| Basic Information | |
|---|---|
| Family ID | F029250 |
| Family Type | Metagenome |
| Number of Sequences | 189 |
| Average Sequence Length | 43 residues |
| Representative Sequence | MDAKGFVVPPGGGSILSMAPGRSAALKLLGGDTGDSVMLFEET |
| Number of Associated Samples | 132 |
| Number of Associated Scaffolds | 189 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 96.28 % |
| % of genes near scaffold ends (potentially truncated) | 95.77 % |
| % of genes from short scaffolds (< 2000 bps) | 93.65 % |
| Associated GOLD sequencing projects | 121 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.37 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (58.730 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (37.566 % of family members) |
| Environment Ontology (ENVO) | Unclassified (47.619 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (58.730 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 4.23% β-sheet: 14.08% Coil/Unstructured: 81.69% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.37 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 189 Family Scaffolds |
|---|---|---|
| PF01850 | PIN | 8.47 |
| PF13561 | adh_short_C2 | 8.47 |
| PF08450 | SGL | 2.65 |
| PF01145 | Band_7 | 1.59 |
| PF01734 | Patatin | 1.59 |
| PF01402 | RHH_1 | 1.59 |
| PF04226 | Transgly_assoc | 1.59 |
| PF01740 | STAS | 1.59 |
| PF04909 | Amidohydro_2 | 1.06 |
| PF00589 | Phage_integrase | 1.06 |
| PF12536 | DUF3734 | 1.06 |
| PF01494 | FAD_binding_3 | 1.06 |
| PF13470 | PIN_3 | 1.06 |
| PF12833 | HTH_18 | 0.53 |
| PF03466 | LysR_substrate | 0.53 |
| PF07366 | SnoaL | 0.53 |
| PF07813 | LTXXQ | 0.53 |
| PF12697 | Abhydrolase_6 | 0.53 |
| PF08241 | Methyltransf_11 | 0.53 |
| PF13649 | Methyltransf_25 | 0.53 |
| PF05198 | IF3_N | 0.53 |
| PF13358 | DDE_3 | 0.53 |
| PF13424 | TPR_12 | 0.53 |
| PF00691 | OmpA | 0.53 |
| PF07589 | PEP-CTERM | 0.53 |
| PF06745 | ATPase | 0.53 |
| PF04234 | CopC | 0.53 |
| PF00436 | SSB | 0.53 |
| PF05159 | Capsule_synth | 0.53 |
| PF00707 | IF3_C | 0.53 |
| PF16576 | HlyD_D23 | 0.53 |
| PF01636 | APH | 0.53 |
| PF07506 | RepB | 0.53 |
| PF05721 | PhyH | 0.53 |
| PF12680 | SnoaL_2 | 0.53 |
| PF00106 | adh_short | 0.53 |
| COG ID | Name | Functional Category | % Frequency in 189 Family Scaffolds |
|---|---|---|---|
| COG3386 | Sugar lactone lactonase YvrE | Carbohydrate transport and metabolism [G] | 2.65 |
| COG3391 | DNA-binding beta-propeller fold protein YncE | General function prediction only [R] | 2.65 |
| COG0654 | 2-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductases | Energy production and conversion [C] | 2.12 |
| COG3678 | Periplasmic chaperone Spy, Spy/CpxP family | Posttranslational modification, protein turnover, chaperones [O] | 2.12 |
| COG4667 | Predicted phospholipase, patatin/cPLA2 family | Lipid transport and metabolism [I] | 1.59 |
| COG1752 | Predicted acylesterase/phospholipase RssA, containd patatin domain | General function prediction only [R] | 1.59 |
| COG2261 | Uncharacterized membrane protein YeaQ/YmgE, transglycosylase-associated protein family | General function prediction only [R] | 1.59 |
| COG3621 | Patatin-like phospholipase/acyl hydrolase, includes sporulation protein CotR | General function prediction only [R] | 1.59 |
| COG0578 | Glycerol-3-phosphate dehydrogenase | Energy production and conversion [C] | 1.06 |
| COG0290 | Translation initiation factor IF-3 | Translation, ribosomal structure and biogenesis [J] | 1.06 |
| COG0644 | Dehydrogenase (flavoprotein) | Energy production and conversion [C] | 1.06 |
| COG0665 | Glycine/D-amino acid oxidase (deaminating) | Amino acid transport and metabolism [E] | 1.06 |
| COG5285 | Ectoine hydroxylase-related dioxygenase, phytanoyl-CoA dioxygenase (PhyH) family | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.53 |
| COG3563 | Capsule polysaccharide export protein KpsC/LpsZ | Cell wall/membrane/envelope biogenesis [M] | 0.53 |
| COG3562 | Capsule polysaccharide modification protein KpsS | Cell wall/membrane/envelope biogenesis [M] | 0.53 |
| COG2965 | Primosomal replication protein N | Replication, recombination and repair [L] | 0.53 |
| COG2372 | Copper-binding protein CopC (methionine-rich) | Inorganic ion transport and metabolism [P] | 0.53 |
| COG1475 | Chromosome segregation protein Spo0J, contains ParB-like nuclease domain | Cell cycle control, cell division, chromosome partitioning [D] | 0.53 |
| COG0629 | Single-stranded DNA-binding protein | Replication, recombination and repair [L] | 0.53 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 58.73 % |
| Unclassified | root | N/A | 41.27 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2189573004|GZGWRS402HK7AP | All Organisms → cellular organisms → Bacteria | 502 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_101801835 | Not Available | 513 | Open in IMG/M |
| 3300004092|Ga0062389_100282437 | Not Available | 1713 | Open in IMG/M |
| 3300004092|Ga0062389_101426751 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 877 | Open in IMG/M |
| 3300004635|Ga0062388_101708891 | All Organisms → cellular organisms → Bacteria | 643 | Open in IMG/M |
| 3300005332|Ga0066388_102998421 | Not Available | 863 | Open in IMG/M |
| 3300005439|Ga0070711_101357780 | Not Available | 618 | Open in IMG/M |
| 3300005518|Ga0070699_102020947 | Not Available | 527 | Open in IMG/M |
| 3300005536|Ga0070697_101644165 | All Organisms → cellular organisms → Bacteria | 574 | Open in IMG/M |
| 3300005540|Ga0066697_10444469 | Not Available | 747 | Open in IMG/M |
| 3300005560|Ga0066670_10827612 | Not Available | 561 | Open in IMG/M |
| 3300005617|Ga0068859_102265686 | Not Available | 599 | Open in IMG/M |
| 3300005764|Ga0066903_103324494 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 869 | Open in IMG/M |
| 3300005764|Ga0066903_103616383 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 832 | Open in IMG/M |
| 3300005764|Ga0066903_104839865 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 716 | Open in IMG/M |
| 3300005842|Ga0068858_102577307 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 502 | Open in IMG/M |
| 3300005844|Ga0068862_101846267 | Not Available | 614 | Open in IMG/M |
| 3300006163|Ga0070715_10885532 | Not Available | 548 | Open in IMG/M |
