| Basic Information | |
|---|---|
| Family ID | F029160 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 189 |
| Average Sequence Length | 43 residues |
| Representative Sequence | MTPTERPISHKVLLVDDDDAVREMMTVTLEHKGFDVVAATNV |
| Number of Associated Samples | 140 |
| Number of Associated Scaffolds | 189 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 94.00 % |
| % of genes near scaffold ends (potentially truncated) | 71.96 % |
| % of genes from short scaffolds (< 2000 bps) | 67.20 % |
| Associated GOLD sequencing projects | 128 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.43 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (68.254 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (16.931 % of family members) |
| Environment Ontology (ENVO) | Unclassified (30.159 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (51.323 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 20.00% β-sheet: 14.29% Coil/Unstructured: 65.71% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.43 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 189 Family Scaffolds |
|---|---|---|
| PF00072 | Response_reg | 24.34 |
| PF13545 | HTH_Crp_2 | 5.82 |
| PF12779 | WXXGXW | 3.17 |
| PF14361 | RsbRD_N | 2.65 |
| PF00027 | cNMP_binding | 1.06 |
| PF02954 | HTH_8 | 1.06 |
| PF00563 | EAL | 1.06 |
| PF00990 | GGDEF | 0.53 |
| PF13185 | GAF_2 | 0.53 |
| PF02897 | Peptidase_S9_N | 0.53 |
| PF13469 | Sulfotransfer_3 | 0.53 |
| PF00069 | Pkinase | 0.53 |
| PF02518 | HATPase_c | 0.53 |
| PF13487 | HD_5 | 0.53 |
| PF01988 | VIT1 | 0.53 |
| PF04366 | Ysc84 | 0.53 |
| PF00882 | Zn_dep_PLPC | 0.53 |
| PF01068 | DNA_ligase_A_M | 0.53 |
| PF07963 | N_methyl | 0.53 |
| PF08447 | PAS_3 | 0.53 |
| PF04185 | Phosphoesterase | 0.53 |
| PF00326 | Peptidase_S9 | 0.53 |
| PF06745 | ATPase | 0.53 |
| PF00239 | Resolvase | 0.53 |
| PF13692 | Glyco_trans_1_4 | 0.53 |
| PF09699 | Paired_CXXCH_1 | 0.53 |
| PF11941 | DUF3459 | 0.53 |
| PF01566 | Nramp | 0.53 |
| PF05697 | Trigger_N | 0.53 |
| PF13302 | Acetyltransf_3 | 0.53 |
| PF03544 | TonB_C | 0.53 |
| PF13620 | CarboxypepD_reg | 0.53 |
| PF13435 | Cytochrome_C554 | 0.53 |
| PF02621 | VitK2_biosynth | 0.53 |
| PF00383 | dCMP_cyt_deam_1 | 0.53 |
| PF13276 | HTH_21 | 0.53 |
| PF00989 | PAS | 0.53 |
| COG ID | Name | Functional Category | % Frequency in 189 Family Scaffolds |
|---|---|---|---|
| COG0515 | Serine/threonine protein kinase | Signal transduction mechanisms [T] | 2.12 |
| COG5001 | Cyclic di-GMP metabolism protein, combines GGDEF and EAL domains with a 6TM membrane domain | Signal transduction mechanisms [T] | 1.06 |
| COG4943 | Redox-sensing c-di-GMP phosphodiesterase, contains CSS-motif and EAL domains | Signal transduction mechanisms [T] | 1.06 |
| COG3434 | c-di-GMP phosphodiesterase YuxH/PdeH, contains EAL and HDOD domains | Signal transduction mechanisms [T] | 1.06 |
| COG2200 | EAL domain, c-di-GMP-specific phosphodiesterase class I (or its enzymatically inactive variant) | Signal transduction mechanisms [T] | 1.06 |
| COG1814 | Predicted Fe2+/Mn2+ transporter, VIT1/CCC1 family | Inorganic ion transport and metabolism [P] | 0.53 |
| COG3511 | Phospholipase C | Cell wall/membrane/envelope biogenesis [M] | 0.53 |
| COG2930 | Lipid-binding SYLF domain, Ysc84/FYVE family | Lipid transport and metabolism [I] | 0.53 |
| COG2452 | Predicted site-specific integrase-resolvase | Mobilome: prophages, transposons [X] | 0.53 |
| COG1961 | Site-specific DNA recombinase SpoIVCA/DNA invertase PinE | Replication, recombination and repair [L] | 0.53 |
| COG1914 | Mn2+ or Fe2+ transporter, NRAMP family | Inorganic ion transport and metabolism [P] | 0.53 |
| COG1793 | ATP-dependent DNA ligase | Replication, recombination and repair [L] | 0.53 |
| COG1770 | Protease II | Amino acid transport and metabolism [E] | 0.53 |
| COG1633 | Rubrerythrin, includes spore coat protein YhjR | Inorganic ion transport and metabolism [P] | 0.53 |
| COG1505 | Prolyl endopeptidase PreP, S9A serine peptidase family | Amino acid transport and metabolism [E] | 0.53 |
| COG1427 | Chorismate dehydratase (menaquinone biosynthesis, futalosine pathway) | Coenzyme transport and metabolism [H] | 0.53 |
| COG1423 | ATP-dependent RNA circularization protein, DNA/RNA ligase (PAB1020) family | Replication, recombination and repair [L] | 0.53 |
| COG0810 | Periplasmic protein TonB, links inner and outer membranes | Cell wall/membrane/envelope biogenesis [M] | 0.53 |
| COG0544 | FKBP-type peptidyl-prolyl cis-trans isomerase (trigger factor) | Posttranslational modification, protein turnover, chaperones [O] | 0.53 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 68.25 % |
| Unclassified | root | N/A | 31.75 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000789|JGI1027J11758_12729428 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 532 | Open in IMG/M |
| 3300001175|JGI12649J13570_1014041 | All Organisms → cellular organisms → Bacteria | 904 | Open in IMG/M |
| 3300001593|JGI12635J15846_10747918 | Not Available | 562 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_100508867 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1081 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_100613208 | All Organisms → cellular organisms → Bacteria | 965 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_100663410 | Not Available | 921 | Open in IMG/M |
| 3300004156|Ga0062589_100551858 | All Organisms → cellular organisms → Bacteria | 986 | Open in IMG/M |
| 3300005167|Ga0066672_10180782 | All Organisms → cellular organisms → Bacteria | 1336 | Open in IMG/M |
| 3300005458|Ga0070681_10273343 | All Organisms → cellular organisms → Bacteria | 1601 | Open in IMG/M |
| 3300005552|Ga0066701_10024478 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 3054 | Open in IMG/M |
| 3300005552|Ga0066701_10127062 | All Organisms → cellular organisms → Bacteria | 1515 | Open in IMG/M |
| 3300005591|Ga0070761_10747447 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 614 | Open in IMG/M |
| 3300005602|Ga0070762_10031346 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2844 | Open in IMG/M |
| 3300005602|Ga0070762_10226014 | All Organisms → cellular organisms → Bacteria | 1154 | Open in IMG/M |
