| Basic Information | |
|---|---|
| Family ID | F029167 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 189 |
| Average Sequence Length | 43 residues |
| Representative Sequence | RFDPLASAGLVERDGTVVRLAPEKLSVSNEVFVELMR |
| Number of Associated Samples | 149 |
| Number of Associated Scaffolds | 189 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 1.59 % |
| % of genes near scaffold ends (potentially truncated) | 98.94 % |
| % of genes from short scaffolds (< 2000 bps) | 86.77 % |
| Associated GOLD sequencing projects | 135 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.48 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (72.487 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (35.979 % of family members) |
| Environment Ontology (ENVO) | Unclassified (35.450 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (42.328 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 20.00% β-sheet: 12.31% Coil/Unstructured: 67.69% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.48 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 189 Family Scaffolds |
|---|---|---|
| PF01212 | Beta_elim_lyase | 91.01 |
| PF01401 | Peptidase_M2 | 3.17 |
| PF02771 | Acyl-CoA_dh_N | 2.12 |
| PF00294 | PfkB | 0.53 |
| PF13180 | PDZ_2 | 0.53 |
| PF04055 | Radical_SAM | 0.53 |
| PF01048 | PNP_UDP_1 | 0.53 |
| PF09286 | Pro-kuma_activ | 0.53 |
| COG ID | Name | Functional Category | % Frequency in 189 Family Scaffolds |
|---|---|---|---|
| COG1167 | DNA-binding transcriptional regulator, MocR family, contains an aminotransferase domain | Transcription [K] | 182.01 |
| COG1104 | Cysteine desulfurase/Cysteine sulfinate desulfinase IscS or related enzyme, NifS family | Amino acid transport and metabolism [E] | 91.01 |
| COG4992 | Acetylornithine/succinyldiaminopimelate/putrescine aminotransferase | Amino acid transport and metabolism [E] | 91.01 |
| COG3033 | Tryptophanase | Amino acid transport and metabolism [E] | 91.01 |
| COG2873 | O-acetylhomoserine/O-acetylserine sulfhydrylase, pyridoxal phosphate-dependent | Amino acid transport and metabolism [E] | 91.01 |
| COG2008 | Threonine aldolase | Amino acid transport and metabolism [E] | 91.01 |
| COG1982 | Arginine/lysine/ornithine decarboxylase | Amino acid transport and metabolism [E] | 91.01 |
| COG1921 | Seryl-tRNA(Sec) selenium transferase | Translation, ribosomal structure and biogenesis [J] | 91.01 |
| COG0075 | Archaeal aspartate aminotransferase or a related aminotransferase, includes purine catabolism protein PucG | Amino acid transport and metabolism [E] | 91.01 |
| COG1003 | Glycine cleavage system protein P (pyridoxal-binding), C-terminal domain | Amino acid transport and metabolism [E] | 91.01 |
| COG0626 | Cystathionine beta-lyase/cystathionine gamma-synthase | Amino acid transport and metabolism [E] | 91.01 |
| COG0520 | Selenocysteine lyase/Cysteine desulfurase | Amino acid transport and metabolism [E] | 91.01 |
| COG0436 | Aspartate/methionine/tyrosine aminotransferase | Amino acid transport and metabolism [E] | 91.01 |
| COG0399 | dTDP-4-amino-4,6-dideoxygalactose transaminase | Cell wall/membrane/envelope biogenesis [M] | 91.01 |
| COG0156 | 7-keto-8-aminopelargonate synthetase or related enzyme | Coenzyme transport and metabolism [H] | 91.01 |
| COG0112 | Glycine/serine hydroxymethyltransferase | Amino acid transport and metabolism [E] | 91.01 |
| COG0076 | Glutamate or tyrosine decarboxylase or a related PLP-dependent protein | Amino acid transport and metabolism [E] | 91.01 |
| COG1960 | Acyl-CoA dehydrogenase related to the alkylation response protein AidB | Lipid transport and metabolism [I] | 2.12 |
| COG0813 | Purine-nucleoside phosphorylase | Nucleotide transport and metabolism [F] | 0.53 |
| COG0775 | Nucleoside phosphorylase/nucleosidase, includes 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase MtnN and futalosine hydrolase MqnB | Nucleotide transport and metabolism [F] | 0.53 |
| COG2820 | Uridine phosphorylase | Nucleotide transport and metabolism [F] | 0.53 |
| COG4934 | Serine protease, subtilase family | Posttranslational modification, protein turnover, chaperones [O] | 0.53 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 73.54 % |
| Unclassified | root | N/A | 26.46 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000655|AF_2010_repII_A100DRAFT_1075248 | Not Available | 594 | Open in IMG/M |
| 3300001137|JGI12637J13337_1014326 | All Organisms → cellular organisms → Bacteria | 684 | Open in IMG/M |
| 3300001527|A3513AW1_1015792 | All Organisms → cellular organisms → Bacteria | 505 | Open in IMG/M |
| 3300001867|JGI12627J18819_10402099 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium 12-62-4 | 557 | Open in IMG/M |
| 3300003505|JGIcombinedJ51221_10300367 | All Organisms → cellular organisms → Bacteria | 653 | Open in IMG/M |
| 3300004080|Ga0062385_10228084 | All Organisms → cellular organisms → Bacteria | 1024 | Open in IMG/M |
| 3300004091|Ga0062387_101203590 | Not Available | 593 | Open in IMG/M |
| 3300005167|Ga0066672_10949303 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium 12-62-4 | 529 | Open in IMG/M |
| 3300005171|Ga0066677_10152145 | All Organisms → cellular organisms → Bacteria | 1268 | Open in IMG/M |
| 3300005334|Ga0068869_100671537 | All Organisms → cellular organisms → Bacteria | 881 | Open in IMG/M |
| 3300005445|Ga0070708_100114534 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2481 | Open in IMG/M |
| 3300005445|Ga0070708_100412978 | Not Available | 1273 | Open in IMG/M |
| 3300005518|Ga0070699_100480639 | All Organisms → cellular organisms → Bacteria | 1127 | Open in IMG/M |
| 3300005555|Ga0066692_10988028 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 515 | Open in IMG/M |
| 3300005566|Ga0066693_10352064 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium 12-62-4 | 593 | Open in IMG/M |
| 3300005576|Ga0066708_10307852 | All Organisms → cellular organisms → Bacteria | 1015 | Open in IMG/M |
| 3300005591|Ga0070761_10522109 | All Organisms → cellular organisms → Bacteria | 734 | Open in IMG/M |
| 3300005610|Ga0070763_10079515 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1619 | Open in IMG/M |
| 3300005610|Ga0070763_10558853 | All Organisms → cellular organisms → Bacteria | 660 | Open in IMG/M |
| 3300005921|Ga0070766_11209411 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium 12-62-4 | 523 | Open in IMG/M |