| 3300006755|Ga0079222_10752898 | Not Available | 784 | Open in IMG/M |
| 3300007258|Ga0099793_10410618 | Not Available | 666 | Open in IMG/M |
| 3300009088|Ga0099830_11444037 | Not Available | 572 | Open in IMG/M |
| 3300009156|Ga0111538_13907073 | Not Available | 515 | Open in IMG/M |
| 3300009553|Ga0105249_13132619 | Not Available | 531 | Open in IMG/M |
| 3300009683|Ga0116224_10077729 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1615 | Open in IMG/M |
| 3300009792|Ga0126374_11596659 | Not Available | 539 | Open in IMG/M |
| 3300009792|Ga0126374_11880696 | Not Available | 503 | Open in IMG/M |
| 3300010047|Ga0126382_11183934 | Not Available | 683 | Open in IMG/M |
| 3300010048|Ga0126373_10349142 | All Organisms → cellular organisms → Bacteria | 1491 | Open in IMG/M |
| 3300010048|Ga0126373_10577731 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Rhodovastum → Rhodovastum atsumiense | 1174 | Open in IMG/M |
| 3300010048|Ga0126373_10877113 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 961 | Open in IMG/M |
| 3300010048|Ga0126373_12352544 | All Organisms → cellular organisms → Bacteria | 593 | Open in IMG/M |
| 3300010048|Ga0126373_12489781 | All Organisms → cellular organisms → Bacteria | 577 | Open in IMG/M |
| 3300010048|Ga0126373_12575994 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Rhizobiales bacterium GAS113 | 567 | Open in IMG/M |
| 3300010048|Ga0126373_12606730 | Not Available | 564 | Open in IMG/M |
| 3300010048|Ga0126373_13080476 | All Organisms → cellular organisms → Bacteria | 519 | Open in IMG/M |
| 3300010358|Ga0126370_10282520 | All Organisms → cellular organisms → Bacteria | 1306 | Open in IMG/M |
| 3300010358|Ga0126370_10868795 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 811 | Open in IMG/M |
| 3300010358|Ga0126370_11348490 | All Organisms → cellular organisms → Bacteria | 671 | Open in IMG/M |
| 3300010358|Ga0126370_12296656 | Not Available | 534 | Open in IMG/M |
| 3300010360|Ga0126372_12748544 | Not Available | 544 | Open in IMG/M |
| 3300010361|Ga0126378_12632081 | All Organisms → cellular organisms → Bacteria | 575 | Open in IMG/M |
| 3300010361|Ga0126378_12707066 | All Organisms → cellular organisms → Bacteria | 566 | Open in IMG/M |
| 3300010366|Ga0126379_10238188 | All Organisms → cellular organisms → Bacteria | 1782 | Open in IMG/M |
| 3300010376|Ga0126381_100657880 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Reyranellaceae → Reyranella → Reyranella massiliensis | 1495 | Open in IMG/M |
| 3300010376|Ga0126381_103410834 | All Organisms → cellular organisms → Bacteria | 625 | Open in IMG/M |
| 3300010376|Ga0126381_104349151 | Not Available | 548 | Open in IMG/M |
| 3300010396|Ga0134126_11170275 | Not Available | 855 | Open in IMG/M |
| 3300012198|Ga0137364_11174075 | Not Available | 576 | Open in IMG/M |
| 3300012361|Ga0137360_10885014 | Not Available | 770 | Open in IMG/M |
| 3300012362|Ga0137361_11232369 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae → Undibacterium → unclassified Undibacterium → Undibacterium sp. KW1 | 671 | Open in IMG/M |
| 3300012917|Ga0137395_11119949 | Not Available | 556 | Open in IMG/M |
| 3300012918|Ga0137396_10881142 | Not Available | 657 | Open in IMG/M |
| 3300012922|Ga0137394_11271548 | Not Available | 599 | Open in IMG/M |
| 3300012924|Ga0137413_11649812 | Not Available | 525 | Open in IMG/M |
| 3300012971|Ga0126369_13445601 | All Organisms → cellular organisms → Bacteria | 518 | Open in IMG/M |
| 3300014501|Ga0182024_10325658 | All Organisms → cellular organisms → Bacteria | 2019 | Open in IMG/M |
| 3300015373|Ga0132257_101354604 | Not Available | 904 | Open in IMG/M |
| 3300016294|Ga0182041_10254842 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 1430 | Open in IMG/M |
| 3300016294|Ga0182041_10486396 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 1067 | Open in IMG/M |
| 3300016294|Ga0182041_11004339 | All Organisms → cellular organisms → Bacteria | 754 | Open in IMG/M |
| 3300016319|Ga0182033_10728842 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 870 | Open in IMG/M |
| 3300016341|Ga0182035_10186029 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 1631 | Open in IMG/M |
| 3300016357|Ga0182032_10303163 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1262 | Open in IMG/M |
| 3300016371|Ga0182034_10528529 | Not Available | 987 | Open in IMG/M |
| 3300016371|Ga0182034_10672311 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 878 | Open in IMG/M |
| 3300016387|Ga0182040_10171608 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Neisseriales → Chromobacteriaceae → Chitinilyticum → Chitinilyticum litopenaei | 1568 | Open in IMG/M |
| 3300016387|Ga0182040_10212066 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1431 | Open in IMG/M |
| 3300016387|Ga0182040_10784217 | All Organisms → cellular organisms → Bacteria | 784 | Open in IMG/M |
| 3300016387|Ga0182040_11616541 | All Organisms → cellular organisms → Bacteria | 552 | Open in IMG/M |
| 3300016404|Ga0182037_10984906 | All Organisms → cellular organisms → Bacteria | 734 | Open in IMG/M |
| 3300016404|Ga0182037_11187665 | Not Available | 670 | Open in IMG/M |
| 3300016404|Ga0182037_11224314 | All Organisms → cellular organisms → Bacteria | 660 | Open in IMG/M |
| 3300016422|Ga0182039_10302059 | All Organisms → cellular organisms → Bacteria | 1326 | Open in IMG/M |
| 3300016422|Ga0182039_10967368 | Not Available | 762 | Open in IMG/M |
| 3300016445|Ga0182038_10998426 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 741 | Open in IMG/M |
| 3300017973|Ga0187780_11024644 | All Organisms → cellular organisms → Bacteria | 602 | Open in IMG/M |
| 3300017974|Ga0187777_10330764 | Not Available | 1045 | Open in IMG/M |
| 3300020579|Ga0210407_10013478 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 6088 | Open in IMG/M |
| 3300020579|Ga0210407_10222508 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1468 | Open in IMG/M |
| 3300020579|Ga0210407_10928211 | Not Available | 666 | Open in IMG/M |
| 3300020580|Ga0210403_10709377 | Not Available | 805 | Open in IMG/M |
| 3300020580|Ga0210403_10927272 | All Organisms → cellular organisms → Bacteria | 685 | Open in IMG/M |