| 3300005844|Ga0068862_102740348 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 504 | Open in IMG/M |
| 3300006052|Ga0075029_100557227 | All Organisms → cellular organisms → Bacteria | 762 | Open in IMG/M |
| 3300006162|Ga0075030_100570961 | All Organisms → cellular organisms → Bacteria | 898 | Open in IMG/M |
| 3300006893|Ga0073928_10266350 | All Organisms → cellular organisms → Bacteria | 1303 | Open in IMG/M |
| 3300006914|Ga0075436_101308840 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → Methylocystis → unclassified Methylocystis → Methylocystis sp. SC2 | 548 | Open in IMG/M |
| 3300007982|Ga0102924_1143090 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1117 | Open in IMG/M |
| 3300007982|Ga0102924_1261539 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 708 | Open in IMG/M |
| 3300009090|Ga0099827_11387084 | Not Available | 612 | Open in IMG/M |
| 3300009520|Ga0116214_1419207 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 524 | Open in IMG/M |
| 3300009624|Ga0116105_1130612 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 652 | Open in IMG/M |
| 3300009635|Ga0116117_1077678 | Not Available | 823 | Open in IMG/M |
| 3300009645|Ga0116106_1065140 | All Organisms → cellular organisms → Bacteria | 1201 | Open in IMG/M |
| 3300009759|Ga0116101_1090877 | All Organisms → cellular organisms → Bacteria | 701 | Open in IMG/M |
| 3300009760|Ga0116131_1070991 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1081 | Open in IMG/M |
| 3300009764|Ga0116134_1051628 | All Organisms → cellular organisms → Bacteria | 1570 | Open in IMG/M |
| 3300009824|Ga0116219_10024767 | All Organisms → cellular organisms → Bacteria | 3659 | Open in IMG/M |
| 3300009824|Ga0116219_10305809 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 896 | Open in IMG/M |
| 3300011120|Ga0150983_10156933 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 601 | Open in IMG/M |
| 3300011120|Ga0150983_12276256 | All Organisms → cellular organisms → Bacteria | 1160 | Open in IMG/M |
| 3300011120|Ga0150983_13311668 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 765 | Open in IMG/M |
| 3300011411|Ga0153933_1048318 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 934 | Open in IMG/M |
| 3300012203|Ga0137399_10406273 | Not Available | 1136 | Open in IMG/M |
| 3300012211|Ga0137377_11877973 | Not Available | 517 | Open in IMG/M |
| 3300013102|Ga0157371_11111251 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 606 | Open in IMG/M |
| 3300013308|Ga0157375_13701239 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 508 | Open in IMG/M |
| 3300014160|Ga0181517_10382975 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 724 | Open in IMG/M |
| 3300014200|Ga0181526_10040075 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3003 | Open in IMG/M |
| 3300014489|Ga0182018_10006065 | All Organisms → cellular organisms → Bacteria | 9526 | Open in IMG/M |
| 3300014491|Ga0182014_10341527 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 758 | Open in IMG/M |
| 3300014501|Ga0182024_10089749 | All Organisms → cellular organisms → Bacteria | 4529 | Open in IMG/M |
| 3300014501|Ga0182024_11104630 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → unclassified Terriglobales → Terriglobales bacterium | 936 | Open in IMG/M |
| 3300014638|Ga0181536_10397930 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 616 | Open in IMG/M |
| 3300014745|Ga0157377_11033740 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 625 | Open in IMG/M |
| 3300017931|Ga0187877_1332823 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 578 | Open in IMG/M |
| 3300017941|Ga0187850_10119273 | All Organisms → cellular organisms → Bacteria | 1262 | Open in IMG/M |
| 3300017946|Ga0187879_10035285 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 3003 | Open in IMG/M |
| 3300017946|Ga0187879_10063427 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2154 | Open in IMG/M |
| 3300017948|Ga0187847_10000511 | All Organisms → cellular organisms → Bacteria | 42629 | Open in IMG/M |
| 3300018007|Ga0187805_10277742 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 769 | Open in IMG/M |
| 3300018009|Ga0187884_10300049 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 649 | Open in IMG/M |
| 3300018021|Ga0187882_1135261 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1014 | Open in IMG/M |
| 3300018021|Ga0187882_1358676 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 555 | Open in IMG/M |
| 3300018033|Ga0187867_10636033 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 583 | Open in IMG/M |
| 3300018037|Ga0187883_10177834 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1092 | Open in IMG/M |
| 3300018038|Ga0187855_10623904 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 628 | Open in IMG/M |
| 3300018038|Ga0187855_10776065 | Not Available | 559 | Open in IMG/M |
| 3300018040|Ga0187862_10638057 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 627 | Open in IMG/M |
| 3300018040|Ga0187862_10824080 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 536 | Open in IMG/M |
| 3300018044|Ga0187890_10361356 | All Organisms → cellular organisms → Bacteria | 814 | Open in IMG/M |
| 3300018047|Ga0187859_10308874 | All Organisms → cellular organisms → Bacteria | 857 | Open in IMG/M |
| 3300018057|Ga0187858_10027712 | All Organisms → cellular organisms → Bacteria | 4314 | Open in IMG/M |
| 3300018468|Ga0066662_12881774 | Not Available | 511 | Open in IMG/M |
| 3300019786|Ga0182025_1020160 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1821 | Open in IMG/M |
| 3300020579|Ga0210407_10008551 | All Organisms → cellular organisms → Bacteria | 7678 | Open in IMG/M |
| 3300020579|Ga0210407_10039030 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3532 | Open in IMG/M |
| 3300020579|Ga0210407_10320102 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | 1212 | Open in IMG/M |
| 3300020580|Ga0210403_10295854 | All Organisms → cellular organisms → Bacteria | 1326 | Open in IMG/M |
| 3300020581|Ga0210399_10499016 | All Organisms → cellular organisms → Bacteria | 1012 | Open in IMG/M |
