |
| Ga0114951_101901044 | 3300009502 | Freshwater | CGGLWGDGVMGFYKNIEIEIMEWQARGRSVEDTYIYFKDYVTHEDVVRIFARDCDEATV* |
| Ga0114951_102493053 | 3300009502 | Freshwater | MGSFKHIEIEIMHWQACGRTVEETYIYWKDYVTYEDVIRIFSQETV* |
| Ga0114951_102508743 | 3300009502 | Freshwater | MGFYKNIDIEIQEWQARGRSVEETYIYFKDYATYEDVVRIFARDCDEETV* |
| Ga0114951_105125482 | 3300009502 | Freshwater | MGFYKNIEIEIMEWQARGRSVEDTYIYFKDYVTHEDVVRIFARDCDEATV* |
| Ga0114951_106020631 | 3300009502 | Freshwater | MGSFKHIEIEIMHWQACGRTVEETYIYWKDYVTHEDVVR |
| Ga0114964_102179942 | 3300010157 | Freshwater Lake | MGFYKNIEIEILEWRARGRSTEDTYIYFKDYATYEDIERIFAGDFDEETV* |
| Ga0114960_102521922 | 3300010158 | Freshwater Lake | MGFYKNIEIEIMEWQARGRSVEETYIYFKDYATHEDIIRIFARNCDEETV* |
| Ga0114960_103856291 | 3300010158 | Freshwater Lake | MGSFKDIDIDIMEWQSLGRSIDETYIYFKDYVTYEDVVRI |
| Ga0114960_105959342 | 3300010158 | Freshwater Lake | MGSFKDIEIDIMEWQSLGRSIDETYIYFKDYVSYEDVVRIFEREEIL* |
| Ga0136644_106247021 | 3300010334 | Freshwater Lake | MGFYKNIEIEIMEWQARGRSIEDTYIYFKDYVTHEDVIRIFARDCDEATV* |
| Ga0136644_107449463 | 3300010334 | Freshwater Lake | MGFFKDIEIEIMAWQDQGRSIEDTYIYFKDYVAYEDVVRIFARDCDEEN |
| Ga0129333_117250942 | 3300010354 | Freshwater To Marine Saline Gradient | MGFYKDIEIEIMSWQARGCSQDETYIYFKDYVTQEDVARIFARDCDEDTVVDQ* |
| Ga0133913_110396292 | 3300010885 | Freshwater Lake | MGSFKDIEIDIMEWQSLGRSIDETYIYFKDYVTYEDVVRIFSREEIL* |
| Ga0133913_116014805 | 3300010885 | Freshwater Lake | MGFYKNIEIEIQEWQARGRSIEETYIYFKDYATYEDVVRIFAQETA* |
| Ga0133913_116531615 | 3300010885 | Freshwater Lake | MGFYKDIELEIMHWQALGRSQDETYIYFKDYVTQEDVARIFARECDEETV* |
| Ga0133913_124011503 | 3300010885 | Freshwater Lake | MGFYKNIEIEILEWRACGRSIEDTYIYFKDYATYEDIKRIFAGDFDEETV* |
| Ga0133913_129073381 | 3300010885 | Freshwater Lake | MGFFKDIEIEIMDWQDQGRSIQDTYIYFKDYVTYE |
| Ga0151517_1002156 | 3300011113 | Freshwater | MGFYKDIEIEIMQWQARGRTQDETYIYFKDYVTQEDVARIFARDCDEETV* |
| Ga0151516_1024837 | 3300011116 | Freshwater | MGFYKDIEIEIMQWQARGRSQDETYIYFKDYVTQEDVARIFARDCDEETV* |
| Ga0119951_10994612 | 3300012000 | Freshwater | MGFFKDIEIEIMDWQDQGRSIQDTYIYFKDYVTLEDVVRIFARDCDEATA* |
| Ga0119951_11182883 | 3300012000 | Freshwater | MGFYKDIEIEIMQWQARGRTQEETYIYFKDYVTQEDVARIFARDCDEETV* |
| Ga0153799_10399341 | 3300012012 | Freshwater | SLCWGDSVMGFFKDIEIEIMHWQALGRTQAETYIYFKDYVTQEDVARIFARDCDEETV* |