| 3300005993|Ga0080027_10155228 | All Organisms → cellular organisms → Bacteria | 880 | Open in IMG/M |
| 3300006031|Ga0066651_10227521 | All Organisms → cellular organisms → Bacteria | 989 | Open in IMG/M |
| 3300006052|Ga0075029_100417155 | All Organisms → cellular organisms → Bacteria | 875 | Open in IMG/M |
| 3300006102|Ga0075015_100187503 | Not Available | 1095 | Open in IMG/M |
| 3300006176|Ga0070765_100336051 | Not Available | 1402 | Open in IMG/M |
| 3300006755|Ga0079222_12148716 | Not Available | 553 | Open in IMG/M |
| 3300006854|Ga0075425_100366384 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1659 | Open in IMG/M |
| 3300006904|Ga0075424_101393405 | All Organisms → cellular organisms → Bacteria | 745 | Open in IMG/M |
| 3300007265|Ga0099794_10341380 | All Organisms → cellular organisms → Bacteria | 778 | Open in IMG/M |
| 3300007265|Ga0099794_10487952 | Not Available | 648 | Open in IMG/M |
| 3300007265|Ga0099794_10725174 | Not Available | 530 | Open in IMG/M |
| 3300009038|Ga0099829_10080227 | Not Available | 2496 | Open in IMG/M |
| 3300009088|Ga0099830_11447366 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium | 572 | Open in IMG/M |
| 3300009090|Ga0099827_10350799 | Not Available | 1255 | Open in IMG/M |
| 3300009090|Ga0099827_11600750 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium 12-62-4 | 567 | Open in IMG/M |
| 3300009137|Ga0066709_101131084 | All Organisms → cellular organisms → Bacteria | 1152 | Open in IMG/M |
| 3300010321|Ga0134067_10049856 | Not Available | 1346 | Open in IMG/M |
| 3300010358|Ga0126370_10265815 | Not Available | 1340 | Open in IMG/M |
| 3300010359|Ga0126376_11459711 | All Organisms → cellular organisms → Bacteria | 711 | Open in IMG/M |
| 3300010360|Ga0126372_10671434 | All Organisms → cellular organisms → Bacteria | 1007 | Open in IMG/M |
| 3300010376|Ga0126381_100011555 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 9988 | Open in IMG/M |
| 3300010398|Ga0126383_12363583 | Not Available | 617 | Open in IMG/M |
| 3300011269|Ga0137392_10827934 | All Organisms → cellular organisms → Bacteria | 764 | Open in IMG/M |
| 3300011270|Ga0137391_10094716 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2583 | Open in IMG/M |
| 3300011271|Ga0137393_10612555 | All Organisms → cellular organisms → Bacteria | 934 | Open in IMG/M |
| 3300011271|Ga0137393_10990500 | All Organisms → cellular organisms → Bacteria | 716 | Open in IMG/M |
| 3300011271|Ga0137393_11175775 | Not Available | 651 | Open in IMG/M |
| 3300011271|Ga0137393_11676651 | All Organisms → cellular organisms → Bacteria | 525 | Open in IMG/M |
| 3300012096|Ga0137389_10433714 | All Organisms → cellular organisms → Bacteria | 1124 | Open in IMG/M |
| 3300012096|Ga0137389_11516378 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium | 566 | Open in IMG/M |
| 3300012189|Ga0137388_11963665 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 514 | Open in IMG/M |
| 3300012199|Ga0137383_10695941 | All Organisms → cellular organisms → Bacteria | 743 | Open in IMG/M |
| 3300012199|Ga0137383_10728036 | Not Available | 724 | Open in IMG/M |
| 3300012202|Ga0137363_10091202 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2294 | Open in IMG/M |
| 3300012202|Ga0137363_10874888 | All Organisms → cellular organisms → Bacteria | 763 | Open in IMG/M |
| 3300012202|Ga0137363_11647561 | Not Available | 534 | Open in IMG/M |
| 3300012205|Ga0137362_10737915 | All Organisms → cellular organisms → Bacteria | 845 | Open in IMG/M |
| 3300012207|Ga0137381_10789307 | All Organisms → cellular organisms → Bacteria | 824 | Open in IMG/M |
| 3300012209|Ga0137379_10697877 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium 12-62-4 | 920 | Open in IMG/M |
| 3300012210|Ga0137378_10634575 | All Organisms → cellular organisms → Bacteria | 978 | Open in IMG/M |
| 3300012210|Ga0137378_11461722 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium 12-62-4 | 595 | Open in IMG/M |
| 3300012210|Ga0137378_11507680 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium 12-62-4 | 583 | Open in IMG/M |
| 3300012211|Ga0137377_11551150 | Not Available | 587 | Open in IMG/M |
| 3300012212|Ga0150985_104385007 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium 12-62-4 | 615 | Open in IMG/M |
| 3300012351|Ga0137386_10684786 | All Organisms → cellular organisms → Bacteria | 737 | Open in IMG/M |
| 3300012356|Ga0137371_10388023 | Not Available | 1083 | Open in IMG/M |
| 3300012357|Ga0137384_10740779 | All Organisms → cellular organisms → Bacteria | 797 | Open in IMG/M |
| 3300012357|Ga0137384_10841416 | All Organisms → cellular organisms → Bacteria | 741 | Open in IMG/M |
| 3300012357|Ga0137384_10921956 | All Organisms → cellular organisms → Bacteria | 704 | Open in IMG/M |
| 3300012359|Ga0137385_10378316 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha | 1210 | Open in IMG/M |
| 3300012359|Ga0137385_11092213 | Not Available | 657 | Open in IMG/M |
| 3300012361|Ga0137360_11890989 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 503 | Open in IMG/M |
| 3300012362|Ga0137361_10027353 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 4459 | Open in IMG/M |
| 3300012582|Ga0137358_10967404 | All Organisms → cellular organisms → Bacteria | 553 | Open in IMG/M |
| 3300012683|Ga0137398_10440016 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 891 | Open in IMG/M |
| 3300012683|Ga0137398_10849855 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium 12-62-4 | 637 | Open in IMG/M |
| 3300012683|Ga0137398_11101724 | All Organisms → cellular organisms → Bacteria | 547 | Open in IMG/M |
| 3300012685|Ga0137397_10621079 | All Organisms → cellular organisms → Bacteria | 804 | Open in IMG/M |
| 3300012685|Ga0137397_10717310 | Not Available | 743 | Open in IMG/M |
| 3300012917|Ga0137395_10038992 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2924 | Open in IMG/M |
| 3300012918|Ga0137396_10776169 | Not Available | 705 | Open in IMG/M |
| 3300012918|Ga0137396_11077287 | All Organisms → cellular organisms → Bacteria | 576 | Open in IMG/M |
| 3300012923|Ga0137359_10057164 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 3396 | Open in IMG/M |
| 3300012924|Ga0137413_10915663 | Not Available | 682 | Open in IMG/M |
| 3300012925|Ga0137419_11012931 | All Organisms → cellular organisms → Bacteria | 689 | Open in IMG/M |