| 3300020582|Ga0210395_11088172 | All Organisms → cellular organisms → Bacteria | 590 | Open in IMG/M |
| 3300021088|Ga0210404_10006754 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 4627 | Open in IMG/M |
| 3300021171|Ga0210405_10116102 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2114 | Open in IMG/M |
| 3300021180|Ga0210396_11688161 | Not Available | 515 | Open in IMG/M |
| 3300021181|Ga0210388_10142188 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 2080 | Open in IMG/M |
| 3300021181|Ga0210388_10887388 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 769 | Open in IMG/M |
| 3300021181|Ga0210388_11817606 | Not Available | 502 | Open in IMG/M |
| 3300021407|Ga0210383_11167380 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 648 | Open in IMG/M |
| 3300021407|Ga0210383_11738288 | Not Available | 510 | Open in IMG/M |
| 3300021433|Ga0210391_10009622 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 7852 | Open in IMG/M |
| 3300021433|Ga0210391_10665902 | All Organisms → cellular organisms → Bacteria | 816 | Open in IMG/M |
| 3300021474|Ga0210390_10415144 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1137 | Open in IMG/M |
| 3300021474|Ga0210390_10561341 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 959 | Open in IMG/M |
| 3300021479|Ga0210410_10087351 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2744 | Open in IMG/M |
| 3300021479|Ga0210410_10539499 | All Organisms → cellular organisms → Bacteria | 1040 | Open in IMG/M |
| 3300022557|Ga0212123_10199740 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1484 | Open in IMG/M |
| 3300022840|Ga0224549_1042906 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 614 | Open in IMG/M |
| 3300023068|Ga0224554_1089615 | All Organisms → cellular organisms → Bacteria | 723 | Open in IMG/M |
| 3300023259|Ga0224551_1045882 | Not Available | 760 | Open in IMG/M |
| 3300025404|Ga0208936_1051657 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 559 | Open in IMG/M |
| 3300025473|Ga0208190_1012435 | All Organisms → cellular organisms → Bacteria | 2110 | Open in IMG/M |
| 3300025477|Ga0208192_1103066 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 511 | Open in IMG/M |
| 3300025912|Ga0207707_10295282 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1402 | Open in IMG/M |
| 3300025928|Ga0207700_11345578 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 636 | Open in IMG/M |
| 3300026214|Ga0209838_1027231 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 807 | Open in IMG/M |
| 3300026294|Ga0209839_10065629 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1284 | Open in IMG/M |
| 3300026490|Ga0257153_1001975 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 3864 | Open in IMG/M |
| 3300027297|Ga0208241_1010209 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1311 | Open in IMG/M |
| 3300027497|Ga0208199_1128296 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 517 | Open in IMG/M |
| 3300027545|Ga0209008_1052391 | Not Available | 929 | Open in IMG/M |
| 3300027604|Ga0208324_1219151 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 500 | Open in IMG/M |
| 3300027641|Ga0208827_1209119 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | 515 | Open in IMG/M |
| 3300027652|Ga0209007_1009959 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2517 | Open in IMG/M |
| 3300027660|Ga0209736_1110099 | Not Available | 745 | Open in IMG/M |
| 3300027660|Ga0209736_1145875 | Not Available | 630 | Open in IMG/M |
| 3300027678|Ga0209011_1112318 | All Organisms → cellular organisms → Bacteria | 785 | Open in IMG/M |
| 3300027727|Ga0209328_10208875 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 588 | Open in IMG/M |
| 3300027853|Ga0209274_10044995 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2083 | Open in IMG/M |
| 3300027853|Ga0209274_10082254 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1569 | Open in IMG/M |
| 3300027853|Ga0209274_10389069 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 720 | Open in IMG/M |
| 3300027867|Ga0209167_10173245 | All Organisms → cellular organisms → Bacteria | 1141 | Open in IMG/M |
| 3300027879|Ga0209169_10130289 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1307 | Open in IMG/M |
| 3300027884|Ga0209275_10671687 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 596 | Open in IMG/M |
| 3300027911|Ga0209698_11198665 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | 559 | Open in IMG/M |
| 3300027911|Ga0209698_11358090 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 519 | Open in IMG/M |
| 3300028017|Ga0265356_1017186 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 783 | Open in IMG/M |
| 3300030053|Ga0302177_10158474 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | 1270 | Open in IMG/M |
| 3300030058|Ga0302179_10037027 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | 2246 | Open in IMG/M |
| 3300030399|Ga0311353_11505044 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 545 | Open in IMG/M |
| 3300030494|Ga0310037_10257643 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 755 | Open in IMG/M |
| 3300030503|Ga0311370_12129518 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 554 | Open in IMG/M |
| 3300030760|Ga0265762_1033001 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 989 | Open in IMG/M |
| 3300030862|Ga0265753_1002892 | All Organisms → cellular organisms → Bacteria | 1723 | Open in IMG/M |
| 3300031090|Ga0265760_10065073 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1112 | Open in IMG/M |
| 3300031231|Ga0170824_118001463 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1378 | Open in IMG/M |
| 3300031232|Ga0302323_102567317 | Not Available | 582 | Open in IMG/M |
| 3300031236|Ga0302324_102587764 | Not Available | 617 | Open in IMG/M |
| 3300031240|Ga0265320_10163494 | All Organisms → cellular organisms → Bacteria | 1002 | Open in IMG/M |
| 3300031469|Ga0170819_15018030 | Not Available | 502 | Open in IMG/M |
| 3300031474|Ga0170818_108062968 | Not Available | 664 | Open in IMG/M |
| 3300031525|Ga0302326_10618078 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1606 | Open in IMG/M |