| Ga0153801_10317114 | 3300012017 | Freshwater | IMGFFKDIEIEIMHWQALGRTQAETYIYFKDYVTQEDVARIFARDCDEETV* |
| Ga0164293_108646393 | 3300013004 | Freshwater | MGFYKDIEIMSWQARGRSQDETYIYFKDYVTQEDVARIFARDCDEETV* |
| Ga0164294_103518362 | 3300013006 | Freshwater | MGFYKNIEIEILEWRARSRTVEDTYIYFKDYVTHEDVIRIFAGDLDEETA* |
| Ga0164294_104151384 | 3300013006 | Freshwater | MGSFKDIEIDIMEWQYRGCSIEDTYIYFKDYVTYEDVVRIFAREEIL* |
| Ga0164294_105425612 | 3300013006 | Freshwater | MGSFKHIETEIMHWQACGRTQEETYIYWKDYVTQEDVIRIFARDCDKETV* |
| Ga0164295_101818835 | 3300013014 | Freshwater | MGFFKDIEIEIMDWQDQGRSIQDTYIYFKEYVTLEDVVRIFARDCDEATA* |
| Ga0164295_103145541 | 3300013014 | Freshwater | SQMGSFKDIEIDIMEWQSLGRGIDETYIYFKDYVTYEDVVRIFSREEIL* |
| Ga0164296_10303445 | 3300013093 | Freshwater | MIMGFFKDIHYEILEWQARGSSVEDTYIYFKDYVTYEDVVRIFNEATV* |
| Ga0170791_114771173 | 3300013295 | Freshwater | MGFYKNIEIEIMHWQARGRSVENTYIYFKDYVTHEDVIRIFARECDEETV* |
| Ga0181363_10414502 | 3300017707 | Freshwater Lake | MGFYKDIEIEIMQWQARGRSQAETYIYFKDYVTQEDVARIFARDCDEETV |
| Ga0181350_10697343 | 3300017716 | Freshwater Lake | MGFYKNIEIEILEWRSRGRGVDDTYIYFKDYATYEDIVRIFAGDFDEETV |
| Ga0181352_11984432 | 3300017747 | Freshwater Lake | MGFYKNIEIEIMEWQARGRTVEDTYIYFKDYVTDEDVIRIFDKETA |
| Ga0181344_10084907 | 3300017754 | Freshwater Lake | MGFYKNIHIEIQEWQARGRSIEETYIYFKDYVTFEDVVRIFAEETV |
| Ga0181344_12220072 | 3300017754 | Freshwater Lake | MGSFKHIETEIMHWQACGRTQEETYIYWKDYVSQEDVARIFAHDCDEETV |
| Ga0181356_10523131 | 3300017761 | Freshwater Lake | MGFFKDIEIEIMHWQALGRTQAETYIYFKDYVTQEDV |
| Ga0181343_10838643 | 3300017766 | Freshwater Lake | MGFYKNIHIEIQEWQARGRNIEETYIYFKDYVTFEDVVRIFAEETV |
| Ga0181343_11269151 | 3300017766 | Freshwater Lake | MGFYKDIEIEIMEWQARGRSQAETYIYFKDYVTQEDVARIFARDCDEETV |
| Ga0181349_10669245 | 3300017778 | Freshwater Lake | MGFFKDIEIEIMHWQALGRTQAETFIYFKDYVTQEDVARIFARDCDEETV |
| Ga0187842_10467264 | 3300018790 | Freshwater | MGSFKDIEIDIMEWQSLGRSINETYIYFKDYVTYEDVVRIFSREEIL |
| Ga0187844_101924574 | 3300018868 | Freshwater | MGSFKDIEIDIMEWQYRGCSIEDTYIYFKDYVTYEDVV |
| Ga0187843_100180029 | 3300019093 | Freshwater | MGSFKDIEIDIMEWQYRGCSIEDTYIYFKDYVTYEDVVRIFAREEIL |
| Ga0187843_100233146 | 3300019093 | Freshwater | MGSFKDIEIDIMEWQSLGRSINETYIYFKDYVTYEDVVRIFAREEIL |