| 3300012927|Ga0137416_12085291 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 521 | Open in IMG/M |
| 3300012929|Ga0137404_12204940 | All Organisms → cellular organisms → Bacteria | 515 | Open in IMG/M |
| 3300012931|Ga0153915_11348176 | Not Available | 834 | Open in IMG/M |
| 3300012944|Ga0137410_11500157 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium 12-62-4 | 588 | Open in IMG/M |
| 3300012957|Ga0164303_10745587 | Not Available | 666 | Open in IMG/M |
| 3300012964|Ga0153916_10687819 | Not Available | 1102 | Open in IMG/M |
| 3300014501|Ga0182024_10417256 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1730 | Open in IMG/M |
| 3300014968|Ga0157379_10036418 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 4388 | Open in IMG/M |
| 3300015052|Ga0137411_1066893 | Not Available | 793 | Open in IMG/M |
| 3300015053|Ga0137405_1000940 | Not Available | 1181 | Open in IMG/M |
| 3300015053|Ga0137405_1004960 | Not Available | 1200 | Open in IMG/M |
| 3300015054|Ga0137420_1204110 | All Organisms → cellular organisms → Bacteria | 1001 | Open in IMG/M |
| 3300015241|Ga0137418_11324485 | All Organisms → cellular organisms → Bacteria | 501 | Open in IMG/M |
| 3300015264|Ga0137403_11399386 | All Organisms → cellular organisms → Bacteria | 547 | Open in IMG/M |
| 3300017943|Ga0187819_10134622 | Not Available | 1473 | Open in IMG/M |
| 3300017955|Ga0187817_10363251 | All Organisms → cellular organisms → Bacteria | 923 | Open in IMG/M |
| 3300017995|Ga0187816_10362276 | All Organisms → cellular organisms → Bacteria | 641 | Open in IMG/M |
| 3300018468|Ga0066662_10988566 | All Organisms → cellular organisms → Bacteria | 832 | Open in IMG/M |
| 3300018482|Ga0066669_11672467 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium 12-62-4 | 583 | Open in IMG/M |
| 3300019789|Ga0137408_1329214 | Not Available | 1234 | Open in IMG/M |
| 3300019888|Ga0193751_1269360 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium 12-62-4 | 510 | Open in IMG/M |
| 3300020579|Ga0210407_10692485 | All Organisms → cellular organisms → Bacteria | 791 | Open in IMG/M |
| 3300021086|Ga0179596_10422979 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium 12-62-4 | 673 | Open in IMG/M |
| 3300021170|Ga0210400_10097821 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 2322 | Open in IMG/M |
| 3300021170|Ga0210400_10840555 | All Organisms → cellular organisms → Bacteria | 751 | Open in IMG/M |
| 3300021170|Ga0210400_11281213 | Not Available | 588 | Open in IMG/M |
| 3300021178|Ga0210408_11264608 | Not Available | 561 | Open in IMG/M |
| 3300021180|Ga0210396_10044079 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 4100 | Open in IMG/M |
| 3300021181|Ga0210388_11592056 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium 12-62-4 | 543 | Open in IMG/M |
| 3300021401|Ga0210393_10113479 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2162 | Open in IMG/M |
| 3300021402|Ga0210385_10242324 | Not Available | 1322 | Open in IMG/M |
| 3300021402|Ga0210385_10515986 | All Organisms → cellular organisms → Bacteria | 907 | Open in IMG/M |
| 3300021403|Ga0210397_10742246 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 756 | Open in IMG/M |
| 3300021420|Ga0210394_10295613 | Not Available | 1421 | Open in IMG/M |
| 3300021432|Ga0210384_10501008 | All Organisms → cellular organisms → Bacteria | 1093 | Open in IMG/M |
| 3300021432|Ga0210384_10560823 | All Organisms → cellular organisms → Bacteria | 1027 | Open in IMG/M |
| 3300021433|Ga0210391_10214267 | Not Available | 1514 | Open in IMG/M |
| 3300021474|Ga0210390_11474522 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium 12-62-4 | 539 | Open in IMG/M |
| 3300021476|Ga0187846_10048055 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1893 | Open in IMG/M |
| 3300021478|Ga0210402_10908706 | All Organisms → cellular organisms → Bacteria | 807 | Open in IMG/M |
| 3300021478|Ga0210402_11301751 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium 12-62-4 | 654 | Open in IMG/M |
| 3300021479|Ga0210410_10032311 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 4541 | Open in IMG/M |
| 3300021559|Ga0210409_10324895 | Not Available | 1384 | Open in IMG/M |
| 3300021559|Ga0210409_10475975 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Cactineae → Cactaceae → Opuntioideae → Opuntia → Opuntia streptacantha | 1111 | Open in IMG/M |
| 3300024330|Ga0137417_1396361 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2054 | Open in IMG/M |
| 3300025906|Ga0207699_11009578 | Not Available | 615 | Open in IMG/M |
| 3300025935|Ga0207709_11542448 | Not Available | 551 | Open in IMG/M |
| 3300025939|Ga0207665_10097691 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2045 | Open in IMG/M |
| 3300025939|Ga0207665_10571372 | All Organisms → cellular organisms → Bacteria | 880 | Open in IMG/M |
| 3300026277|Ga0209350_1034739 | Not Available | 1494 | Open in IMG/M |
| 3300026277|Ga0209350_1078649 | All Organisms → cellular organisms → Bacteria | 895 | Open in IMG/M |
| 3300026328|Ga0209802_1221001 | All Organisms → cellular organisms → Bacteria | 700 | Open in IMG/M |
| 3300026330|Ga0209473_1042158 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 2022 | Open in IMG/M |
| 3300026374|Ga0257146_1081534 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium 12-62-4 | 528 | Open in IMG/M |
| 3300026499|Ga0257181_1068639 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium 12-62-4 | 606 | Open in IMG/M |
| 3300026551|Ga0209648_10163533 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1743 | Open in IMG/M |
| 3300026551|Ga0209648_10496336 | All Organisms → cellular organisms → Bacteria | 712 | Open in IMG/M |
| 3300026557|Ga0179587_11075314 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium | 529 | Open in IMG/M |
| 3300027381|Ga0208983_1103833 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium 12-62-4 | 523 | Open in IMG/M |
| 3300027512|Ga0209179_1010529 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1615 | Open in IMG/M |
| 3300027643|Ga0209076_1008510 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2571 | Open in IMG/M |
| 3300027660|Ga0209736_1024795 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1816 | Open in IMG/M |
| 3300027660|Ga0209736_1124755 | All Organisms → cellular organisms → Bacteria | 691 | Open in IMG/M |
| 3300027671|Ga0209588_1137217 | All Organisms → cellular organisms → Bacteria | 779 | Open in IMG/M |