| 3300031708|Ga0310686_115364529 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 784 | Open in IMG/M |
| 3300031715|Ga0307476_10489450 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 911 | Open in IMG/M |
| 3300031716|Ga0310813_11136021 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 717 | Open in IMG/M |
| 3300031718|Ga0307474_10113063 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Granulicella → unclassified Granulicella → Granulicella sp. GAS466 | 2035 | Open in IMG/M |
| 3300031718|Ga0307474_10522428 | All Organisms → cellular organisms → Bacteria | 932 | Open in IMG/M |
| 3300031718|Ga0307474_11143031 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 616 | Open in IMG/M |
| 3300031753|Ga0307477_10483831 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 842 | Open in IMG/M |
| 3300031754|Ga0307475_10131985 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1974 | Open in IMG/M |
| 3300031754|Ga0307475_10728033 | All Organisms → cellular organisms → Bacteria | 790 | Open in IMG/M |
| 3300031754|Ga0307475_11313247 | Not Available | 560 | Open in IMG/M |
| 3300031817|Ga0316046_106009 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 677 | Open in IMG/M |
| 3300031823|Ga0307478_11074453 | All Organisms → cellular organisms → Bacteria | 672 | Open in IMG/M |
| 3300032160|Ga0311301_12127509 | All Organisms → cellular organisms → Bacteria | 648 | Open in IMG/M |
| 3300032180|Ga0307471_103485189 | Not Available | 557 | Open in IMG/M |
| 3300032756|Ga0315742_11098843 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 802 | Open in IMG/M |
| 3300033829|Ga0334854_104618 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 679 | Open in IMG/M |
| 3300034125|Ga0370484_0221286 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 521 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 16.93% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 12.17% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 9.52% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 9.52% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 5.82% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 5.29% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 4.23% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.70% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 3.70% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 2.65% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 2.12% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 2.12% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 2.12% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 2.12% |
| Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 2.12% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 2.12% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 1.59% |
| Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost | 1.59% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 1.06% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 1.06% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.06% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.53% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.53% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.53% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.53% |
| Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 0.53% |
| Bog | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Bog | 0.53% |
| Palsa | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa | 0.53% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 0.53% |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 0.53% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 0.53% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.53% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.53% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.53% |
| Attine Ant Fungus Gardens | Host-Associated → Fungi → Mycelium → Unclassified → Unclassified → Attine Ant Fungus Gardens | 0.53% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000789 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300001175 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_O3 | Environmental | Open in IMG/M |
| 3300001593 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 | Environmental | Open in IMG/M |
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300004156 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1 | Environmental | Open in IMG/M |
| 3300005167 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 | Environmental | Open in IMG/M |
| 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Environmental | Open in IMG/M |
| 3300005552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 | Environmental | Open in IMG/M |
| 3300005591 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 | Environmental | Open in IMG/M |
| 3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
| 3300005610 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 | Environmental | Open in IMG/M |
| 3300005712 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 | Environmental | Open in IMG/M |
| 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Host-Associated | Open in IMG/M |
| 3300006052 | Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013 | Environmental | Open in IMG/M |
| 3300006162 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006893 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG | Environmental | Open in IMG/M |
| 3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
| 3300007982 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPM 11 metaG | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009520 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_1_NS metaG | Environmental | Open in IMG/M |
| 3300009624 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_10 | Environmental | Open in IMG/M |
| 3300009635 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_10 | Environmental | Open in IMG/M |
| 3300009645 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_40 | Environmental | Open in IMG/M |
| 3300009759 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_4_10 | Environmental | Open in IMG/M |