| Ga0187843_100517116 | 3300019093 | Freshwater | MGSFKDIEIDIMEWQSLGRGIDETYIYFKDYVTYEDVVRIFSREEIL |
| Ga0187843_102009913 | 3300019093 | Freshwater | MGFYKNIEIEILEWRARSRTVEDTYIYFKDYVTHEDVIRIFAGDLDEETA |
| Ga0181359_10635601 | 3300019784 | Freshwater Lake | MGFFKDIEIEIMHWQALGRTQAETYIYFKDYVTQEDVARIFARDCDEETV |
| Ga0181359_10845571 | 3300019784 | Freshwater Lake | MGFFKDIEIEIMHWQSLGRTQAETYIYFKDYVTQEDVARIFARDCDEETV |
| Ga0181359_12323673 | 3300019784 | Freshwater Lake | MGSFKHIEIEIMHWQACGRTVEETYIYWKDYVTQEDVARIFARDCDEETV |
| Ga0207193_13970392 | 3300020048 | Freshwater Lake Sediment | MIVGSFKHIETEIMYWQACGRSQEETYVYWKDYVTQEDVARIFAQDYDLDPT |
| Ga0211732_15699715 | 3300020141 | Freshwater | MGFYKDIEIEIMHWQSLGRSQAETYIYFKDYVTQEDVARIFARDCDEDLV |
| Ga0211736_105470242 | 3300020151 | Freshwater | MGFYKDIELEIMHWQALGRSQAETYIYFKDYVTQEDVARIFARDCDEETV |
| Ga0211734_111123294 | 3300020159 | Freshwater | MGFYKDIEIEIMQWQSRGRTQDETYIYFKDYVTQEDVARIFARDCDEETV |
| Ga0211734_111879801 | 3300020159 | Freshwater | MGFYKDIEIEIMHWQALGRSQAETYIYFKDYVTQEDVARIFARDCDEETV |
| Ga0211733_109405423 | 3300020160 | Freshwater | MGFFKDIEIEIMHWQGLGRSVDETYIYFKDYVTYEDVARIFARECDEDLV |
| Ga0211726_104364082 | 3300020161 | Freshwater | MGSFKHIETEIMHWQACGRTQEETYIYWKDYVTQEDVARIFARNCDEETV |
| Ga0211735_115455461 | 3300020162 | Freshwater | QSLCWGGSVMGFYKDIELEIMHWQALGRSQAETYIYFKDYVTQEDVARIFARDCDEETV |
| Ga0211729_100950552 | 3300020172 | Freshwater | MGSFKHIETEIMHWQACGRTQEETYIYWKDYVTQEDVARIFARDCDEETV |
| Ga0214246_10229073 | 3300020727 | Freshwater | MGSFKHIEIEIMHWQACGRTVEETYIYRKDYVTHEDVVRIFSQETV |
| Ga0214247_10684592 | 3300021135 | Freshwater | MGFYKNIDIEIQEWQARGRSVEETYIYFKDYATYEDVVRIFARETV |
| Ga0214192_10979612 | 3300021142 | Freshwater | MGFFKNIEIEIMEWQARGRSIEDTYIYFKDYVTHEDVIRIFARDCDEEIV |
| Ga0214192_11852021 | 3300021142 | Freshwater | MGFFKDIHYEILEWQARGSSVEDTYIYFKDYVTYEDVVRIFNEATV |
| Ga0194048_100968433 | 3300021519 | Anoxic Zone Freshwater | MGSFKHIETEIMHWQACGHTVEETYIYWKDYVTHEDVIRIFARECDEETA |
| Ga0181354_11105871 | 3300022190 | Freshwater Lake | MGSFKHIEIEIMHWQACGRTVEETYIYWKDYVTQEDV |
| Ga0181351_10477325 | 3300022407 | Freshwater Lake | MGFFKDIEIEIMHWQSLGRTQAEFYIYFKDYVTQEDVARIFARDCDEETV |
| Ga0212088_100130155 | 3300022555 | Freshwater Lake Hypolimnion | MGFYKNIEIEIMEWQARGRSVEDTYIYFKDYVTHEDVVRIFARDCDEAAV |