| 3300020580|Ga0210403_10947065 | All Organisms → cellular organisms → Bacteria | 676 | Open in IMG/M |
| 3300020583|Ga0210401_10234724 | All Organisms → cellular organisms → Bacteria | 1693 | Open in IMG/M |
| 3300021088|Ga0210404_10413151 | Not Available | 756 | Open in IMG/M |
| 3300021168|Ga0210406_10041682 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 4067 | Open in IMG/M |
| 3300021168|Ga0210406_10578942 | Not Available | 879 | Open in IMG/M |
| 3300021168|Ga0210406_10936703 | All Organisms → cellular organisms → Bacteria | 649 | Open in IMG/M |
| 3300021168|Ga0210406_11157203 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae → Undibacterium → unclassified Undibacterium → Undibacterium sp. KW1 | 566 | Open in IMG/M |
| 3300021170|Ga0210400_11165330 | All Organisms → cellular organisms → Bacteria | 622 | Open in IMG/M |
| 3300021171|Ga0210405_10379828 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1113 | Open in IMG/M |
| 3300021180|Ga0210396_11195246 | Not Available | 637 | Open in IMG/M |
| 3300021401|Ga0210393_11649974 | Not Available | 508 | Open in IMG/M |
| 3300021403|Ga0210397_10865703 | Not Available | 699 | Open in IMG/M |
| 3300021405|Ga0210387_10587667 | Not Available | 989 | Open in IMG/M |
| 3300021407|Ga0210383_11734486 | Not Available | 511 | Open in IMG/M |
| 3300021432|Ga0210384_10599878 | All Organisms → cellular organisms → Bacteria | 989 | Open in IMG/M |
| 3300021433|Ga0210391_10878202 | Not Available | 700 | Open in IMG/M |
| 3300021475|Ga0210392_10800293 | Not Available | 704 | Open in IMG/M |
| 3300021560|Ga0126371_13391905 | Not Available | 538 | Open in IMG/M |
| 3300021560|Ga0126371_13635524 | Not Available | 520 | Open in IMG/M |
| 3300025898|Ga0207692_11188850 | Not Available | 506 | Open in IMG/M |
| 3300025939|Ga0207665_11685079 | Not Available | 502 | Open in IMG/M |
| 3300027095|Ga0208606_107108 | Not Available | 525 | Open in IMG/M |
| 3300027869|Ga0209579_10391002 | All Organisms → cellular organisms → Bacteria | 753 | Open in IMG/M |
| 3300027879|Ga0209169_10396537 | All Organisms → cellular organisms → Bacteria | 726 | Open in IMG/M |
| 3300027903|Ga0209488_10002741 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 14387 | Open in IMG/M |
| 3300027908|Ga0209006_10545574 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 963 | Open in IMG/M |
| 3300028906|Ga0308309_11041174 | Not Available | 708 | Open in IMG/M |
| 3300031231|Ga0170824_120786190 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Reyranellaceae → Reyranella → Reyranella soli | 981 | Open in IMG/M |
| 3300031234|Ga0302325_10665260 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Defluviicoccus → Defluviicoccus vanus | 1511 | Open in IMG/M |
| 3300031474|Ga0170818_109703531 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 584 | Open in IMG/M |
| 3300031545|Ga0318541_10469610 | Not Available | 704 | Open in IMG/M |
| 3300031561|Ga0318528_10217131 | Not Available | 1024 | Open in IMG/M |
| 3300031572|Ga0318515_10746093 | Not Available | 517 | Open in IMG/M |
| 3300031573|Ga0310915_10157718 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1572 | Open in IMG/M |
| 3300031718|Ga0307474_11135963 | Not Available | 618 | Open in IMG/M |
| 3300031719|Ga0306917_10828443 | Not Available | 725 | Open in IMG/M |
| 3300031719|Ga0306917_10988351 | Not Available | 657 | Open in IMG/M |
| 3300031719|Ga0306917_11165698 | Not Available | 599 | Open in IMG/M |
| 3300031723|Ga0318493_10338389 | Not Available | 817 | Open in IMG/M |
| 3300031724|Ga0318500_10117351 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1226 | Open in IMG/M |
| 3300031744|Ga0306918_10226576 | All Organisms → cellular organisms → Bacteria | 1419 | Open in IMG/M |
| 3300031744|Ga0306918_10974030 | Not Available | 659 | Open in IMG/M |
| 3300031744|Ga0306918_11137255 | Not Available | 604 | Open in IMG/M |
| 3300031751|Ga0318494_10375517 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Oscillatoriophycideae → Chroococcales → Aphanothecaceae | 824 | Open in IMG/M |
| 3300031754|Ga0307475_10521078 | Not Available | 954 | Open in IMG/M |
| 3300031763|Ga0318537_10305863 | Not Available | 588 | Open in IMG/M |
| 3300031768|Ga0318509_10687541 | All Organisms → cellular organisms → Bacteria | 568 | Open in IMG/M |
| 3300031771|Ga0318546_11182447 | Not Available | 537 | Open in IMG/M |
| 3300031777|Ga0318543_10506739 | Not Available | 541 | Open in IMG/M |
| 3300031778|Ga0318498_10321810 | All Organisms → cellular organisms → Bacteria | 692 | Open in IMG/M |
| 3300031781|Ga0318547_10861483 | Not Available | 565 | Open in IMG/M |
| 3300031792|Ga0318529_10558183 | Not Available | 532 | Open in IMG/M |
| 3300031793|Ga0318548_10574494 | All Organisms → cellular organisms → Bacteria | 549 | Open in IMG/M |
| 3300031795|Ga0318557_10319473 | All Organisms → cellular organisms → Bacteria | 713 | Open in IMG/M |
| 3300031798|Ga0318523_10409511 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Roseiarcaceae → Roseiarcus → Roseiarcus fermentans | 674 | Open in IMG/M |
| 3300031798|Ga0318523_10671662 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 509 | Open in IMG/M |
| 3300031799|Ga0318565_10246918 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 868 | Open in IMG/M |
| 3300031805|Ga0318497_10118239 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1433 | Open in IMG/M |
| 3300031823|Ga0307478_11253776 | All Organisms → cellular organisms → Bacteria | 617 | Open in IMG/M |
| 3300031845|Ga0318511_10070818 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1440 | Open in IMG/M |
| 3300031859|Ga0318527_10452549 | All Organisms → cellular organisms → Bacteria | 547 | Open in IMG/M |
| 3300031879|Ga0306919_10794301 | All Organisms → cellular organisms → Bacteria | 728 | Open in IMG/M |
| 3300031879|Ga0306919_11036633 | Not Available | 627 | Open in IMG/M |
| 3300031880|Ga0318544_10283670 | All Organisms → cellular organisms → Bacteria | 642 | Open in IMG/M |
| 3300031880|Ga0318544_10295660 | All Organisms → cellular organisms → Bacteria | 628 | Open in IMG/M |
| 3300031880|Ga0318544_10434263 | Not Available | 511 | Open in IMG/M |
| 3300031890|Ga0306925_10046842 | All Organisms → cellular organisms → Bacteria | 4496 | Open in IMG/M |