| 3300009760 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_17_100 | Environmental | Open in IMG/M |
| 3300009764 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_19_40 | Environmental | Open in IMG/M |
| 3300009824 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaG | Environmental | Open in IMG/M |
| 3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
| 3300011411 | Attine ant fungus gardens microbial communities from New Jersey, USA - TSNJ017 MetaG | Host-Associated | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Host-Associated | Open in IMG/M |
| 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014160 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin01_30_metaG | Environmental | Open in IMG/M |
| 3300014169 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_10_metaG | Environmental | Open in IMG/M |
| 3300014200 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_30_metaG | Environmental | Open in IMG/M |
| 3300014489 | Permafrost microbial communities from Stordalen Mire, Sweden - 812P2M metaG | Environmental | Open in IMG/M |
| 3300014491 | Permafrost microbial communities from Stordalen Mire, Sweden - 612S2D metaG | Environmental | Open in IMG/M |
| 3300014501 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300014638 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_60_metaG | Environmental | Open in IMG/M |
| 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Host-Associated | Open in IMG/M |
| 3300017931 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_100 | Environmental | Open in IMG/M |
| 3300017941 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_150 | Environmental | Open in IMG/M |
| 3300017946 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_10 | Environmental | Open in IMG/M |
| 3300017948 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_10 | Environmental | Open in IMG/M |
| 3300017996 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_21_40 | Environmental | Open in IMG/M |
| 3300018007 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_5 | Environmental | Open in IMG/M |
| 3300018009 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_40 | Environmental | Open in IMG/M |
| 3300018021 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_150 | Environmental | Open in IMG/M |
| 3300018022 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_40 | Environmental | Open in IMG/M |
| 3300018024 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_100 | Environmental | Open in IMG/M |
| 3300018033 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_10 | Environmental | Open in IMG/M |
| 3300018037 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_10 | Environmental | Open in IMG/M |
| 3300018038 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_10 | Environmental | Open in IMG/M |
| 3300018040 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_150 | Environmental | Open in IMG/M |
| 3300018044 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_21_10 | Environmental | Open in IMG/M |
| 3300018047 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_10 | Environmental | Open in IMG/M |
| 3300018057 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_150 | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300019786 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (PacBio error correction) | Environmental | Open in IMG/M |
| 3300019887 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1c2 | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
| 3300021088 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M | Environmental | Open in IMG/M |
| 3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
| 3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
| 3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
| 3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
| 3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
| 3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
| 3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
| 3300022557 | Paint Pots_combined assembly | Environmental | Open in IMG/M |
| 3300022840 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 P3 1-5 | Environmental | Open in IMG/M |
| 3300023068 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 S2 20-24 | Environmental | Open in IMG/M |
| 3300023259 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 P3 20-24 | Environmental | Open in IMG/M |
| 3300025404 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_10_10 (SPAdes) | Environmental | Open in IMG/M |
| 3300025473 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_10 (SPAdes) | Environmental | Open in IMG/M |
| 3300025477 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_150 (SPAdes) | Environmental | Open in IMG/M |
| 3300025498 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_150 (SPAdes) | Environmental | Open in IMG/M |
| 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026214 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 2 DNA2013-047 (SPAdes) | Environmental | Open in IMG/M |
| 3300026294 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-050 (SPAdes) | Environmental | Open in IMG/M |
| 3300026490 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-10-A | Environmental | Open in IMG/M |
| 3300027297 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF047 (SPAdes) | Environmental | Open in IMG/M |
| 3300027497 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_1_NS metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027545 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027604 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_5_LS metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027641 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_8_FC metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027652 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027660 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027678 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027727 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027853 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027867 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027879 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 (SPAdes) | Environmental | Open in IMG/M |