| 3300027671|Ga0209588_1208292 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium 12-62-4 | 607 | Open in IMG/M |
| 3300027787|Ga0209074_10549332 | Not Available | 508 | Open in IMG/M |
| 3300027846|Ga0209180_10025707 | All Organisms → cellular organisms → Bacteria | 3144 | Open in IMG/M |
| 3300027846|Ga0209180_10047406 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2363 | Open in IMG/M |
| 3300027853|Ga0209274_10430561 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium 12-62-4 | 682 | Open in IMG/M |
| 3300027855|Ga0209693_10079085 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1623 | Open in IMG/M |
| 3300027874|Ga0209465_10444604 | All Organisms → cellular organisms → Bacteria | 648 | Open in IMG/M |
| 3300027895|Ga0209624_10307598 | Not Available | 1056 | Open in IMG/M |
| 3300027908|Ga0209006_10060318 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3393 | Open in IMG/M |
| 3300028047|Ga0209526_10140703 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1692 | Open in IMG/M |
| 3300028773|Ga0302234_10326948 | All Organisms → cellular organisms → Bacteria | 657 | Open in IMG/M |
| 3300028795|Ga0302227_10160363 | All Organisms → cellular organisms → Bacteria | 885 | Open in IMG/M |
| 3300028906|Ga0308309_10486623 | Not Available | 1066 | Open in IMG/M |
| 3300029636|Ga0222749_10030167 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2300 | Open in IMG/M |
| 3300029636|Ga0222749_10259880 | All Organisms → cellular organisms → Bacteria | 886 | Open in IMG/M |
| 3300031231|Ga0170824_111228008 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium 12-62-4 | 534 | Open in IMG/M |
| 3300031231|Ga0170824_114592404 | Not Available | 1284 | Open in IMG/M |
| 3300031474|Ga0170818_102069997 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium 12-62-4 | 588 | Open in IMG/M |
| 3300031718|Ga0307474_10019506 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 4931 | Open in IMG/M |
| 3300031720|Ga0307469_11967561 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium | 567 | Open in IMG/M |
| 3300031720|Ga0307469_12199002 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium 12-62-4 | 537 | Open in IMG/M |
| 3300031753|Ga0307477_10042751 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 3113 | Open in IMG/M |
| 3300031754|Ga0307475_10418995 | Not Available | 1076 | Open in IMG/M |
| 3300031763|Ga0318537_10395276 | All Organisms → cellular organisms → Bacteria | 510 | Open in IMG/M |
| 3300031771|Ga0318546_10455791 | All Organisms → cellular organisms → Bacteria | 896 | Open in IMG/M |
| 3300031820|Ga0307473_10523740 | All Organisms → cellular organisms → Bacteria | 804 | Open in IMG/M |
| 3300031821|Ga0318567_10274735 | All Organisms → cellular organisms → Bacteria | 948 | Open in IMG/M |
| 3300031890|Ga0306925_10002835 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 15074 | Open in IMG/M |
| 3300031893|Ga0318536_10300028 | All Organisms → cellular organisms → Bacteria | 815 | Open in IMG/M |
| 3300031912|Ga0306921_12584240 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium 12-62-4 | 525 | Open in IMG/M |
| 3300031962|Ga0307479_10366389 | Not Available | 1424 | Open in IMG/M |
| 3300032059|Ga0318533_10207094 | Not Available | 1407 | Open in IMG/M |
| 3300032068|Ga0318553_10753585 | Not Available | 509 | Open in IMG/M |
| 3300032180|Ga0307471_104006104 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium | 520 | Open in IMG/M |
| 3300032205|Ga0307472_101438301 | All Organisms → cellular organisms → Bacteria | 670 | Open in IMG/M |
| 3300032205|Ga0307472_101927469 | Not Available | 590 | Open in IMG/M |
| 3300033158|Ga0335077_10038199 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 5933 | Open in IMG/M |
| 3300033158|Ga0335077_10531597 | Not Available | 1238 | Open in IMG/M |
| 3300033289|Ga0310914_10497439 | Not Available | 1103 | Open in IMG/M |
| 3300033289|Ga0310914_10533673 | All Organisms → cellular organisms → Bacteria | 1060 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 35.98% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 17.46% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 5.29% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 4.76% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 4.23% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 3.70% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 3.70% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.17% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 2.65% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 2.12% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 1.59% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 1.06% |
| Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 1.06% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 1.06% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.06% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.06% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.06% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.06% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 1.06% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.06% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.53% |
| Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 0.53% |
| Prmafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Prmafrost Soil | 0.53% |
| Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost | 0.53% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.53% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.53% |
| Biofilm | Environmental → Terrestrial → Cave → Unclassified → Unclassified → Biofilm | 0.53% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 0.53% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.53% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.53% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.53% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000655 | Forest soil microbial communities from Amazon forest - 2010 replicate II A100 | Environmental | Open in IMG/M |
| 3300001137 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M3 | Environmental | Open in IMG/M |
| 3300001527 | Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A3-5cm-13A)- 1 week illumina | Environmental | Open in IMG/M |