| 3300031896|Ga0318551_10551909 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 663 | Open in IMG/M |
| 3300031897|Ga0318520_10068524 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1918 | Open in IMG/M |
| 3300031910|Ga0306923_10161067 | Not Available | 2562 | Open in IMG/M |
| 3300031910|Ga0306923_10823167 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae | 1023 | Open in IMG/M |
| 3300031910|Ga0306923_12190898 | Not Available | 555 | Open in IMG/M |
| 3300031912|Ga0306921_11325602 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 795 | Open in IMG/M |
| 3300031941|Ga0310912_10496491 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Roseiarcaceae → Roseiarcus → Roseiarcus fermentans | 951 | Open in IMG/M |
| 3300031945|Ga0310913_10226098 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1311 | Open in IMG/M |
| 3300031945|Ga0310913_10371791 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1013 | Open in IMG/M |
| 3300031945|Ga0310913_11108067 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 553 | Open in IMG/M |
| 3300031946|Ga0310910_10876218 | All Organisms → cellular organisms → Bacteria | 705 | Open in IMG/M |
| 3300031946|Ga0310910_11066104 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 630 | Open in IMG/M |
| 3300031947|Ga0310909_10052972 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 3124 | Open in IMG/M |
| 3300031947|Ga0310909_10083636 | All Organisms → cellular organisms → Bacteria | 2536 | Open in IMG/M |
| 3300031954|Ga0306926_11638252 | All Organisms → cellular organisms → Bacteria | 737 | Open in IMG/M |
| 3300031959|Ga0318530_10276331 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 693 | Open in IMG/M |
| 3300031962|Ga0307479_12120846 | Not Available | 510 | Open in IMG/M |
| 3300032001|Ga0306922_10041173 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 4748 | Open in IMG/M |
| 3300032001|Ga0306922_10323186 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1656 | Open in IMG/M |
| 3300032001|Ga0306922_12255498 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 523 | Open in IMG/M |
| 3300032001|Ga0306922_12310838 | Not Available | 515 | Open in IMG/M |
| 3300032008|Ga0318562_10791896 | Not Available | 543 | Open in IMG/M |
| 3300032025|Ga0318507_10137687 | All Organisms → cellular organisms → Bacteria | 1039 | Open in IMG/M |
| 3300032035|Ga0310911_10498570 | All Organisms → cellular organisms → Bacteria | 706 | Open in IMG/M |
| 3300032043|Ga0318556_10132768 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1278 | Open in IMG/M |
| 3300032051|Ga0318532_10290473 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 580 | Open in IMG/M |
| 3300032059|Ga0318533_10107202 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1941 | Open in IMG/M |
| 3300032059|Ga0318533_10317233 | Not Available | 1132 | Open in IMG/M |
| 3300032059|Ga0318533_10823631 | Not Available | 681 | Open in IMG/M |
| 3300032059|Ga0318533_11212913 | All Organisms → cellular organisms → Bacteria | 552 | Open in IMG/M |
| 3300032076|Ga0306924_10092111 | All Organisms → cellular organisms → Bacteria | 3415 | Open in IMG/M |
| 3300032076|Ga0306924_12599439 | Not Available | 505 | Open in IMG/M |
| 3300032089|Ga0318525_10627936 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 547 | Open in IMG/M |
| 3300032090|Ga0318518_10262108 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 887 | Open in IMG/M |
| 3300032091|Ga0318577_10328917 | All Organisms → cellular organisms → Bacteria | 731 | Open in IMG/M |
| 3300032261|Ga0306920_100197808 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2999 | Open in IMG/M |
| 3300032261|Ga0306920_100593389 | All Organisms → cellular organisms → Bacteria | 1639 | Open in IMG/M |
| 3300032261|Ga0306920_100732522 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1455 | Open in IMG/M |
| 3300033289|Ga0310914_10385916 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1267 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 37.57% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 21.69% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 13.23% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 5.29% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.17% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.12% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 2.12% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 1.59% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 1.59% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.59% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 1.06% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.06% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 1.06% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 1.06% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.53% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.53% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grass Soil | 0.53% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.53% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 0.53% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.53% |
| Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost | 0.53% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 0.53% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.53% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.53% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.53% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2189573004 | Grass soil microbial communities from Rothamsted Park, UK - FG2 (Nitrogen) | Environmental | Open in IMG/M |
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300004635 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
| 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
| 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
| 3300005540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 | Environmental | Open in IMG/M |
| 3300005560 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119 | Environmental | Open in IMG/M |
| 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Host-Associated | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Host-Associated | Open in IMG/M |
| 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Host-Associated | Open in IMG/M |