| 3300027884 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027889 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes) | Environmental | Open in IMG/M |
| 3300027908 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027911 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300028017 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 | Host-Associated | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300029636 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300029943 | I_Palsa_N3 coassembly | Environmental | Open in IMG/M |
| 3300029986 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_E2_1 | Environmental | Open in IMG/M |
| 3300030053 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E1_2 | Environmental | Open in IMG/M |
| 3300030058 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E3_1 | Environmental | Open in IMG/M |
| 3300030399 | II_Palsa_E2 coassembly | Environmental | Open in IMG/M |
| 3300030494 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG (v2) | Environmental | Open in IMG/M |
| 3300030503 | III_Palsa_E3 coassembly | Environmental | Open in IMG/M |
| 3300030760 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030862 | Metatranscriptome of soil microbial communities from Maridalen valley, Oslo, Norway - NSE5 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031232 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_3 | Environmental | Open in IMG/M |
| 3300031236 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1 | Environmental | Open in IMG/M |
| 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Host-Associated | Open in IMG/M |
| 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Host-Associated | Open in IMG/M |
| 3300031469 | Fir Spring Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031474 | Fir Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031525 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_3 | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Host-Associated | Open in IMG/M |
| 3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
| 3300031716 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3 | Environmental | Open in IMG/M |
| 3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
| 3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031817 | Metatranscriptome of spruce litter microbial communities from Bohemian Forest, Czech Republic - CLU5 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
| 3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032756 | Forest Soil Metatranscriptomics Site 2 Humus Litter Mineral Combined Assembly | Environmental | Open in IMG/M |
| 3300033829 | Peat soil microbial communities from Stordalen Mire, Sweden - 715 P2 1-5 | Environmental | Open in IMG/M |
| 3300034125 | Peat soil microbial communities from wetlands in Alaska, United States - Sheep_creek_tus_01_15 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI1027J11758_127294282 | 3300000789 | Soil | MSPTEPPVAHKVLLVDDDDAVCAMMNATLERKGFDVVAAASV |
| JGI12649J13570_10140411 | 3300001175 | Forest Soil | MIPTEHPITHKVLLVDDDDAVRTMMTLTLEHKGFEVVSAPN |
| JGI12635J15846_107479182 | 3300001593 | Forest Soil | MTPTEQPVAHRVLLVDDDNAVLAMMTATLTHKGFD |
| JGIcombinedJ26739_1005088672 | 3300002245 | Forest Soil | MPYPPVVHKILLVDDDDSVRAMMSATLEKKGFEVIAAANVTEALKLI |
| JGIcombinedJ26739_1006132081 | 3300002245 | Forest Soil | MTPTEWPVFHRALLVDDDEAVRSMMNATLERKVFE |
| JGIcombinedJ26739_1006634102 | 3300002245 | Forest Soil | MTPTGKSVVHRVLLVDDDEAVRAMMNVGVERGEALAMK |
| Ga0062589_1005518581 | 3300004156 | Soil | MTVPERPAAHRVLLVDDDDAVRSMMNLTLESKGFDVVAAASVTEALRR |
| Ga0066672_101807823 | 3300005167 | Soil | MAPNEQRFAHRVLLVDDDDAVRAMMNATFERKGFDVVAAASVTEALR |
| Ga0070681_102733432 | 3300005458 | Corn Rhizosphere | MIPSTLHKVLLVDDDSAVRNMMELTLEYKGFKVVSAANVTE |
| Ga0066701_100244785 | 3300005552 | Soil | MASNEQRFAHRVLLVDDDAAVRAMVNQGLERQGFEVVAAASV |
| Ga0066701_101270623 | 3300005552 | Soil | MAPNEQRFAHRVLLVDDDAAVRAMVNQGLERQGFEVVAAASV |
| Ga0070761_100683562 | 3300005591 | Soil | MTQAQTSVSQRVLLVDDDEAVRSMMTATLEHKGVKVVPAASFSGSTLRG* |
| Ga0070761_101348613 | 3300005591 | Soil | VTQTKTSVSHRVLLVDDDEAVRSMMTATLEHKGFEVVPAASVTE |
| Ga0070761_107474472 | 3300005591 | Soil | MVPTEQRSAHKVLLVDDDDAVRNMMTATLLHKGFGVVSAANVTEALKL |
| Ga0070762_100313461 | 3300005602 | Soil | MTQTQTGVSHRVLLVDDDEGVRDVMRETLQAKGVDVVPAGNVREAMATLQ* |
| Ga0070762_102260141 | 3300005602 | Soil | MTPTEPLIAHKVLLVDDDDAVRTMMTLTLEHKGFGVV |
| Ga0070763_107083912 | 3300005610 | Soil | MTQTKTSISHRVLLVDDDEAVRDMMSTTLEHKGFE |
| Ga0070764_109784272 | 3300005712 | Soil | MAQTETSASHRVLLVDDDEAIRTMMTLTLEQKGFEVVAAAN |
| Ga0068862_1027403482 | 3300005844 | Switchgrass Rhizosphere | MALAEGSTSHKVLLVDDDAAVRDMMTATLQHKGFKVVSAANVTEAL |
| Ga0075029_1005572271 | 3300006052 | Watersheds | MTPTEPRVAHRVLLVDDDGAVRAMMKEGLARKGFEV |
| Ga0075030_1005709612 | 3300006162 | Watersheds | MTTTERSAAHKGLLVDDDDAVRDMMSMTLERKGFDVVAAAS |
| Ga0070765_1010103832 | 3300006176 | Soil | MTAMAQTGTSASHRVLLVDDDEAIRTMMTLTLEHKGF |
| Ga0073928_102663502 | 3300006893 | Iron-Sulfur Acid Spring | MTLAERPISHKVLLVDDDDAIREMMTATLAHKGFAVV |
| Ga0075436_1013088401 | 3300006914 | Populus Rhizosphere | MDPISPSAHHTVLLVDDDTAVRDMMALTLEHKGFKVISAANV |
| Ga0102924_11430902 | 3300007982 | Iron-Sulfur Acid Spring | MTPAEHSISHKVLLVDDDDAVCEMMTGTLEHTGFGVVAAVNVTGALKRI* |
| Ga0102924_12615391 | 3300007982 | Iron-Sulfur Acid Spring | MTPPERPIVYRVLLVDDDDAVRDIMTATLEHKGFG |
| Ga0099827_113870841 | 3300009090 | Vadose Zone Soil | MAPNERRFAHRVLLVDDDAAVRAMVNKGLERQGFEVVAAASVTEAL |
| Ga0116214_14192071 | 3300009520 | Peatlands Soil | MTPTDPPVAHKVLVVDDDDGVRAMMTATLKHKGFDVVAAASVTE |
| Ga0116105_11306122 | 3300009624 | Peatland | MTPTERRTAHKVLLVDDDDAVRDMMTLTLEHKGFEVVSAANVT |
| Ga0116117_10776782 | 3300009635 | Peatland | MTTPEKSVAYKTLLVDDDNAVRQVMTAVLERKGFEVIAVA |
| Ga0116106_10651402 | 3300009645 | Peatland | MTPTEPPAAHKVLLVDDDDAVRAMMSATLERKGFDVVTA |
| Ga0116101_10908771 | 3300009759 | Peatland | MCDMTPLENPVTHRVLLVDDDDGVRSMMTQTLEYRGFSVVAASSVGEA |
| Ga0116131_10709911 | 3300009760 | Peatland | MTQTTRPVALKVLLVDDDDAVRGMMNMTLERKGFDGT* |