| 3300001867 | Texas A ecozone_OM1H0_M2 (Combined assembly for Texas A ecozone Site metagenome samples, ASSEMBLY_DATE=20130705) | Environmental | Open in IMG/M |
| 3300003505 | Forest soil microbial communities from Harvard Forest LTER, USA - Combined assembly of forest soil metaG samples (ASSEMBLY_DATE=20140924) | Environmental | Open in IMG/M |
| 3300004080 | Coassembly of ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
| 3300004091 | Coassembly of ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300005167 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 | Environmental | Open in IMG/M |
| 3300005171 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126 | Environmental | Open in IMG/M |
| 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Host-Associated | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
| 3300005555 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 | Environmental | Open in IMG/M |
| 3300005566 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_142 | Environmental | Open in IMG/M |
| 3300005576 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 | Environmental | Open in IMG/M |
| 3300005591 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 | Environmental | Open in IMG/M |
| 3300005610 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 | Environmental | Open in IMG/M |
| 3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
| 3300005993 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-046 | Environmental | Open in IMG/M |
| 3300006031 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100 | Environmental | Open in IMG/M |
| 3300006052 | Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013 | Environmental | Open in IMG/M |
| 3300006102 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2013 | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300010321 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09212015 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
| 3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
| 3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
| 3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
| 3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
| 3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300012924 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012931 | Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 3 metaG | Environmental | Open in IMG/M |
| 3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
| 3300012964 | Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 4 metaG | Environmental | Open in IMG/M |
| 3300014501 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Host-Associated | Open in IMG/M |
| 3300015052 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015053 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015054 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015241 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015264 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300017943 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4 | Environmental | Open in IMG/M |
| 3300017955 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2 | Environmental | Open in IMG/M |
| 3300017995 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_1 | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300019789 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300019888 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1c2 | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300021086 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
| 3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
| 3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
| 3300021402 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-O | Environmental | Open in IMG/M |
| 3300021403 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
| 3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
| 3300021476 | Biofilm microbial communities from the roof of an iron ore cave, State of Minas Gerais, Brazil - TC_06 Biofilm (v2) | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300024330 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026277 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_2_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026328 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 (SPAdes) | Environmental | Open in IMG/M |
| 3300026330 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 (SPAdes) | Environmental | Open in IMG/M |
| 3300026374 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - CO-08-A | Environmental | Open in IMG/M |
| 3300026499 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NR-06-B | Environmental | Open in IMG/M |
| 3300026551 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300027381 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA Ref_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027643 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027660 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027787 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter (SPAdes) | Environmental | Open in IMG/M |
| 3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027853 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027855 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027874 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes) | Environmental | Open in IMG/M |
| 3300027895 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027908 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300028047 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028773 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N3_2 | Environmental | Open in IMG/M |
| 3300028795 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N1_1 | Environmental | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300029636 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031474 | Fir Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031763 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f29 | Environmental | Open in IMG/M |
| 3300031771 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19 | Environmental | Open in IMG/M |
| 3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
| 3300031821 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f20 | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031893 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f28 | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032059 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27 | Environmental | Open in IMG/M |