| 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Environmental | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
| 3300009683 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_b_LC metaG | Environmental | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010337 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09082015 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
| 3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
| 3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
| 3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
| 3300012924 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300014501 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
| 3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
| 3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
| 3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
| 3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
| 3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
| 3300017973 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MG | Environmental | Open in IMG/M |
| 3300017974 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MG | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021088 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M | Environmental | Open in IMG/M |
| 3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
| 3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
| 3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
| 3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
| 3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
| 3300021403 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O | Environmental | Open in IMG/M |
| 3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
| 3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
| 3300021475 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-O | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027095 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF020 (SPAdes) | Environmental | Open in IMG/M |
| 3300027869 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027879 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 (SPAdes) | Environmental | Open in IMG/M |
| 3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027908 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031234 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2 | Environmental | Open in IMG/M |
| 3300031474 | Fir Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031545 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26 | Environmental | Open in IMG/M |
| 3300031561 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26 | Environmental | Open in IMG/M |
| 3300031572 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19 | Environmental | Open in IMG/M |
| 3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
| 3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
| 3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
| 3300031723 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f23 | Environmental | Open in IMG/M |
| 3300031724 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f20 | Environmental | Open in IMG/M |
| 3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
| 3300031751 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f24 | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031763 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f29 | Environmental | Open in IMG/M |
| 3300031768 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f22 | Environmental | Open in IMG/M |
| 3300031771 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19 | Environmental | Open in IMG/M |
| 3300031777 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f24 | Environmental | Open in IMG/M |
| 3300031778 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f24 | Environmental | Open in IMG/M |
| 3300031781 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20 | Environmental | Open in IMG/M |
| 3300031792 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f23 | Environmental | Open in IMG/M |
| 3300031793 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f21 | Environmental | Open in IMG/M |
| 3300031795 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f19 | Environmental | Open in IMG/M |
| 3300031798 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f19 | Environmental | Open in IMG/M |
| 3300031799 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f21 | Environmental | Open in IMG/M |
| 3300031805 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f23 | Environmental | Open in IMG/M |
| 3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
| 3300031845 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f18 | Environmental | Open in IMG/M |
| 3300031859 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f25 | Environmental | Open in IMG/M |
| 3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
| 3300031880 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f25 | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031896 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f19 | Environmental | Open in IMG/M |
| 3300031897 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16 | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
| 3300031945 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082 | Environmental | Open in IMG/M |
| 3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
| 3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300031959 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f24 | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
| 3300032008 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f18 | Environmental | Open in IMG/M |
| 3300032025 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f20 | Environmental | Open in IMG/M |
| 3300032035 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF170 | Environmental | Open in IMG/M |
| 3300032043 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f24 | Environmental | Open in IMG/M |
| 3300032051 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f26 | Environmental | Open in IMG/M |
| 3300032059 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27 | Environmental | Open in IMG/M |