| Ga0116131_11714812 | 3300009760 | Peatland | MTQTKTSVSHRVLLVDDDEAVRAMMTATLTRKGFDVVPAANVTEALK |
| Ga0116134_10516281 | 3300009764 | Peatland | MVPSERPIVYKVLLVDDDGAVRDMMTATFEHKGFGVVAVA |
| Ga0116219_100247671 | 3300009824 | Peatlands Soil | MAPTEQPVAYRVLLVDDDDGVRAMMTATLEHKGFDAVAAASVTEA |
| Ga0116219_103058092 | 3300009824 | Peatlands Soil | MTPTEPPVAHKVLLVDDDDAVRGMMTMTLEHQGLEV |
| Ga0150983_101569331 | 3300011120 | Forest Soil | QTKTSVSHRVLLVDDDEAVRDVMSATLEGKGFDVVSAASVTTPS* |
| Ga0150983_122762561 | 3300011120 | Forest Soil | MTPIEPGAAHRVLLVDDDGAVRAMMNEALRRKGFDVVTA |
| Ga0150983_133116681 | 3300011120 | Forest Soil | MTPAEHSISHKVLLVDDDDAVREMMTVTLERKGFAVVAAANVTE |
| Ga0153933_10483181 | 3300011411 | Attine Ant Fungus Gardens | MTPTESTVSHIHRVLLVDDDDAVRTMMNATLERKGFEVVPAANVTEALR |
| Ga0137399_104062731 | 3300012203 | Vadose Zone Soil | MSSTGSPIVHKVLLVDDDDDVRAMMKATLERKGFDVVLAASVAEAL |
| Ga0137377_118779731 | 3300012211 | Vadose Zone Soil | MASNEQRFAHRVLLVDDDAAVRAMVNQGLERQGFEV |
| Ga0157371_111112511 | 3300013102 | Corn Rhizosphere | MTVPERPAAHRVLLVDDDDAVRSMMNLTLESKGFDVV |
| Ga0157375_137012391 | 3300013308 | Miscanthus Rhizosphere | MTVPERPAAHRVLLVDDDDAVRSMMNSTLESKGFD |
| Ga0181517_103829751 | 3300014160 | Bog | MTSLEKPTAHKVLLVDGDNAVREMMTATLEHKGFEV |
| Ga0181531_109439171 | 3300014169 | Bog | MTQIETSASHRVLLVDDDEAIRTMMTLTLVHKGFEVVA |
| Ga0181526_100400755 | 3300014200 | Bog | MTPAESRVAHKVLLVDDNDAVRTMMSLTLEHKGFEV |
| Ga0182018_100060653 | 3300014489 | Palsa | MIPTERPIPHKVLLVDDDDAVCHMMTATLARKGFG* |
| Ga0182014_103415271 | 3300014491 | Bog | MSLTEPPTSHKVLLVDDDAGIREMMTATLEQKGFDVVAAANVTEALKL |
| Ga0182024_100897494 | 3300014501 | Permafrost | MALAERPISHKVLLVEDDDAIREMMTVTLAHKGST* |
| Ga0182024_111046302 | 3300014501 | Permafrost | MTPTEPGAARRVLLVDDDDAVRAMMSEGLQRKGFEVTTAA |
| Ga0181536_103979302 | 3300014638 | Bog | MTPTEVPVAHRVLLVDDDHAVRAMMSATLERKGFDVVAV |
| Ga0157377_110337401 | 3300014745 | Miscanthus Rhizosphere | MTPAEQPVAHRVLLVDDDDAVRTMMNVTLERKGFDVVVAASVTE |
| Ga0187877_13328231 | 3300017931 | Peatland | MTPTEPRIAHKVLLVDDDDGVRDMMTATLENKGFEP |
| Ga0187850_101192732 | 3300017941 | Peatland | MMPTERAVSPRVLLVDDDDGVRAMMTATLEHKGFEV |
| Ga0187879_100352856 | 3300017946 | Peatland | MTLLEKPIAHRVLLVDDDEAVRSMMSVTLERKGFDVVSAVNVPEALK |
| Ga0187879_100634274 | 3300017946 | Peatland | MTLLEKPVAHRVLLVDDDEAVRSMMSVTLERKGFDVVSAVNVPEAL |
| Ga0187847_1000051136 | 3300017948 | Peatland | MTQTNTSVSHRVLLVDDDDGVRDMMTATLENKGFEP |
| Ga0187847_102465762 | 3300017948 | Peatland | MTQTRTSVSHKVLLVDDDAAVRDMMSRTLKGKGFDVVSAASVV |
| Ga0187891_12711982 | 3300017996 | Peatland | MKFSDRRCCVSPTEVPVAHRVLLVDDDHAVRAMMNETLERKGFEVVAAASVTE |
| Ga0187805_102777423 | 3300018007 | Freshwater Sediment | MAPNEPPVAHNVLLVDDDDAVRAMMCATLEHKGFEVV |
| Ga0187884_103000492 | 3300018009 | Peatland | MTSIGQPVAHRVLLVDDDHAVRAMMNATLERKGFDVVAAASVTEALRHISTESF |
| Ga0187882_11352612 | 3300018021 | Peatland | MTPTERPISHKVLLVDDDDAVREMMTVTLEHKGFDVVAATNV |
| Ga0187882_13586761 | 3300018021 | Peatland | MMPTERAVSPRVLLVDDDDGVRAMMTATLEHKGFEVAA |
| Ga0187864_103005451 | 3300018022 | Peatland | MTQTKTSHSHRVLLVDDDDAVRDMMTETLKVKGFEVVPVACVTAALKFIATE |
| Ga0187881_101871452 | 3300018024 | Peatland | VTQTKTSVSHRVLLVDDDEAVRAMMSTTLERKGFEVIPACNVTEALKL |
| Ga0187867_106360332 | 3300018033 | Peatland | MTPIEPSVAHKVLLVDDDDAVRAMMDATLQHKGYKVVAAASV |
| Ga0187883_101778341 | 3300018037 | Peatland | MTLLEKPIAHRVLLVDDDAAVRSMMSVTLERKGFDVVSAVNVPEALKLITTESF |
| Ga0187855_106239042 | 3300018038 | Peatland | MTSQEKPIPSKVLLVDDDDAVREMMTQTLQHKGFEV |
| Ga0187855_107760651 | 3300018038 | Peatland | MASTEQPVSPRVLLVDDDHGVRAMMNAMLEHKGFEVVAAANVTDALRHIATE |
| Ga0187862_106380571 | 3300018040 | Peatland | MTPTEPRIAHKVLLVDDDDAVRQMMTATLEHKGFR |
| Ga0187862_108240802 | 3300018040 | Peatland | MTPTERRIAHKVLLVDDDDAIRTMMSLTLEHKGFEVVSAANV |
| Ga0187890_103613561 | 3300018044 | Peatland | MMPTERAVSPRVLLVDDDDGVRDMMTATLEHKGFEV |
| Ga0187859_101383703 | 3300018047 | Peatland | MAPTERTSTSHRVLLVDDDDAVRDMMTRTLKQKGFEVVTATN |
| Ga0187859_102647521 | 3300018047 | Peatland | MTEARTSVSHRVLQVDNDEAVRTVMRAMLGRKGFDVIPAARVMESLKPITAESFC |
| Ga0187859_103088742 | 3300018047 | Peatland | MMPTERAVSPRVLLVDDDDGVRAMMTATLEHKGFEVAAAANVT |
| Ga0187858_100277121 | 3300018057 | Peatland | MTLLEKPIAHRVLLVDDDEAVRSMMSVTLERKGFDV |
| Ga0066662_128817742 | 3300018468 | Grasslands Soil | MAPNEQRFAHRVLLVDDDAAVRAMVNQGLERQGFEVVAAA |
| Ga0182025_10201602 | 3300019786 | Permafrost | MIPTERPIPHKVLLVDDDDAVCHMMTATLARKGFG |
| Ga0193729_12252021 | 3300019887 | Soil | MTQTRTSASHKVLLVDDDDAVREMMSAMLQAKGFAVTLAASVT |
| Ga0210407_1000855111 | 3300020579 | Soil | MTQTQTGVSHRVLLVDDDEGVRDVMRETLQAKGVDVVPAGNVREAMATLQ |
| Ga0210407_100390305 | 3300020579 | Soil | MTPTEPPIAHKVLLVDDDDAVRTMMTLTLEHKGFGVVSAANVTQA |
| Ga0210407_103201023 | 3300020579 | Soil | MTATERPVVSHKVLLVDDDEAVRNMMTATLERKGFGVVAVANVTEALKL |
| Ga0210403_102958542 | 3300020580 | Soil | MTLAERPISHKVLLVDDDDAIREMMTASLAHKGFDVITAANVTEALKLITT |
| Ga0210403_106631991 | 3300020580 | Soil | MTPIKTGTSHRVLLVDDDESVREMMSLTLEKKGFEVVP |
| Ga0210403_109034132 | 3300020580 | Soil | MTQTKTSDSHRVLLVDDDEAVRTMMTATLERKGFDVIPAAGVVEALKLIM |
| Ga0210399_104990161 | 3300020581 | Soil | MTLAERPISHKVLLVDDDDAIREMMTATLAHKGFDVVSAAN |
| Ga0210395_101680461 | 3300020582 | Soil | MTQTKTSISHRVLLVDDDEAVRSMMTATLEHKGFEVVPAASVTEALKL |
| Ga0210395_110881722 | 3300020582 | Soil | MSLTETGAAHRVLLVDDDDAVRAMMNATLEDKGFDVVV |
| Ga0210404_100067542 | 3300021088 | Soil | MSPAGRPVAHRVPLVDDDNGVRAMMNATLERKGFEVVAAASVAEALRSLLRASTS |
| Ga0210405_101161024 | 3300021171 | Soil | MTPTEPLIAHKVLLVDDDDAVREMMTVTLEHKGFAVVAAANVTETLKLIT |
| Ga0210396_116881611 | 3300021180 | Soil | MSPAGRPVAHRVPLVDDDNGVRVMMNATLERKGFEVVAAASVTEALRSLLRAS |
| Ga0210388_101421883 | 3300021181 | Soil | MAPTEQPVLHRVLLVDDVDDDDGVRAMVYATLEPRGFDVVAPASVTEALRHIATQSLDG |
| Ga0210388_108873881 | 3300021181 | Soil | MTPTEPRVSHKVLLVDDDEAIREMMTATLAHKGFDVVAAA |
| Ga0210388_110354701 | 3300021181 | Soil | MTQAQTSVSQRVLLVDDDEAVRSMMTATLEHKGVKVVPAASFSGSTLRG |
| Ga0210388_118176061 | 3300021181 | Soil | MTPTEPPVTPRVLLVDDDDGVRAMMSESLEGKGFAVVAAANVT |
| Ga0210393_102198081 | 3300021401 | Soil | MNPTKTSATHRVLLVDDDEAVREVMTLTLAAKGFD |