| 3300032068 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f21 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
| 3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| AF_2010_repII_A100DRAFT_10752481 | 3300000655 | Forest Soil | VGRIEREYGVTLDGRLEPLAAAGLVKRDGDVVRLAEERLSVSNEVFVELMK* |
| JGI12637J13337_10143261 | 3300001137 | Forest Soil | EGLESAGLVKRDGEVVRLAPAKLSVSNEVFVELMR* |
| A3513AW1_10157922 | 3300001527 | Permafrost | VSRIEKNYAVSLTPRFAPLASSGLVEWNGPVVRLAPSRLSVSNEVFVELLR* |
| JGI12627J18819_104020991 | 3300001867 | Forest Soil | RLHEAGLVERCGSVVRLAPARLSISNEAFVELMR* |
| JGIcombinedJ51221_103003672 | 3300003505 | Forest Soil | YGVAVTPRFDRLMSAGMVERNGNVVRLTESKLSAANEVFVELMK* |
| Ga0062385_102280842 | 3300004080 | Bog Forest Soil | LGGRFEPLESAGLIERSGELVRLSPARLSVSNEVFVGLMR* |
| Ga0062387_1012035902 | 3300004091 | Bog Forest Soil | ERDYHVQLASRFDPLAKLGLLERSGNVVRLAPQKLSISNEVFVEIMR* |
| Ga0066672_109493031 | 3300005167 | Soil | YGVSLAARFDPLTSAGLVERDGSIVRLGPERLTISNEVFVGLMR* |
| Ga0066677_101521452 | 3300005171 | Soil | REYGVALEGRFKSLAAAGLVERDGDVVRLAEEKLSVSNEVFVELMR* |
| Ga0068869_1006715371 | 3300005334 | Miscanthus Rhizosphere | VAPRFERLTAAGLIEQQGSIVRLAPKKLSVSNEVFVELMK* |
| Ga0070708_1001145341 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | GVTLASRFDPLMMAGLVERDGGVVRLARDRLAVSNEVFVELMR* |
| Ga0070708_1004129782 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | ISDRFQPLESSGLLERDGTVVRLAAKHLSISNEVFVELMR* |
| Ga0070699_1004806392 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | ISDRFQPLESSGLLERDGPVVRLAPKHLSISNEVFVELMR* |
| Ga0066692_109880281 | 3300005555 | Soil | VSRIEREYGVTLAGRFEPLASAGLVKRDGNVVRLAPERLSVSNEVFVELMK* |
| Ga0066693_103520641 | 3300005566 | Soil | GVSLAARFDPLTSAGLVERDGSIVRLAPDRLSISNEVFVELMR* |
| Ga0066708_103078521 | 3300005576 | Soil | IEQEYGVTVTGRFDRLGSAGLVERQGSVVRLAPEKLSISNEVFVELMR* |
| Ga0070761_105221092 | 3300005591 | Soil | EGLESAGLITREGRIVRLAPARLSVSNEVFVELMR* |
| Ga0070763_100795153 | 3300005610 | Soil | RFDPLAAAGLVMREGDLVRLAGEKLSISNEVFVELLK* |
| Ga0070763_105588532 | 3300005610 | Soil | PLESAGLVERDGNLLRLAPGKVSISNEAFVELMR* |
| Ga0070766_112094112 | 3300005921 | Soil | DRLMTAGLVERNGSIVRLAPEKLSVSNEVFVELMK* |
| Ga0080027_101552282 | 3300005993 | Prmafrost Soil | KDYAVALASRFDPLASSGLVEWNGPVVRLAPSRLSVSNEVFVELLR* |
| Ga0066651_102275212 | 3300006031 | Soil | VSLAARFDPLTSAGLVERDGSIVRLAPERLSISNEVFVELMR* |
| Ga0075029_1004171552 | 3300006052 | Watersheds | EYGVALAGRFDPLALAGLVERDGGLVRLAVGKLSVSNEVFVELMR* |
| Ga0075015_1001875031 | 3300006102 | Watersheds | EKEYGVELGARFEMLTSAGLVEREGSVVRLAEEKLSISNEVFVELMR* |
| Ga0070765_1003360511 | 3300006176 | Soil | KYGVGLGKRFEALEAAGLVERRGNVVRLAPARLSVSNEVFVELMR* |
| Ga0079222_121487162 | 3300006755 | Agricultural Soil | AGRFEPLAAAGLVEREGNVVRLAEERLSVSNEVFVQLMK* |
| Ga0075425_1003663841 | 3300006854 | Populus Rhizosphere | EAEYGIAVAPRFERLTAAGLIEQQGSIVRLAPKKLSVSNEVFVELMK* |
| Ga0075424_1013934051 | 3300006904 | Populus Rhizosphere | RLQAAGLVKRSGPVVRLAPEHLSISNEAFVELMR* |
| Ga0099794_103413802 | 3300007265 | Vadose Zone Soil | DPLASAGLVERDGSVVRLAPERLSVSNEAFVELMR* |
| Ga0099794_104879521 | 3300007265 | Vadose Zone Soil | IEREYGVALAKRFDSLALAGFVERDGGVVRLAPGRLSVSNEVFVELLR* |
| Ga0099794_107251741 | 3300007265 | Vadose Zone Soil | EREYGVMLAARFDPLASAGLVERDGSMVRLAPERLSVSNEVFVELMR* |
| Ga0099829_100802274 | 3300009038 | Vadose Zone Soil | YGVPLANRFDVLASNGLVERNGSIVRLAPSRLSVSNEVFVELLR* |
| Ga0099830_114473662 | 3300009088 | Vadose Zone Soil | RFDPLALAGLVEREGSVVRLAPERLSVSNEVFVELLR* |
| Ga0099827_103507991 | 3300009090 | Vadose Zone Soil | RIEREYGVTLAGRFEPLASAGLVKRDGNVVRLAPERLSVSNEVFVELMK* |
| Ga0099827_116007502 | 3300009090 | Vadose Zone Soil | LERAYCVPLSARFDALAGAGLVEREGTIVRLAPARISISNEVFVELLR* |
| Ga0066709_1011310841 | 3300009137 | Grasslands Soil | IEREYGVALAGRFEPLAAAGLVQREGNVVRLAEEKLSVSNEVFVELMR* |
| Ga0134067_100498561 | 3300010321 | Grasslands Soil | QIERDYGVSLAARFDPLTSAGLVERDGSIVRLAPERLTISNEVFVELMR* |
| Ga0126370_102658151 | 3300010358 | Tropical Forest Soil | ALAGRFEPLTTAGLVEREGDVVRLAEQKLSVSNEVFVELMK* |
| Ga0126376_114597111 | 3300010359 | Tropical Forest Soil | GVALDKRFEPLVSAGLVERDGDVIRLSEKKLSVSNEVFVELMT* |
| Ga0126372_106714342 | 3300010360 | Tropical Forest Soil | GVALDGRLEPLAAAGLVKRDGDVVRLAEERLSVSNEVFVELMK* |
| Ga0126381_1000115551 | 3300010376 | Tropical Forest Soil | YGVALAGRLEPLAAAGLIQREGAVVRLAEEKLSVSNEVFVGLMK* |
| Ga0126383_123635831 | 3300010398 | Tropical Forest Soil | PLAEAGLVEQYGSVVRLAEEKLSVSNEVFVELMR* |
| Ga0137392_108279342 | 3300011269 | Vadose Zone Soil | SLSDRFQPLESSGLLERDGTVVRLAPSHLSISNEVFVELMR* |
| Ga0137391_100947163 | 3300011270 | Vadose Zone Soil | FDPLASAGLLEREGGVVRLAPGKLSVSNEVFVELMR* |
| Ga0137393_106125552 | 3300011271 | Vadose Zone Soil | DVARIEREYGVSLEARFARLWSAGLVEREGSLVRLAPGRVSVSNEVFVELMK* |
| Ga0137393_109905002 | 3300011271 | Vadose Zone Soil | DYGVRLTERFDPLALAGLVEREGSMVRLAPEKLSVSNEVFVELMR* |
| Ga0137393_111757751 | 3300011271 | Vadose Zone Soil | VTLAGRFEPLASAGLVKRDGNVVRLAPERLSVSNEVFVELMR* |
| Ga0137393_116766511 | 3300011271 | Vadose Zone Soil | IDLGRIEREYGVAVTARFDRIASAGLVKIDGRMVRLAPERLSVSNEVFVELMR* |
| Ga0137389_104337141 | 3300012096 | Vadose Zone Soil | GVSLDSRFARLSSAGLIQRAGSVVRLAPGRVSVSNEVFVELMR* |
| Ga0137389_115163782 | 3300012096 | Vadose Zone Soil | GLAGRFDPLASAGLVKRDGSMVRLAPSRLSVSNEVFVELMR* |
| Ga0137388_119636651 | 3300012189 | Vadose Zone Soil | ARIERDYGVTLAGRFDPLALAGLVEREGSVVRLAPERLSVSNEVFVELLR* |
| Ga0137383_106959411 | 3300012199 | Vadose Zone Soil | RFDPLASAGLVERQGSVVRLTPEKLSISNEVFVELMR* |
| Ga0137383_107280362 | 3300012199 | Vadose Zone Soil | DVGRIEKEYGVALAGRFESLAAAGLIEREGDVVRLAEERLSVSNEVFVELMR* |
| Ga0137363_100912021 | 3300012202 | Vadose Zone Soil | GVRLTARFDPLASAGLVEREGSMVRLAPKRLSVSNEVFVELMK* |
| Ga0137363_108748882 | 3300012202 | Vadose Zone Soil | VGLAGRFDPLASAGLVKRDGSMVRLAPSRLSVSNEVFVELMR* |
| Ga0137363_116475611 | 3300012202 | Vadose Zone Soil | GIDVARIEREYGVSLESRFARLRSAGLVEWEGSLVRLAPGRVSVANEVFVELMK* |
| Ga0137362_107379152 | 3300012205 | Vadose Zone Soil | RIEREYGVALASRFDPLRAVGLVRREGNIVRLAEEKLSISNEVFVELMK* |
| Ga0137381_107893071 | 3300012207 | Vadose Zone Soil | EYGVTVMERFDPLASAGLVERQGSVVRLTPEKLSISNEVFVELMR* |
| Ga0137379_106978772 | 3300012209 | Vadose Zone Soil | AGRFEPLASAGLVKRDGNVVRLAPERLSVSNEVFVELMK* |