| Ga0212088_1004818610 | 3300022555 | Freshwater Lake Hypolimnion | MGSFKHIEIEIMHWQACGRTVEETYIYWKDYVTHEDVVRIFSQETV |
| Ga0212088_101569263 | 3300022555 | Freshwater Lake Hypolimnion | MGFYKNIEIEIMEWQARGRSVEDTYIYFKDYATLEDVVRIFARDCDEETV |
| Ga0212088_101753082 | 3300022555 | Freshwater Lake Hypolimnion | MGSFKHIEIEIMHWQACGRTVEETYIYWKDYVTYEDVIRIFSQETV |
| Ga0212088_107003672 | 3300022555 | Freshwater Lake Hypolimnion | MGFYKNIEIEIMEWQARGRSVEDTYIYFKDYVTHEDVVRIFARDCDEATV |
| Ga0236342_10474813 | 3300022592 | Freshwater | MGFYKNIDIEIQEWQARGRSVEETYIYFKDYVTHEDVIRIFARETV |
| Ga0214921_1000001676 | 3300023174 | Freshwater | MGFFKDIEIEIMDWQDQGRSIQDTYIYFKDYVTLEDVVRIFARDCDEATA |
| Ga0214921_10000372100 | 3300023174 | Freshwater | MGFYKDIEIQIMEWQARGRTQAETYIYFKDYVTQEDVARIFARECDEDLV |
| Ga0214921_105105261 | 3300023174 | Freshwater | GFYKDIEIEIMQWQARGRTQEETYIYFKDYVTQEDVACIFARDCDEETV |
| Ga0214919_1000098841 | 3300023184 | Freshwater | MGSFKDIEIDIMEWQSMGRSINETYIYFKDYVTYEDVVRIFAREEIL |
| Ga0208250_10083363 | 3300025383 | Freshwater | MGFFKDIHYEILEWQARGSSVEDTYIYFKDYVTYEDVVCIFNEATV |
| Ga0208251_10391753 | 3300025398 | Freshwater | MGFYKNIDIEIQEWQARGRSVEETYIYFKDYVTYEDVVRIFARETV |
| Ga0208868_10543382 | 3300025415 | Freshwater | MGFMKDIHLEICEWFGRGCTVEETYIYFKDYVTYEDVQRIRDEDFDKEPV |
| Ga0208622_10860292 | 3300025430 | Freshwater | MGSFKHIEIEIMHWQACGRTVEETYIYWKDYVTHEDVVRIFCQETV |
| Ga0208864_10069832 | 3300025578 | Freshwater | MGFYKNIEIEIQEWQARGCGIEETYIYFKDYATYEDVVRIFAKETV |
| Ga0208864_10931833 | 3300025578 | Freshwater | MGFYKNIEIEILEWRAFGRSVEDTYIYFKDYVTHEDVIRIFAGDLDEETV |
| Ga0208864_11550971 | 3300025578 | Freshwater | MGFYKNIEIEIMEWQARGRGIEETYIYFKDYVTHEDVARIFARDCDEETV |
| Ga0207954_10521233 | 3300025606 | Freshwater | MGFFKNIHFEILEWQGRGCSVEDTYIYFKDYVTYQDVVRIFAEETV |
| Ga0255123_10185524 | 3300027589 | Freshwater | MGFFKDIQIEIMHWQALGRTQAETYIYFKDYVTQEDVARIFARDCDEQTGEHWPIEADSN |
| Ga0209188_12582772 | 3300027708 | Freshwater Lake | MGSFKDIEIDIMEWQSLGCSIDETYIYFKDYVTYEDVVRIFSREEIL |
| (restricted) Ga0247836_10538865 | 3300027728 | Freshwater | MGSFKHIEIEIMHWQACGRTVEETYIYWKDYVTQEDVARIFAQETV |
| (restricted) Ga0247833_10599105 | 3300027730 | Freshwater | MGFYKDIEIEIMHWQSLGRSQAETYIYFKDYVTQEDVARIFARDCDEETV |
| Ga0209297_11632421 | 3300027733 | Freshwater Lake | MGFYKNIEIEIMEWQARGRSIEDTYIYFKDYVTHEDVIRIFARDCDEETA |