| 3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
| 3300032089 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f23 | Environmental | Open in IMG/M |
| 3300032090 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f22 | Environmental | Open in IMG/M |
| 3300032091 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f25 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| FG2_08554520 | 2189573004 | Grass Soil | MDAKGLIVPPGAGSTLSMAPGPSAALKLLAGDTGDRIMAF |
| JGIcombinedJ26739_1018018351 | 3300002245 | Forest Soil | MVKKGLIVPPGGGSILSMAPGRSAALKLLGRETGDSIMLFE |
| Ga0062389_1002824371 | 3300004092 | Bog Forest Soil | MDTKGFVVPPGGGSVLSMAPGRSAALKLLGGETGDSIMLF |
| Ga0062389_1014267511 | 3300004092 | Bog Forest Soil | MKGFVVPPGGGSMLSMAPGRSAALKLLGGETGDSIMLFEETA |
| Ga0062388_1017088911 | 3300004635 | Bog Forest Soil | MDAKGFVVPPGGGSVLSMAPDRSAALKLLGGETGDSIMMF |
| Ga0066388_1029984213 | 3300005332 | Tropical Forest Soil | MEAKGFVVAPGQGRVWEMAAGRSSALKLLGGETGERVMMFE* |
| Ga0070711_1013577801 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | MVKKGLIVPPGGGSILSMAPGRSAALKLLGRETGDSIMLFEE |
| Ga0070699_1020209471 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | MDAKGFVIPSGGGSVLSMAFGRSAALKLLGRDTGDSIMLFEETAPAGTET |
| Ga0070697_1016441651 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | MDKGFVVPPGQGKVWNMAPGKSAALKMLSGDTAGSVMMFEESRASQH |
| Ga0066697_104444691 | 3300005540 | Soil | MAIDAKGFVPPGQGPVWNMAPGRSGALKLLGGETAESVMMFEEG |
| Ga0066670_108276122 | 3300005560 | Soil | MDKGFVVPPGQGKVWNMAPGRSAALKMLNGDTADSVMM |
| Ga0068859_1022656861 | 3300005617 | Switchgrass Rhizosphere | MEAKGFVVPPGGGAVWDMEPGRSAALKLVGGQTAE |
| Ga0066903_1033244941 | 3300005764 | Tropical Forest Soil | MEAKGFVVPPGQGRVWKMAKGRSSALKLLGGETGESVMMFEE |
| Ga0066903_1036163832 | 3300005764 | Tropical Forest Soil | MDAKGFVVPPGGGSILSMAPGRSAALKLLGGDTGDSVMLFEETAPA |
| Ga0066903_1048398651 | 3300005764 | Tropical Forest Soil | MEAQGIVVPPGGGAVWNMAPGRSAALKLLNGETGESVMMFEETAPAGTETT |
| Ga0068858_1025773071 | 3300005842 | Switchgrass Rhizosphere | MTSAKGFVVPAEGGKHFTMNAPGRSAALKLLGRDTGDSIMMFEETQSLYHL |
| Ga0068862_1018462671 | 3300005844 | Switchgrass Rhizosphere | MEAKGFVVPPGGGAVWDMEPGRSAALKLVGGQTAESVMLFEETAPPGTMTG |
| Ga0070715_108855322 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | MEAKGFVVPPGGGAVWDMEPGRSAALKLLGGQTAESVMLFEETAPPGTA |
| Ga0079222_107528981 | 3300006755 | Agricultural Soil | MDKGFVVAPGQGKVWNMAPGRSAALKMLNGQTADSLMLFEEVVPANTETP |
| Ga0099793_104106182 | 3300007258 | Vadose Zone Soil | MKMDAKGFVVPPGGGSVLSMAPGRSAALKLLGGETGDSIMLFEE |
| Ga0099830_114440372 | 3300009088 | Vadose Zone Soil | MDAKGFVVPPGGGSVLSMAPGRSAALKLLCSETGESVVAFEETAPPGTET |
| Ga0111538_139070731 | 3300009156 | Populus Rhizosphere | MEAKGFVVPPGGGAVWDMEPGRSAALKLVGGQTAESVMLFEETAPPGTATD |
| Ga0105249_131326192 | 3300009553 | Switchgrass Rhizosphere | MEAKGFVVPPGGGAVWDMEPGRSAALKLVGGQTAESVMLF |
| Ga0116224_100777293 | 3300009683 | Peatlands Soil | MDSNGIVVPPGGGKVLSMAPGRSAALKLLSGETGESVMMFEET |
| Ga0126374_115966591 | 3300009792 | Tropical Forest Soil | MDAKGFIVPPGGGSILSMAPGRSAALKLLGGDTGDSVMLFEETAPAGTE |
| Ga0126374_118806961 | 3300009792 | Tropical Forest Soil | MDAKSFVVPPGGGSILSMAPGRSAALKLLGGDTGDSVMLFEETAPAGTE |
| Ga0126382_111839342 | 3300010047 | Tropical Forest Soil | MDARGFVVPPGGGSILSMAPGRSAALKLLGGDTGDSIMLFEETAPA |
| Ga0126373_103491423 | 3300010048 | Tropical Forest Soil | MKMDAKGFVVPPGGGSVLSMAPGRSAALKLLGGDTGDSIMLFEETA |
| Ga0126373_105777312 | 3300010048 | Tropical Forest Soil | VPPGGGSILSMAPGRSAALKLLGGDTGDSIMLFEE |
| Ga0126373_108771131 | 3300010048 | Tropical Forest Soil | MEAKGFVVPPGQGRVWEMAAGRSSALKLLGGETGESVMMFEET |
| Ga0126373_123525442 | 3300010048 | Tropical Forest Soil | MEAKGFVVPSGQGRVWQMAAGRSSALKLLGGETGESVMMFEETAPAG |
| Ga0126373_124897812 | 3300010048 | Tropical Forest Soil | MMGTKGFVVPPGGGEVLSMAPGRSAALKLLSAETG |
| Ga0126373_125759942 | 3300010048 | Tropical Forest Soil | MEAKGFVVPPGEGRIWNSSPGRSEVLKLVGGETGESVMMFEETAPADTR |
| Ga0126373_126067301 | 3300010048 | Tropical Forest Soil | MATKGFVVPPGGGKLLDMAPGRFSALKLLGGETADSIMLFEETAPVG |
| Ga0126373_130804762 | 3300010048 | Tropical Forest Soil | MEAKGFVVPPGQGRVWEMAAGRSSALKFLGGETGDSVMMFEETAP |
| Ga0134062_104038612 | 3300010337 | Grasslands Soil | MDKGFVVPPGQGKVWNMAPGRSAALKMLNGDTAGSVMMF |
| Ga0126370_102825201 | 3300010358 | Tropical Forest Soil | MEAKGFVVPPGQGRVWKMAAGRSSALKLLGGETGESVMMFEETAPAGTQ |
| Ga0126370_108687951 | 3300010358 | Tropical Forest Soil | MEAKGFVVPPGQGRVWEMAAGRSSALKLLGGETGESVMMFEETAPAGTQTT |
| Ga0126370_113484901 | 3300010358 | Tropical Forest Soil | MEAKGFVVPPGQGRVWEMAAGRSSALKLLGGETGESVMMFEETAPAGTQ |
| Ga0126370_122966561 | 3300010358 | Tropical Forest Soil | MDAKGFVVPPGGGSILSMAPGRSAALKLLGGDAGDSIMLFEET |
| Ga0126372_127485441 | 3300010360 | Tropical Forest Soil | MGAKGFVVPPGGGSVLSMAPGRSAALKLLSGETGESLV |
| Ga0126378_126320812 | 3300010361 | Tropical Forest Soil | MEAKGFVVPPGQGRVWQMAAGRSSALKLLGGETGE |
| Ga0126378_127070661 | 3300010361 | Tropical Forest Soil | MEAKGFVVPPGQGRVWEMAAGRSSALKLLGGETGKS |
| Ga0126379_102381883 | 3300010366 | Tropical Forest Soil | MDAKGFVVPPGGGSILSMAPRRSAALKLLGGDTGDSIMLFEETAP |
| Ga0126381_1006578801 | 3300010376 | Tropical Forest Soil | MEAKGFVVPPGQGRVWEMAAGRSSALKLLGAETGESVM |
| Ga0126381_1034108342 | 3300010376 | Tropical Forest Soil | MEAKGFVVPPGQGRVWEMAAGRSSALKLLGGETGESVMMFEETA |
| Ga0126381_1043491511 | 3300010376 | Tropical Forest Soil | MGAKGFVVPPGGGSILSMAPGRSAALKLLGGDTGDSVML |
| Ga0134126_111702752 | 3300010396 | Terrestrial Soil | MEAKGFVVPPGGGAVWDMEPGRTAALKLLGGQTAESV |
| Ga0137364_111740752 | 3300012198 | Vadose Zone Soil | VDKGFVVPPGQGKVWNMAPGRSAALKMLNGDTADSVMMFEEVAP |
| Ga0137360_108850142 | 3300012361 | Vadose Zone Soil | MSAKGFVVPPGGGSILSMAPGRSAALKLVGGDTADSIMLFEETAPSGTET |
| Ga0137361_112323691 | 3300012362 | Vadose Zone Soil | MSGKGFVVPPGGGSVLSMAPGRSAALKLVGGETAESVMLFEETAPSGTE |
| Ga0137395_111199492 | 3300012917 | Vadose Zone Soil | MSAKGFVVPPGGGSILSMAPGHSAALKLVGGDTADSIMLFEETAPSGTETT |
| Ga0137396_108811421 | 3300012918 | Vadose Zone Soil | MSAKGFVVPPGGGSILSMAPGRSAALKLVGGDTADSIMLFEETAPSG |
| Ga0137394_112715482 | 3300012922 | Vadose Zone Soil | MSGKGFVVPPGGRSVLSMAPGRSAALKLVGGETADSVMLFEETAPSGTETR* |