| Ga0137378_106345751 | 3300012210 | Vadose Zone Soil | RFDPMVSAGLVEREGSVVRLAEGKLSVSNEVFVELLR* |
| Ga0137378_114617222 | 3300012210 | Vadose Zone Soil | YGLEVMGRFDPMVSAGLVEREGSVVRLAEGKLSVSNEVFVELMR* |
| Ga0137378_115076802 | 3300012210 | Vadose Zone Soil | RFDPLTSAGLVERDGSVVRLVPRRLSVSNEVFVELMR* |
| Ga0137377_115511501 | 3300012211 | Vadose Zone Soil | YGVTLAGRFEPLASAGLVKRDGNVVRLAPERLSVSNEVFVELMR* |
| Ga0150985_1043850071 | 3300012212 | Avena Fatua Rhizosphere | RFERLGVAGLIERQGSIVRLAPNKLSVSNEVFVELMK* |
| Ga0137386_106847861 | 3300012351 | Vadose Zone Soil | FDPMVSAGLVEREGSVVRLAEGKLSVSNEVFVELLR* |
| Ga0137371_103880232 | 3300012356 | Vadose Zone Soil | DVPLKDRFTSLESAGLIERCGSVVRLVPARLSIANEVFVELMR* |
| Ga0137384_107407792 | 3300012357 | Vadose Zone Soil | AMVSAGLVERAGSVVRLAEGKLSVSNEVFVELMR* |
| Ga0137384_108414162 | 3300012357 | Vadose Zone Soil | DPLASAGLVERQGSVVRLTPEKLSISNEVFVELMR* |
| Ga0137384_109219562 | 3300012357 | Vadose Zone Soil | QLEQVYDVPLSARFDALAGAGLVEREGTTVRLAPARLSISNEVFVELLR* |
| Ga0137385_103783162 | 3300012359 | Vadose Zone Soil | DVARIERKYGLEVMGRFDPMVSAGLVEREGSVVRLAEGKLSVSNEVFVELMR* |
| Ga0137385_110922132 | 3300012359 | Vadose Zone Soil | EYGVRLQERFAELAAAGLVERAGDVVRLAEERLSVSNEVFVELMK* |
| Ga0137360_118909892 | 3300012361 | Vadose Zone Soil | LGRIEREYGVTLASRFDPLATVGLVRREGNIVRLAEEKLSISNEVFVELMK* |
| Ga0137361_100273535 | 3300012362 | Vadose Zone Soil | ARLSSAGLIEREGSLVRLAPGRVSVSNEVFVELMK* |
| Ga0137358_109674041 | 3300012582 | Vadose Zone Soil | RFDPLASAGLVERDGTVVRLAPEKLSVSNDVFVELMR* |
| Ga0137398_104400162 | 3300012683 | Vadose Zone Soil | LDSRFARLTSAGLSERAGGLVRLGVGRVRVAKEVFGD |
| Ga0137398_108498551 | 3300012683 | Vadose Zone Soil | DYGRLERVDGVALDSGLARLTSAGLIERVGSLVRLAAGRVSVSNEVFVELMK* |
| Ga0137398_111017242 | 3300012683 | Vadose Zone Soil | RFERLTSAGLVEREGSLVRLAPGRVSVANEVFVELMK* |
| Ga0137397_106210792 | 3300012685 | Vadose Zone Soil | FRTLESSGMLERDGNVVRLAPRHLSIANEVFVELMR* |
| Ga0137397_107173102 | 3300012685 | Vadose Zone Soil | EREYGVTLASRFDPLMMAGLVKRDGGIVKLASDRLAVSNEVFVELMR* |
| Ga0137395_100389924 | 3300012917 | Vadose Zone Soil | RFEPLTSAGLVKREGNFVRLAPEKLSVSNEVFVELLR* |
| Ga0137396_107761692 | 3300012918 | Vadose Zone Soil | YGVSLESRFARLRSAGLIERDGSLVRLAPGRVSVSNEVFVELMK* |
| Ga0137396_110772872 | 3300012918 | Vadose Zone Soil | VTLASRFDPLMMAGLVERDGGVVRLASDRLAVSNEVFVELMR* |
| Ga0137359_100571644 | 3300012923 | Vadose Zone Soil | VRLTGRFDPLASAGLVEREGSMVRLAPKRLSVSNEVFVELMK* |
| Ga0137413_109156632 | 3300012924 | Vadose Zone Soil | EREYGVSLESRFERLTSAGLVEREGSLVRLAPGRVSVSNEVFVELMK* |
| Ga0137419_110129312 | 3300012925 | Vadose Zone Soil | FDPLMVAGLVERDGGVVRLARNRLAVSNEVFVELMK* |
| Ga0137416_120852912 | 3300012927 | Vadose Zone Soil | DGIDLGRIEREYGVTLASRFDPLMMAGLVERDGGIVKLASDRLAVSNEVFVELMR* |
| Ga0137404_122049402 | 3300012929 | Vadose Zone Soil | FARLKSAGLIEREGSLVRLAPRRVSVSNEVFVELMK* |
| Ga0153915_113481762 | 3300012931 | Freshwater Wetlands | LAGKFDPLASAGLVKRDGSMVRLAPEKLSVSNEVFVELMR* |
| Ga0137410_115001571 | 3300012944 | Vadose Zone Soil | QLDGIDVGRIEQKYGVTLAGRFDPLATNGFVRREGSVVRLAEEKLSISNEVFVELMK* |
| Ga0164303_107455872 | 3300012957 | Soil | REYGVALGTVFEVVESAGLVTRAGDVVRLAPAKLSVSNEVFVELMR* |
| Ga0153916_106878191 | 3300012964 | Freshwater Wetlands | RYGVQLANRFEGLAAGGFIEQDGPRVRLAPARLSVSNEVFVELLR* |
| Ga0182024_104172563 | 3300014501 | Permafrost | RFDRLMTAGLVERDGAVVRLVAEKLSVSNEVFVELMR* |
| Ga0157379_100364181 | 3300014968 | Switchgrass Rhizosphere | TRLQAAGLVKRSGPVVRLAPEYLSISNEAFVELMR* |
| Ga0137411_10668932 | 3300015052 | Vadose Zone Soil | YGVTLTGRFDPLALAGLVERDGPVVRLAPEKLSVSNEVFVELMR* |
| Ga0137405_10009401 | 3300015053 | Vadose Zone Soil | VGRIEREYGVMLTGRFEPLASAGLVKREGNFVRLAPEKLSVSNEVFVELLR* |
| Ga0137405_10049601 | 3300015053 | Vadose Zone Soil | DGIDVGHVGRIEREYGVMLTGRFEPLASAGLVKREGNFVRLAPEKLSVSNEVFVELLR* |
| Ga0137420_12041102 | 3300015054 | Vadose Zone Soil | FDPLASAGLVEREGSMVRLAPERLSVSNEVFVELMK* |
| Ga0137418_113244851 | 3300015241 | Vadose Zone Soil | ARLTSAGLIEREGSLVRLAPGRISVSNEVFVELMR* |
| Ga0137403_113993861 | 3300015264 | Vadose Zone Soil | GRIERDYGVTLTGRFDPLASAGLVERDGTVVRLAPEKLSVSNEVFVELMR* |
| Ga0187819_101346222 | 3300017943 | Freshwater Sediment | RQLEGIDVGRIEREYEVAVAGRFDPLVLAGLMERDGSVVRLAPNRLAISNEAFVALME |
| Ga0187817_103632512 | 3300017955 | Freshwater Sediment | AGRFDRLASAGLVERDGSVVRLAPGRLSVSNEVFVELMR |
| Ga0187816_103622761 | 3300017995 | Freshwater Sediment | LAGRFDPLASAGLVVREGSLVRLAAGKLSVSNEVFVELMR |
| Ga0066662_109885662 | 3300018468 | Grasslands Soil | PLSARFDALAGAGLVEREGTTVRLAPARLSISNEVFVELLR |
| Ga0066669_116724671 | 3300018482 | Grasslands Soil | VMGRFDPLTSAGLVERDGSVVRLAPRRLSVSNEVFVELMR |
| Ga0137408_13292141 | 3300019789 | Vadose Zone Soil | VDGGGILMVAGLVERDGGVVRLARNRLAVSNEVFVELMK |
| Ga0193751_12693601 | 3300019888 | Soil | SDRFLPLESSGLLERDGTVVRLAPKHLSISNEVFVELMR |
| Ga0210407_106924852 | 3300020579 | Soil | YHVELAPRFALLEKQGWLERRGAVVRLAPQKLSVSNEVFVELLR |
| Ga0179596_104229792 | 3300021086 | Vadose Zone Soil | RIEREYGVAVGSRFDRLIEAGLVERDGGVVRLAAKKLSVSNEVFVELMR |
| Ga0210400_100978213 | 3300021170 | Soil | LAGKLDPLALAGLVKRDGSMVRLAPERLSVSNEVFVELMR |
| Ga0210400_108405552 | 3300021170 | Soil | ELLGKIVSLEAAGLVERQGDLVRLAPGKLSVSNEAFVLLLD |
| Ga0210400_112812132 | 3300021170 | Soil | LDSRFSRLSSAGLIERAGNWVRLAPGRVSVSNEVFVELMK |
| Ga0210408_112646082 | 3300021178 | Soil | DVGRIERQYGVTLAGGFDPLASAGLVERTGSIVRLAPAKLSVSNEVFVGLLG |
| Ga0210396_100440796 | 3300021180 | Soil | YGVSLANRFEGLESAGLVKREGGIVRLAPARLSVSNEVFVELMR |
| Ga0210388_115920561 | 3300021181 | Soil | YGVAVGPRFDRLMAAGLVQREGGVVRLVAEKLSVSNEVFVELMR |
| Ga0210393_101134793 | 3300021401 | Soil | DVGRIEREYGVAVTPRFDRLMSAGMVERNGNVVRLAESKLSVANEVFVELMK |
| Ga0210385_102423241 | 3300021402 | Soil | ERRYGVAVESRFERLMKAGLIEREGSWVRLAPGKLSVANEVFVELMK |
| Ga0210385_105159861 | 3300021402 | Soil | FARLMAAGLVEREGNCVRLAPGKLSVANEVFVELMR |
| Ga0210397_107422463 | 3300021403 | Soil | DLSQIEREYGVALAGRFDPLASAGLVEREGSLVRLAPGRLSISNEVFVELMR |
| Ga0210394_102956131 | 3300021420 | Soil | DPLASSGLLEWNGSVVRLAPSRLSVSNEVFVELLR |
| Ga0210384_105010082 | 3300021432 | Soil | IDLGRIEREYGVAVTARFDRIASAGLVKIDGHMVRLAPERLSVSNEVFVELMR |
| Ga0210384_105608232 | 3300021432 | Soil | DVGRIERKYGVSLDSRFERLTSAGLIEREGSLVRLAAGRVSVSNEVFVELMK |
| Ga0210391_102142673 | 3300021433 | Soil | VGRIEREYGVGLGKRFEGLQAVGLVERCGDVVRLAPSRLSVSNEVFVELMR |
| Ga0210390_114745222 | 3300021474 | Soil | QLDGIDVGRIEREYGVAVTPRFDRLMSAGMVERNGNVVRLTESKLSAANEVFVELMK |