| Ga0209297_12404283 | 3300027733 | Freshwater Lake | MGFYKDIEIEIMEWQALGRSQEGTYIYFKDYVTQEDVARIFARDCNEETV |
| Ga0209087_10209497 | 3300027734 | Freshwater Lake | MGFYKNIEIEIMEWQARGRTVEETYIYFKDYVTHEDVIRIFARECDEETV |
| Ga0209087_10309964 | 3300027734 | Freshwater Lake | MGFYKDIHIEMLEWRARGCSLDEIYIYFKDYVTYEDVVRIFAGDFDEETA |
| Ga0209087_12357082 | 3300027734 | Freshwater Lake | MGFYKDIHIEMLEWQARGCSIEETYIYFKDYVTYEDVVRIFAEETV |
| Ga0209190_11221151 | 3300027736 | Freshwater Lake | MGSFKDIEIDIMEWQSLGRSIDETYIYFKDYVTYEDVVRIFAREEIL |
| Ga0209190_13826092 | 3300027736 | Freshwater Lake | MGSFKDIEIDIMEWQSLGRSIDETYIYFKDYVTYEDVVRIFSREEIL |
| Ga0209085_11517243 | 3300027741 | Freshwater Lake | MGSFKDIEIDIMEWQSLGRSIDETYIYFKDYVTLEDVVRIFAREEIL |
| Ga0209189_13988821 | 3300027747 | Freshwater Lake | MGFYKNIEIEIMEWQARGRSVEETYIYFKDYATHEDIIRIFARNCDEETV |
| Ga0209084_10443882 | 3300027749 | Freshwater Lake | MGFYKNIEIKILEWRAFGRSVDDTYIYFKDYVTYEDVERIFAGDLDEETV |
| Ga0209596_13078562 | 3300027754 | Freshwater Lake | MGSFKDIEIDIMEWQYRGCSIEDTYIYFKDYVTYEDVVRIFSREEIL |
| Ga0209296_100195622 | 3300027759 | Freshwater Lake | MGFYKDIEIEIMQWQARGRTQAETYIYFKDYVTQEDVARIFARDCDEETV |
| Ga0209296_100288016 | 3300027759 | Freshwater Lake | MGFFKDIEIEIMDWQDQGRSIQDTYIYFKDYVTLEDVVRIFARDCDEATV |
| Ga0209296_101134010 | 3300027759 | Freshwater Lake | MGSFKDIEIDIMEWQSMGRGINETYIYFKDYVTYEDVVRIFAREEIL |
| Ga0209296_10753672 | 3300027759 | Freshwater Lake | MGFYKNIEIEIMEWQARGRTVEDTYIYFKDYVTYEDVIRIFDKETA |
| Ga0209770_103988512 | 3300027769 | Freshwater Lake | MGFYKDIEIEIMEWQARGRSAEETYIYFKDYVTQEDVARIFARECDEDVV |
| Ga0209500_100505314 | 3300027782 | Freshwater Lake | MGFYKNIEIEIMEWQARGRSVEDTYIYFKDYVTHEDVIRIFARDCDEETV |
| Ga0209500_103134292 | 3300027782 | Freshwater Lake | MGFYKDIHIEMLEWQARGCSIEETYIYFKDYVTYEDVVRIFAEE |
| Ga0209229_100918582 | 3300027805 | Freshwater And Sediment | MGFFKDIEIEIMHWQALGRSQDETYIYFKDYVTQEDVARIFARDCDEETV |
| Ga0209777_111602422 | 3300027896 | Freshwater Lake Sediment | MGFYKNIEIEILEWRARGRSIEDTYIYFKDYVTYEDVERIFASDFDEETV |
| Ga0209668_106240761 | 3300027899 | Freshwater Lake Sediment | MGFYKDIEIEIMEWQARGRTQEETYIYFKDYVTYEDVVRIFAE |
| Ga0209400_10567292 | 3300027963 | Freshwater Lake | MGSFKDIEIDIMEWQYRGCSIEDTYIYFKDYVTLEDVVRIFAREEIL |
| (restricted) Ga0247837_11900351 | 3300027970 | Freshwater | MGFYKDIELEIMHWQSLGRSQAETYIYFKDYVTQEDVARIFARDCD |