| Ga0137413_116498122 | 3300012924 | Vadose Zone Soil | MSGKGFVVSPGGGSVLSMAPGRSAALKLVGGETADSVMLFEET |
| Ga0126369_134456012 | 3300012971 | Tropical Forest Soil | MEAKGFVVPPGQGRVWEMAAGRSSALKLLGGETSESVMMFEETAP |
| Ga0182024_103256581 | 3300014501 | Permafrost | MSTTKGAETMEAKGFVVPPGGGSVLSMAPGRSAALKLLGGETAESIMLCEETAP |
| Ga0132257_1013546041 | 3300015373 | Arabidopsis Rhizosphere | MEAKGFVVPPGGGTVWDMEPGRSAALKLVGTQTAESVMLFEETAPPGTATP |
| Ga0182041_102548421 | 3300016294 | Soil | MDAKGFVVPPGGGSILSMAPGRSAVLKLLGGDTGDSIMLFE |
| Ga0182041_104863962 | 3300016294 | Soil | MEAKGFVVPPGQGRVWEMAAGRSSALKLLGGETGESVMMFEETAPAG |
| Ga0182041_110043392 | 3300016294 | Soil | MEAKGFVVPSGQGRVWEMAAGRSSALKLLGGETGESVMMFEETAPAGTQ |
| Ga0182033_107288422 | 3300016319 | Soil | MDAKGLVVPPGGGSVLSMAPGRSAALKLLGGDTGDSIMLFEETAPAGTE |
| Ga0182035_101860292 | 3300016341 | Soil | MEAKGFVVPPGRGRVWEMAAGRSSALKLLGGETGESVMMFEETAPAGTQ |
| Ga0182032_103031631 | 3300016357 | Soil | MDAKGFVVPPGGGSVLNMAPGRSAALKLLGGETGDSIMLFEETAPVG |
| Ga0182034_105285291 | 3300016371 | Soil | MDAKGFVVPPGGGSILSMAPGRSAALKLLGGDTGDSVMLFEETA |
| Ga0182034_106723111 | 3300016371 | Soil | MDAKGFVVPPGGGSILSMAPGRSAALKLLGGDTGDSIMLFEETAPA |
| Ga0182040_101716084 | 3300016387 | Soil | MDMKGFVVPRGGGSILSMTPGRSAALKLLGGETGDS |
| Ga0182040_102120661 | 3300016387 | Soil | MEARGFVVPPGKGRVWEMAAGRSSALKLLGTETGESVMM |
| Ga0182040_107842173 | 3300016387 | Soil | MEAKGFVGPSGQGRVWEMAAGRSSALKLLGGETGES |
| Ga0182040_116165412 | 3300016387 | Soil | MEVKGFVVPPGQGRVWEMAAGRSSALKLLGGETDESLMMFEETAPAGTQ |
| Ga0182037_109849062 | 3300016404 | Soil | MEAKGFVVPSGQGRVWEMAAGRSSALKLLGGETGE |
| Ga0182037_111876651 | 3300016404 | Soil | MGAKGFVVPPGGGSILSMGPGRSAALKLLGGDTGDSIML |
| Ga0182037_112243141 | 3300016404 | Soil | MEAKGFVVPPGQGRVWEMAAGRSSALKLLGGETGESVMMFEETAP |
| Ga0182039_103020593 | 3300016422 | Soil | MEAKGFVVPSGQGRVWEMAAGRSSALKLLGGETGESVMMFEE |
| Ga0182039_109673682 | 3300016422 | Soil | LSCPPGGGSILSMAPGRSAALKLLGGDTGDSIMLFEETAPAGT |
| Ga0182038_109984261 | 3300016445 | Soil | MDAKSFVVPPGGGSILSMAPGRSAALKLLGGDTGDSVMLF |
| Ga0187780_110246441 | 3300017973 | Tropical Peatland | VEAKGFVVEPGGGAVLQMGAPGRSSVLKLLRADTAGSIMLFEETAP |
| Ga0187777_103307641 | 3300017974 | Tropical Peatland | MSLTKGFVIPPHGGELLAMAPGRSSLLKLLSGETGGSVMLFVETAPPGTATT |
| Ga0210407_100134789 | 3300020579 | Soil | MDAKGLVILPGGGSVLSMAPGRSAALKLLGRDTGDSI |
| Ga0210407_102225083 | 3300020579 | Soil | MEAKGFVVPPGQGRMWEMAAGRSSALKLLGGETGESVMMFEETAPAG |
| Ga0210407_109282112 | 3300020579 | Soil | MNAKGFVVPPDGGSVLSMAPGRSAALKLLGGETGDSIMLFEETAPAGT |
| Ga0210403_107093772 | 3300020580 | Soil | MDAKGFVIPSGGGSVLSMAPGRSAALKLLGRDTGDSIMLFE |
| Ga0210403_109272722 | 3300020580 | Soil | MDAKGFVVPPGDGSALSMAPGRSAALKLLGRDTGDSIMVFEETAPAGTE |
| Ga0210403_109470651 | 3300020580 | Soil | MDAKGFVVPAGGGSVLSMAPGRSALLKLLGGETGDSIMLFEETAPAGTD |
| Ga0210401_102347244 | 3300020583 | Soil | MDAKGFVIPSGGGSVLSMAPGRSAALKLLGRDTGDSIMLFEETAPAGTET |
| Ga0210404_104131511 | 3300021088 | Soil | MVKKGLIVPPGGGSILSMAPGRSAALKLLAGDTGDR |
| Ga0210406_100416827 | 3300021168 | Soil | MDAKGLVILPGGGSVLSMAPGRSAALKLLGRDTGDSIMLFEETAPA |
| Ga0210406_105789421 | 3300021168 | Soil | MSRKGFIVPPGGGSVLSMAPGRSAALKLVGGETADSIMLFE |
| Ga0210406_109367031 | 3300021168 | Soil | METRGFVVPASQGRVWEMAAGRSSALKLLGAETGESVMMVEE |
| Ga0210406_111572032 | 3300021168 | Soil | LEETAMSGKGFVVPPGGGSILSMAPGRSAALKLVGGETAD |
| Ga0210400_111653302 | 3300021170 | Soil | METRGFVVPASQGRVWEMAAGRSSALKLLGAETGESVMMFE |
| Ga0210405_103798282 | 3300021171 | Soil | VDAKGFVVSAGGGSVLSMAPGRSAALKLLGGDTGESIMLF |
| Ga0210396_111952462 | 3300021180 | Soil | MSGKGFVVPPGGGSVLDMAPGRSAALKLVSGETAGSIMLF |
| Ga0210393_116499741 | 3300021401 | Soil | MDAKGFVIPSGGGSVLSMAPDRWAVLKLLGGETGDSI |
| Ga0210397_108657031 | 3300021403 | Soil | MTTKGFVVPPGGGRLLDMAPGRFSTLKLLGGETAESIML |
| Ga0210387_105876671 | 3300021405 | Soil | MDAKGFVIPSGGGSVLSMAPGRSAALKLLGRDTGDSIMLFEETGRVRRE |
| Ga0210383_117344861 | 3300021407 | Soil | MNGKGFVVPPGGGPVLAMAPGRSAALKLVSGETAGSIMLFEETVPSGVG |
| Ga0210384_105998781 | 3300021432 | Soil | MGAKGFIVPPGGGSILSMAPGRSAALKLVGGETAESVMLFEETAPSGT |
| Ga0210391_108782023 | 3300021433 | Soil | MLKKGLIVPPGGSILSMAPGRSAALKLLGGETGDSIMLFEETAPAGT |
| Ga0210392_108002931 | 3300021475 | Soil | MEAKGFVVPPGGGAVWDMEPGRSAALKLVGGQTAESVMLFEETAPPG |
| Ga0126371_133919051 | 3300021560 | Tropical Forest Soil | MDAKGFVVPPRGGSILSMAPGRSAALKLLGGDTGDSIMLFD |
| Ga0126371_136355241 | 3300021560 | Tropical Forest Soil | METRGFVVPPGQGRVSEMAAGRSSALKLLGRETGESVMMFEETAPSGTETT |
| Ga0207692_111888501 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | MDAKGFVIPSNGGSVLSMAPGRSAALKLLGRDTGDSIMLFEETAPAGTETTF |
| Ga0207665_116850791 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | MVKKGLIVPPGGGSILSMAPGRSAALKLMGRDTGDSIMLFEETAPAGTDTTFH |
| Ga0208606_1071081 | 3300027095 | Forest Soil | MDAKGLVILPGGGSVLSMAPGRSAALKLLGRDTGDSIMLFEETAPAGT |
| Ga0209579_103910022 | 3300027869 | Surface Soil | MEAKGFVVPPGGGKLLDMAPGRFSALKLLGGETAD |
| Ga0209169_103965372 | 3300027879 | Soil | MEVKGFVVPPGGGKVLDMAPGRFSALKLLGGETADSIMLFEETAPAG |
| Ga0209488_100027411 | 3300027903 | Vadose Zone Soil | MDAKGFVIPSDGGSVLSMAPGRSAALKLLGRDTGDSIMLFEETAPAGTETT |
| Ga0209006_105455741 | 3300027908 | Forest Soil | MEAKGFVVPPGGGAVWDMEPGRSAALKLVGGQTAES |
| Ga0308309_110411741 | 3300028906 | Soil | MEAKGFVVPPGGGALWDMEPGRSAALKLLGGQTAES |
| Ga0170824_1207861902 | 3300031231 | Forest Soil | MEAKGFVVPPGGGAVWDMEPGRSAALKLLGGQTAESVMLFE |
| Ga0302325_106652604 | 3300031234 | Palsa | MEAKGFVVPAGGGPVLDMAPGRFSALKLLGEATADSVMM |
| Ga0170818_1097035311 | 3300031474 | Forest Soil | MEAKGFVVAPGQGRVWEMAAGRSSALKLLGGETGESVMMFEETAP |
| Ga0318541_104696101 | 3300031545 | Soil | MDAKGLVVPPGGGSVLSMAPGRSAALKLLGGDTGDSIMLFEETAPAGTET |
| Ga0318528_102171311 | 3300031561 | Soil | MQAKGFVVPPGQGRVWEMAAGRSSALKLLGGETGES |
| Ga0318515_107460931 | 3300031572 | Soil | MDAKGFVVPPGGGSILSMAPGRSAALKLLGGDTGDSVMLFEE |
| Ga0310915_101577183 | 3300031573 | Soil | METKGFVVPPGQGRVWEMAAGRSSALKLLGGETGES |
| Ga0307474_111359631 | 3300031718 | Hardwood Forest Soil | MSNEHSEVMTMDAKGFVVPPGGGSILSMAPGRSAALKLLGGQTG |
| Ga0306917_108284431 | 3300031719 | Soil | MDAKGFVVPPGGGSILSMAPGRSAALKLLGGDTGDSIMLFE |
| Ga0306917_109883512 | 3300031719 | Soil | METKGFVVPPGQGRVWEMAAGRSSALKLLGGETGESVMMFEETA |