| Ga0187846_100480553 | 3300021476 | Biofilm | YGVALEGRFAPLTAEGLVEKKGGVVRLAENKLSVSNEVFVELMR |
| Ga0210402_109087061 | 3300021478 | Soil | VQGLQVAGLVERNGDVVRLAPARLSVSNEVFVELMR |
| Ga0210402_113017511 | 3300021478 | Soil | VALTGRFGPLTSAGLVKRDGNFVRLAPEKLSVSNEVFVELMR |
| Ga0210410_100323111 | 3300021479 | Soil | TRFGALEAAGLIEREGEIVRLAPARLSVSNEVFVELMR |
| Ga0210409_103248951 | 3300021559 | Soil | TTLAGRFDPLALAGLVKRDGSIVRLAPEKLSVSNEVFVELMR |
| Ga0210409_104759751 | 3300021559 | Soil | ARLSSAGLIEREGSLVRLAPGRVSVSNEVFVELMK |
| Ga0137417_13963613 | 3300024330 | Vadose Zone Soil | MGRFDPLTSAGLVERDGSVVRLAPRRLSVSNEVFVELMR |
| Ga0207699_110095781 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | TRFGPLESAGLVRRDGDVVRLAPARLSVSNEVFVELMK |
| Ga0207709_115424482 | 3300025935 | Miscanthus Rhizosphere | PRCERLTAAGLIEQQGSIVRLAPKKLSVSNEVFVELMK |
| Ga0207665_100976914 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | DVLLKDRFTPLESAGLIEYSGSVVRLVPAHLSISNEVFVALMR |
| Ga0207665_105713721 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | QRYGVTLGSRFAPLALAGLIERNGDIVRLVPNRVSVSNEVFVELMK |
| Ga0209350_10347394 | 3300026277 | Grasslands Soil | IEREYGINLAGKFDPLALAGLVKQDGSMVRLAPEKLSVSNEVFVELLR |
| Ga0209350_10786492 | 3300026277 | Grasslands Soil | DPLTSAGLVERDGSVVRLVPRRLSVSNEVFVELMR |
| Ga0209802_12210012 | 3300026328 | Soil | ARIEQEYGVTVTGRFDRLGSAGLVERQGSVVRLAPEKLSISNEVFVELMR |
| Ga0209473_10421583 | 3300026330 | Soil | EREYGVALEGRFKSLAAAGLVERDGDVVRLAEEKLSVSNEVFVELMR |
| Ga0257146_10815342 | 3300026374 | Soil | RLQKFYGVSISDRFQPLESSGLLERDGTVVRLAPKHLSISNEVFVELMR |
| Ga0257181_10686391 | 3300026499 | Soil | LTGRFDPLALAGLVERDGTVVRLAPEKLSVSNEVFVELMR |
| Ga0209648_101635333 | 3300026551 | Grasslands Soil | FDPLALAGLVEREGSMVRLAPEKLSVSNEVFVELMR |
| Ga0209648_104963361 | 3300026551 | Grasslands Soil | RFQPLESSGLLERDGTVVRLAPKHLSISNEVFVELMR |
| Ga0179587_110753142 | 3300026557 | Vadose Zone Soil | RFDPLASAGLVERDGTVVRLAPEKLSVSNEVFVELMR |
| Ga0208983_11038332 | 3300027381 | Forest Soil | RFDPLASSGLVEWNGPVVRLAPSRLSVSNEVFVELLR |
| Ga0209179_10105291 | 3300027512 | Vadose Zone Soil | GVSLESRFARLRSAGLIERDGSLVRLAPGRVSVSNEVFVELMK |
| Ga0209076_10085103 | 3300027643 | Vadose Zone Soil | IDLGRIEREYGTTLAEKFDSLTSAGLVKRDGDFVRLASEKLTVSNEVFVELMR |
| Ga0209736_10247951 | 3300027660 | Forest Soil | DPLASAGLIEREGSVVRLAPGRVSVSNEVFVELMK |
| Ga0209736_11247551 | 3300027660 | Forest Soil | RFEGLESAGLVKRDGEVVRLAPAKLSVSNEVFVELMR |
| Ga0209588_11372172 | 3300027671 | Vadose Zone Soil | IERDYGVTLMARFDPLASAGLVERDGSVVRLAPERLSVSNEVFVELMR |
| Ga0209588_12082922 | 3300027671 | Vadose Zone Soil | DPLALAGLVEREGSMVRLAPEKLSVSNEVFVELMR |
| Ga0209074_105493322 | 3300027787 | Agricultural Soil | AGRFEPLAAAGLVEREGNVVRLAEERLSVSNEVFVQLMK |
| Ga0209180_100257073 | 3300027846 | Vadose Zone Soil | IEREYGVTLAKRFDPLALAGFVERDGGVVRLAPGRLSVSNEVFVELLR |
| Ga0209180_100474061 | 3300027846 | Vadose Zone Soil | DVSRIEREYGVALAGRFEPLAEAGLVERNGNVVRLAERKLSVSNEVFVELMK |
| Ga0209274_104305611 | 3300027853 | Soil | EGLESAGLITREGRIVRLAPARLSVSNEVFVELMR |
| Ga0209693_100790853 | 3300027855 | Soil | RFDPLAAAGLVMREGDLVRLAGEKLSISNEVFVELLK |
| Ga0209465_104446042 | 3300027874 | Tropical Forest Soil | FDSLVTVGLVERDGNRVWLAPDRLSISNEVFVELMR |
| Ga0209624_103075981 | 3300027895 | Forest Soil | DPLASSGLVEWNGPVVRLAPSRLSVSNEVFVELLR |
| Ga0209006_100603184 | 3300027908 | Forest Soil | IEKDYAVKLGSRFDPLASSGLLEWNGSVVRLAPSRLSVSNEVFVELLR |
| Ga0209526_101407033 | 3300028047 | Forest Soil | DPLTSAGLVERDGSVVRLAPRRLSVSNEVFVELMR |
| Ga0302234_103269482 | 3300028773 | Palsa | KIEHAYGVQLAPRFDPLANLGLLERRGNVVRLAPRKLSVSNEVFVELMR |
| Ga0302227_101603631 | 3300028795 | Palsa | DPLANLGLLERRGNVVRLAPRKLSVSNEVFVELMR |
| Ga0308309_104866232 | 3300028906 | Soil | RQYGVAIEPRFERLMSAGLVEREGSWVRLAPSKLSVANEVFVELMK |
| Ga0222749_100301673 | 3300029636 | Soil | REYGVALGARIGPLQSAGLVERDGNLLRLAPGKVSISNEVFVELMR |
| Ga0222749_102598802 | 3300029636 | Soil | RIEREYGVSLDARFARLRSAGLIEREGSLVRLAPGRVSVSNEVFVELMK |
| Ga0170824_1112280081 | 3300031231 | Forest Soil | RFLPLESSGLLERDGTVVRLAPKHLSISNEVFVELMR |
| Ga0170824_1145924041 | 3300031231 | Forest Soil | IDVSRIEKDYAVKLASRFDPLASSGLVEWKGSVVRLAPSRLSVSNEVFVELLR |
| Ga0170818_1020699972 | 3300031474 | Forest Soil | RIEKDYAVKLASRFDPLASSGLVEWKGSVVRLAPSRLSVSNEVFVELLR |
| Ga0307474_100195061 | 3300031718 | Hardwood Forest Soil | GVAVEPRFERLMSAGLVQREGNWVRLAPGKLSIANEVFVELMK |
| Ga0307469_119675611 | 3300031720 | Hardwood Forest Soil | MDGIDVGRIELEYGVALGPRFEPLMTAGLVERKGGLVKLASERLAVSNEVFVALIS |
| Ga0307469_121990021 | 3300031720 | Hardwood Forest Soil | LSSLQSAGLIERNGNIVRLAPGKLSISNEVFVELLG |
| Ga0307477_100427513 | 3300031753 | Hardwood Forest Soil | FERLTLAGLIEREGSLVRLAPARVSVSNEVFVELMK |
| Ga0307475_104189952 | 3300031754 | Hardwood Forest Soil | SRFARLTSAGLIEREGSLVRLAPGRVSVSNEVFVELMK |
| Ga0318537_103952761 | 3300031763 | Soil | VTLQERFEQLAAAGLVEREGDVVRLPEGRLSVSNEVFVELMK |
| Ga0318546_104557911 | 3300031771 | Soil | EQLAAAGLVEREGDVVRLAEGRLSVSNEVFVELMK |
| Ga0307473_105237402 | 3300031820 | Hardwood Forest Soil | NRLQKFYGVSVEHRFTPLEASGLIERDGNVVRLAPERLSISNEVFVELMR |
| Ga0318567_102747351 | 3300031821 | Soil | LQERFEQLAAAGLVEREGDVVRLPEGRLSVSNEVFVELMK |
| Ga0306925_100028351 | 3300031890 | Soil | FEQLAAAGLVEREGDVVRLPEGRLSVSNEVFVELMK |
| Ga0318536_103000281 | 3300031893 | Soil | YGVTLQERFEQLAAAGLVEREGDVVRLAEGRLSVSNEVFVELMK |
| Ga0306921_125842402 | 3300031912 | Soil | FERLQQAGLIERSGGVVRLAPERLSVSNEAFVELLR |
| Ga0307479_103663892 | 3300031962 | Hardwood Forest Soil | IEREYGVSLDSRFARLTSAGLIEREGSLVRLAPGLVSVSNEVFVELMK |
| Ga0318533_102070941 | 3300032059 | Soil | FAPLDKAGLVELSGSVVRLRPERLAVSNEVFVELLR |
| Ga0318553_107535851 | 3300032068 | Soil | QRVYGVPLESRFAPLHAAGLIERSGPLVRLRPERLSVSNEVFVELMR |
| Ga0307471_1040061042 | 3300032180 | Hardwood Forest Soil | YGVTLASRFDPLMMAGLVERDGGVVRLASDRLAVSNEVFVELMR |
| Ga0307472_1014383012 | 3300032205 | Hardwood Forest Soil | DLNQIESEYGVLVAPRFERLASAGLVERKGSIVRLAPQKLSVSNEVFVELMK |
| Ga0307472_1019274692 | 3300032205 | Hardwood Forest Soil | LNSRFERLALAGLVKREGSLVRLAPGRVSVSNEVFVELMK |
| Ga0335077_100381991 | 3300033158 | Soil | RRIEKEYGTQIGQRFTAFENAGLVERDGDVVRLAEEKLSVSNEVFVGLMR |
| Ga0335077_105315971 | 3300033158 | Soil | YGVALARRFEPLASAGLVERDGNMVRLAEEKLSVSNEVFVELMK |
| Ga0310914_104974391 | 3300033289 | Soil | SRFERLQQAGLIERSGGVVRLAPERLSVSNEAFVELLR |
| Ga0310914_105336731 | 3300033289 | Soil | LQERFEQLAAAGLVEREGDVVRLAEGRLSVSNEVFVELMK |
| ⦗Top⦘ |