| Ga0209401_13049423 | 3300027971 | Freshwater Lake | ITHTTQLESHMGSFKDIEIDIMEWQSLGRGIDETYIYFKDYVTYEDVVRIFSREEIL |
| (restricted) Ga0247834_10401236 | 3300027977 | Freshwater | MGFYKDIELEIMHWQSLGRSQAETYIYFKDYVTQEDVARIFARDCDEETV |
| (restricted) Ga0247838_12501511 | 3300028044 | Freshwater | FYKDIEIEIMHWQALGRSQAETYIYFKDYVTQEDVARIFARDCDEETV |
| (restricted) Ga0247842_105173291 | 3300029268 | Freshwater | MGSFKHIEIEIMHWQACGRTVEETYIYWKDYVTQEDVARIF |
| Ga0315293_108650062 | 3300031746 | Sediment | MGFFKHIEIEIMHWQACGRTVEETYIYWKDYVTHEDVIRIFARDCDEETV |
| Ga0315909_100095747 | 3300031857 | Freshwater | MGFYKDIELEIMSWQALGRSQDETYIYFKDYVTQEDVARIFARDCDEDTVVD |
| Ga0315904_100861671 | 3300031951 | Freshwater | MGFYKDIELEIMSWQALGRSQDETYIYFKDYVTQEDVARIFARDCDED |
| Ga0315904_102384841 | 3300031951 | Freshwater | MGFYKDIEIEIMSWQARGRTQDETYIYFKDYVTQEDV |
| Ga0315904_108084952 | 3300031951 | Freshwater | MGFFKDIEIEIMEWQARGRSLAETYIYFKDYVTQEDVARIYARDCDEETV |
| Ga0315906_103784352 | 3300032050 | Freshwater | MGSFKHIETEIMHWQACGRTQEETYIYWKDYVTQEDVARIFARDCDEDTVVD |
| Ga0315906_105720901 | 3300032050 | Freshwater | MGFYKDIEIEIMSWQARGRSPEETYIYFKDYVTQEDVARIFARDCDEE |
| Ga0316222_12078461 | 3300032561 | Freshwater | WGGSIMGFFKNIEIEIMEWQARGRSIEDTYIYFKDYVTHEDVIRIFARDCDEEIV |
| Ga0316226_13996432 | 3300032562 | Freshwater | MGFFKNIEIEIMEWQARGRSIEDTYIYFKDYVTHEDVIRIF |
| Ga0316221_12722913 | 3300032665 | Freshwater | FKNIEIEIMEWQARGRSIEDTYIYFKDYVTHEDVIRIFARDCDEEIV |
| Ga0334986_0042481_2582_2734 | 3300034012 | Freshwater | MGFYKDIELEIMHWQALGRSQDETYIYFKDYVTQEDVARIFARDCDEETV |
| Ga0335005_0584048_2_124 | 3300034022 | Freshwater | MGFFKDIEIEIMHWQALGRTQAETYIYFKDYVTQEDVARIF |
| Ga0334987_0572145_1_126 | 3300034061 | Freshwater | MGFYKDIEIEIMEWQARGRSQDETYIYFKDYVTQEDVARIFA |
| Ga0334995_0121507_1832_1936 | 3300034062 | Freshwater | MGFFKDIEIEIMHWQALGRTQAETYIYFKDYVTQE |
| Ga0334995_0527150_65_262 | 3300034062 | Freshwater | MVVRLGCPSLWGDSIMGFYKDIELEIMHWQALGRSQEATYIYFKDYVTQEDVARIFARDCDEETV |
| Ga0335027_0649855_137_289 | 3300034101 | Freshwater | MGFFKDIEIEIMEWQARGRGQDETYIYFKDYVTQEDVARIFARDCDEETV |
| Ga0335029_0044678_2864_3025 | 3300034102 | Freshwater | MGFYKDIELEIMHWQALGRSQEATYIYFKDYVTQEDVARIFARDCDQDTVVDQ |
| Ga0335063_0311335_530_682 | 3300034111 | Freshwater | MGFFKYIEIEIMHWQALGRTQAETYIYFKDYVTQEDVARIFARDCDEETV |
| ⦗Top⦘ |