| Ga0306917_111656982 | 3300031719 | Soil | MEAKGFVVPAGQGRVWEMAAGRSSALKLLGGETGESVMM |
| Ga0318493_103383891 | 3300031723 | Soil | MEAKGFVVPPGQGRVWQMAAGRSSALKLLGGETGESVMM |
| Ga0318500_101173511 | 3300031724 | Soil | MDTKDCVVPPGGGSTLSMAPRRAAGLKLLGGETGDSIIPFE |
| Ga0306918_102265763 | 3300031744 | Soil | MEVKGFVVPPGQGRVWEMAAGRSSALKLLGGETDE |
| Ga0306918_109740301 | 3300031744 | Soil | MDAKGLVVPPGGGSVLSMAPGRSAALKLLGGDTGDSIMLFEETA |
| Ga0306918_111372551 | 3300031744 | Soil | MEAKGFVVSPGEGRVWEMAPGRSSALKLLGGETGES |
| Ga0318494_103755171 | 3300031751 | Soil | MEAKGFVVPPGRGRVWEMAAGRSSALKLLGGETGESVM |
| Ga0307475_105210781 | 3300031754 | Hardwood Forest Soil | METRGFAVPASQGRVWEMAAGRSSALKLLGAETGESVMMFEETAPSGT |
| Ga0318537_103058632 | 3300031763 | Soil | MDAKGFVVPPGGGSILSMAPGRSAALKLLGGDTGDSIMLFEETAPAGTE |
| Ga0318509_106875411 | 3300031768 | Soil | MEAKGLVVAPGQGRVWEMAAGRSSALKLLGRETGESVM |
| Ga0318546_111824471 | 3300031771 | Soil | MDAKGLVVPPGGGSVLSMAPGLSAALKLLGGDTGDSIM |
| Ga0318543_105067391 | 3300031777 | Soil | MEAKGFVVPPGGGSILSMAPGRLAALKLLGGDTGDS |
| Ga0318498_103218101 | 3300031778 | Soil | MEAKGFVVPPGQGRVWEMASGRSSALKLLGGETGESVMMFEETAPVGTQ |
| Ga0318547_108614831 | 3300031781 | Soil | MEAKGFVVPPGQGRVWEMAAGRSSALKLLGGETGESVM |
| Ga0318529_105581831 | 3300031792 | Soil | MDAKGFVVPPGGGSILSMAPGRSAALKLLGGDTGDSIMLFEETAPAGTETT |
| Ga0318548_105744941 | 3300031793 | Soil | MEAKGFVVPPGQGRVWKMAAGRSSALKLLGGETGESV |
| Ga0318557_103194732 | 3300031795 | Soil | MEAKGFVVPPGQGRVWEMASGRSSALKLLGGETGESVMMFE |
| Ga0318523_104095111 | 3300031798 | Soil | MEAKGFVVPSGQGRVWEMAAGRSSALKLLGGETGESV |
| Ga0318523_106716621 | 3300031798 | Soil | MEARGFVVPPGQGRVWEMAAGRSSALKLLGGETGESVMMFEETAPSGTQ |
| Ga0318565_102469181 | 3300031799 | Soil | MEAKGFVVPPGGGSILSMAPGRLAALKLLGGDTGDSIMLFEETAPAGTE |
| Ga0318497_101182391 | 3300031805 | Soil | MDTKGFVVPPGGGSVLNMAPGRSAALKLLGGETGDSIMLFE |
| Ga0307478_112537762 | 3300031823 | Hardwood Forest Soil | MEAKGFVVPPGQGRVWEMAAGRSSALKLLGGETGESVMMFEETAPAGT |
| Ga0318511_100708183 | 3300031845 | Soil | MDTKDCVVPPGGGSTLSMAPGRSAALKLLGGETGDS |
| Ga0318527_104525492 | 3300031859 | Soil | MEAHGFVVPPGQGRVWEMAAGRSSALKLLGAETGESVMMFEETAPSGTE |
| Ga0306919_107943011 | 3300031879 | Soil | MEAKGFVVPPGQGRVWEMAAGRSSALKLLGGETDES |
| Ga0306919_110366331 | 3300031879 | Soil | MDVKGFVVPPGGGSILSMAPGRSAALKLLGGNTGDSIMLFE |
| Ga0318544_102836701 | 3300031880 | Soil | MEAKGFVVPPGQGRVWKMAAGRSSALKLLGGETGESVMMFE |
| Ga0318544_102956602 | 3300031880 | Soil | MEAKGFVVPPGQGRVWEMAAGRSSALKLLGGETGESV |
| Ga0318544_104342631 | 3300031880 | Soil | MDAKGFVVPPGGGSILSMAPGRSAVLKLLGGETGD |
| Ga0306925_100468425 | 3300031890 | Soil | MDAKGFVVPPGGGSILSMAPGRSAALKLLGGDTGDSVMLFEET |
| Ga0318551_105519092 | 3300031896 | Soil | MDAKGFVVPQGGGSILSMAPGRSAALKLLGGDTGDSVMLFEETAPTGTETTF |
| Ga0318520_100685241 | 3300031897 | Soil | MDTKDCVVPPGGGSTLSMAPGRSAALKLLGGETGDSIMPFEETAPVGTDT |
| Ga0306923_101610671 | 3300031910 | Soil | MDAKGFVVPPGGGSILSMAPGRSAALKLLGGDTGDSVMLFEETAPAGTET |
| Ga0306923_108231671 | 3300031910 | Soil | MEAKGFVVPPGQGRVWKMAAGRSSALKLLGGETGESVMMFEETAPAGT |
| Ga0306923_121908981 | 3300031910 | Soil | MEAKGFVVPPGEGRIWNSSPGRSEVLKLLGAETGESLMMFEETAPADTR |
| Ga0306921_113256022 | 3300031912 | Soil | MDAKGFVVPPGGGAILSTGPGRSEALKLLSGDTGNSIMLFEETAPAGTDTT |
| Ga0310912_104964911 | 3300031941 | Soil | MEAKGFVVPPGQGRVWEMAAGRSSALKLLGGETGESVMMFEETAPSGTQ |
| Ga0310913_102260981 | 3300031945 | Soil | MNMGRTKMDAKGFVVPPGGGSILSMAPGRSAALKLLGGDTGDSVML |
| Ga0310913_103717911 | 3300031945 | Soil | MDAKGLVVPPGGGSVLSMAPGRSAALKLLGGDTGDSIMLFEETAPA |
| Ga0310913_111080671 | 3300031945 | Soil | MEARGFVVPPGQGRVWEMAAGRSSALKLLGGETGESVMMFEE |
| Ga0310910_108762181 | 3300031946 | Soil | MEAKGFVVPPGQGRVWEMAAGRSSALKLLGGETDESV |
| Ga0310910_110661042 | 3300031946 | Soil | MNGKGFVVPPGGGPVLSMAPGRSAALKLVSGETAGSIMLFE |
| Ga0310909_100529725 | 3300031947 | Soil | MDAKGFVVPPGGGSILNMAPGLSAALKLLGGDTGHSARL |
| Ga0310909_100836361 | 3300031947 | Soil | MEAKGFVVPPGQGRVWKMAAGRSSALKLLGGETGESVMMFEETAP |
| Ga0306926_116382522 | 3300031954 | Soil | MNGKGFVVPPGGGPVLSMAPGRSAALKLVSGETAGSIMLFEETVPSG |
| Ga0318530_102763311 | 3300031959 | Soil | MDAKSFVVPPGGGSILSMAPGRSAALKLLGGDTGDSVMLFEE |
| Ga0307479_121208461 | 3300031962 | Hardwood Forest Soil | MEARGFVVPPGQGRVWEMAAGRSSALKLLGGETGESVM |
| Ga0306922_100411736 | 3300032001 | Soil | MDAKSFVVPPGGGSILSMAPGRSAALKLLGGDTGDSVML |
| Ga0306922_103231862 | 3300032001 | Soil | MDAKGFVVPPGGGSILSMAPGRSAALKLLGDDTGD |
| Ga0306922_122554981 | 3300032001 | Soil | MEAKGFVVPPGQGRVWEMAAGRSSALKLLGGETGESVMMFE |
| Ga0306922_123108381 | 3300032001 | Soil | MDAKGFVVPQGGGSILSMAPGRSAALKLLGGDTGD |
| Ga0318562_107918962 | 3300032008 | Soil | MDAKGFVVPPGGGAILSTGPGRSEALKLLSGDTGNSIMLFEETAPAGTD |
| Ga0318507_101376871 | 3300032025 | Soil | MEAKGFVVPSGQGRVWEMAAGRSSALKLLGGETGESVMMFEETAPAGTQTT |
| Ga0310911_104985701 | 3300032035 | Soil | MEAKGFVLPPGQGRVWQMAAGRSSALKLLGGETGESVMMFEETAPSGTE |
| Ga0318556_101327683 | 3300032043 | Soil | MEAKGFVVPPGQGRVWKMAAGRSSALKLLGGETGESVMMFEE |
| Ga0318532_102904732 | 3300032051 | Soil | MDAKGFVVPPGGGSILSMAPGRSAALKLLGDDTGDSI |
| Ga0318533_101072025 | 3300032059 | Soil | MEAKGFVVPAGQGRVWEMAAGRSSALKLLGGETGESVMMFE |
| Ga0318533_103172331 | 3300032059 | Soil | MEAKGFVVPPGQGRVWEMASGRSSALKLLGGETGESVMMFEE |
| Ga0318533_108236311 | 3300032059 | Soil | MDAKGLVVPPGGGSILSMAPGRSAALKLLGGDTGDSVMLFEETA |
| Ga0318533_112129132 | 3300032059 | Soil | MEVKGFVVPPGQGRVWEMAAGRSSALKLLGGETDESRMM |
| Ga0306924_100921111 | 3300032076 | Soil | MDAKGLVVPPGGGSILSMAPGRSAALKLLGGDTGDSVMLFEETAPAG |
| Ga0306924_125994391 | 3300032076 | Soil | MDAKGFVVHPGQGRVWDMAPGRSAAIKMQSRETGESVMMFEETAPAGT |
| Ga0318525_106279362 | 3300032089 | Soil | MDAKGFVVPPGGGSILSMAPGRSAALKLLGDDAGDSIMLFEETA |
| Ga0318518_102621083 | 3300032090 | Soil | MEAKGFVVAPGQGRVWKMAAGRSSALKLLGGETSDS |
| Ga0318577_103289172 | 3300032091 | Soil | MEAKGFVVPPGQGRVWEMAAGRSSALKLLGGETGESVMMFEETAPS |
| Ga0306920_1001978081 | 3300032261 | Soil | MDAKGFVVPPGGGSILNMAPGLSAVLKLLGGDTGHSARL |
| Ga0306920_1005933893 | 3300032261 | Soil | MEAKGFVVPPGQGRVWKMAAGRSSALKLLGGETGESVMM |
| Ga0306920_1007325221 | 3300032261 | Soil | MNMGRTKMDAKGFVVPPGGGSILSMAPGRSAALKLLGGDTGD |
| Ga0310914_103859163 | 3300033289 | Soil | MNMGRTKMDAKGFVVPPGGGSILSMAPGRSAALKLLGGDTGDSVMLFEE |
| ⦗Top⦘ |