| Ga0210393_108999702 | 3300021401 | Soil | MTQTRTSVSHKVLLVDDDEAVRDMMSRTLVGKGFDVV |
| Ga0210383_111673801 | 3300021407 | Soil | MTPTEPRIAHKVLLVDDDDAIRRMMSLTLEHKGFEVVSAVNVTEALKL |
| Ga0210383_117382882 | 3300021407 | Soil | MLPQETPHKVLLVDDDEAIRELTKAQLVRKGFEVVTAGCVTEALQLIAT |
| Ga0210394_100286072 | 3300021420 | Soil | MTQAQTSVFQRVLLVDDDEAVRSMMTATLEHKGFKVVPAASFSGSTLRG |
| Ga0210391_100096229 | 3300021433 | Soil | MTPTEKSVVHRVLLVDDDEAVRTMMNATLERKGFDVVNAASV |
| Ga0210391_106659022 | 3300021433 | Soil | MTLAERPVSHRVLLVDDDDALREMMTATLAQKGFEVVAAANVTQA |
| Ga0210390_103688412 | 3300021474 | Soil | MIQTETVASHRVLLVDDDEVIRTMMTLTLVHKGFEVVA |
| Ga0210390_104151441 | 3300021474 | Soil | MTQTKTSSSHRVLLVDDDEDIRAVMSATLDRKGFDVIAAGSVTEALKLITTASF |
| Ga0210390_105613411 | 3300021474 | Soil | MTPTEPPISHKVLLVDDDDAVRDMMTTTLERKGFEVVSAANVTEALKLITTESF |
| Ga0210390_106795751 | 3300021474 | Soil | MTQTRTSVSHRVLLVDDDEAVRDMMSRTLVGKGFDVVAAASV |
| Ga0210410_100873514 | 3300021479 | Soil | MTPTEQAVLHRVLLVDDDDAVRTMMNVTLERKGFEVVAASNVAEAL |
| Ga0210410_105394991 | 3300021479 | Soil | MTPTERPGSHKVLLVDDDEAIRDMMTATLEHKGFDLVAAANVTEALN |
| Ga0210410_107039822 | 3300021479 | Soil | MTQTKTSDSHRVLLVDDDEAVRTMMTATLERKGFDVIPAAGVVEALKL |
| Ga0212123_101997402 | 3300022557 | Iron-Sulfur Acid Spring | MTPAEHSISHKVLLVDDDDAVCEMMTGTLEHTGFGVVAAVNVTGALKRI |
| Ga0212123_107234771 | 3300022557 | Iron-Sulfur Acid Spring | MTQTKTSVSHRVLLVDDDEAVRTMMSATLERKGFEVLPAA |
| Ga0224549_10429061 | 3300022840 | Soil | MTPTEPRVAHKVLLVDDDDAIRDMMSQTLEHKGFAVVSAAN |
| Ga0224554_10896152 | 3300023068 | Soil | MTSIGQLVAHRVLLVDDDHAVRTMMNATLERKGFDVVAAASVTEA |
| Ga0224551_10458822 | 3300023259 | Soil | MTPTEPRISHKVLHVDDDEAIREMMTATLAHKGFDVVAAANVKEALKL |
| Ga0208936_10516571 | 3300025404 | Peatland | MTPTERPTNKVLLVDDDDAVREMMTATLEHKGFGVVAAA |
| Ga0208190_10124351 | 3300025473 | Peatland | MMPTERAVSPRVLLVDDDDGVRAMMTATLEHKGFEVAAAANVTEALRLITA |
| Ga0208192_11030661 | 3300025477 | Peatland | MTLLEKPVAHRVLLVDDDEAVRSMMSVTLERKGFDVVSAV |
| Ga0208819_10567031 | 3300025498 | Peatland | VTQTKTSVSHRVLLVDDDEAVRAMMSTTLERKGFEVIPACNV |
| Ga0207707_102952822 | 3300025912 | Corn Rhizosphere | MGSMIPSTLHKVLLVDDDSAVRNMMELTLEYKGFKVVSAANVTEALK |
| Ga0207700_113455782 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | MATPEERISHKVLLVDDDDAVRDMMSATLELRDFEVVAAANVPDAL |
| Ga0209838_10272311 | 3300026214 | Soil | MTQTEPRVAHRVLLVDDDGAVRAMMNEALTRKGFEVATAS |
| Ga0209839_100656293 | 3300026294 | Soil | MTPTEPRVAQKVLLVDDDDAIRTMMSLTLEHKGFAVVS |
| Ga0257153_10019752 | 3300026490 | Soil | MTPTERPIPHKVLLVDDDEAVRNMMTATLERKGFGVVSVADVTEALKLITTEPF |
| Ga0208241_10102091 | 3300027297 | Forest Soil | MPPIESSVARKVLLVDDDDAVRAMMDATLQRKGFEVVAAASVTEA |
| Ga0208241_10264511 | 3300027297 | Forest Soil | MTHNETSVPHRVLLVDDDDGVRDMMRVTLEHKGFDVVPAVNVTGALKL |
| Ga0208199_11282962 | 3300027497 | Peatlands Soil | MTPTDPPVAHKVLVVDDDDGVRAMMTATLKHKGFDVVAAA |
| Ga0209008_10523912 | 3300027545 | Forest Soil | MTPTEPRISHKVLLVDDDEAIREMMTATLAHKGFDVVAAATV |
| Ga0208324_12191511 | 3300027604 | Peatlands Soil | MTPTEPRAAHRVLLVDDDAAVRSMMTQALERKGFEVV |
| Ga0208827_12091192 | 3300027641 | Peatlands Soil | MTPTEPSVAHKVLLVDDDNAVRDMMTMTLEHKGFEVVAAASVTEALR |
| Ga0209007_10099593 | 3300027652 | Forest Soil | MTLAERPVSHRVLLVDDDDALREMMTATLALKGFEVVAAANVTQALKLITT |
| Ga0209736_11100991 | 3300027660 | Forest Soil | MTPTGQPVAHRVLLVDDDNAVLAMMTATLTHKGFDVV |
| Ga0209736_11458752 | 3300027660 | Forest Soil | MTPTEQPVAHRVLLVDDDNAVLAMMTATLTHKGFDVV |
| Ga0209011_11123182 | 3300027678 | Forest Soil | MTPTEPLVAHKMLLVDDNDAVRAMMNIAFERKGSDVIALPA |
| Ga0209328_102088751 | 3300027727 | Forest Soil | MTPTEPPVAHRVLLVDDDEAVRAMMNATLERKGFDVVNAASVSEA |
| Ga0209274_100449951 | 3300027853 | Soil | MTPTEPLIAHKVLLVDDDDAVRTMMTLTLEHKGFGVVSAANV |
| Ga0209274_100822543 | 3300027853 | Soil | MTPTEPRVAHKVLLVDDDDAIRDMMSQTLEHKGFAVVS |
| Ga0209274_103890693 | 3300027853 | Soil | MTPTERRISHKVLLVDDDAALRTMMTMTLKYKGFEVVSAANVTEA |
| Ga0209274_106419501 | 3300027853 | Soil | MTQAQTSVSQRVLLVDDDEAVRSMMTATLEHKGVKVVPAASFSGSTLR |
| Ga0209167_101732451 | 3300027867 | Surface Soil | MTPSTFPVSHRVLLVDDDDAIRETMAITLQRKGFEVVAAN |
| Ga0209169_101302892 | 3300027879 | Soil | MTPTEPTVAHQALLRVLLVDDDDAVRDMMTLTLEHKGFKVVTAA |
| Ga0209275_106716871 | 3300027884 | Soil | MTPTEPLIAHKVLLVDDDDAVRTMMTLTLEHKGFGVVSAANVT |
| Ga0209380_103892512 | 3300027889 | Soil | MTQTKTSTSHRVLLVDDDDAVREMMSAILQAKGFDVVLAASVTEALK |
| Ga0209380_104461481 | 3300027889 | Soil | MTQTRTSVSHKVLLVDDDEAVRDMMSRTLVGKGFDVVAAASV |
| Ga0209380_105381021 | 3300027889 | Soil | MTQTKTSASRKVLLVDDDDAVREMMSAILQAKGFAVTLA |
| Ga0209006_105311151 | 3300027908 | Forest Soil | MTAMAQTGTSASHRVLLVDDDEAIRTMMTLTLEHKG |
| Ga0209006_107557501 | 3300027908 | Forest Soil | MTQTKTSASRKVLLVDDDDAVREMMSAILQAKGFAVTLAASVTEALRLIVTETF |
| Ga0209698_111986651 | 3300027911 | Watersheds | MTPAGPRVAHKLLIVDDDDAVRTMMTATLELKGFEVVAAASV |
| Ga0209698_113580901 | 3300027911 | Watersheds | MIPTALPVAHKVLLVDDDDAVREVMTETLERKGFHVVAAASVTEALRH |
| Ga0265356_10171861 | 3300028017 | Rhizosphere | MTPTERRISHKVLLVDDDAALRTMMTMTLKYKGFEVVSAANVTEALKL |
| Ga0308309_100178839 | 3300028906 | Soil | MTQTKTSISHRVLLVDDDEAVRDMMSTTLEHKGFEVVPA |
| Ga0222749_102572821 | 3300029636 | Soil | VTQTKTSVSHRVLLVDDDEAVRTMMSMTLRGKGFEV |
| Ga0311340_108586092 | 3300029943 | Palsa | MPQIKSSVSHRVLLVDDDEAVREVMGMTLESKGFNVTPAAS |
| Ga0302188_104605491 | 3300029986 | Bog | MPQIKSSVSHRVLLVDDDEAVREVMGMTLESKGFNVTPAASVTAALRF |
| Ga0302177_101584743 | 3300030053 | Palsa | MTLNAPLTAHKVLLVDDNDAVRNMMMTVLERKGFA |
| Ga0302179_100370274 | 3300030058 | Palsa | MTLNAPLTAHKVLLVDDNDAVRNMMMTVLERKGFAVVAAANVTEA |
| Ga0311353_115050441 | 3300030399 | Palsa | VLLYVPKGVMLTLPDKPVSHKVLLVDDDDAVREMMTITLGRKGFEVVAAT |
| Ga0310037_102576431 | 3300030494 | Peatlands Soil | MTPTELPIPRRVLLVDDDDAVREMMTLTLQHRAFEVVAAANVTEALK |
| Ga0311370_121295182 | 3300030503 | Palsa | MTHPEKPVSHKVLLVDDDDAVREMMTTTLARKGFAVVAATNV |
| Ga0265762_10330011 | 3300030760 | Soil | MTAMTQIETSASRRVLLVDDDEAVRTMMTLTLEHKGFEVVAAANVTEALKLIT |
| Ga0265753_10028924 | 3300030862 | Soil | MTPTEPRVSHKVLLVDDDEAIREVMTATLAHKGFDVVAAANVTEALKLIT |
| Ga0265760_100650732 | 3300031090 | Soil | MTQTKTSLTHRVLLVDDDEAVRSMMSRTLEGKGFDVVAAASVVEALKF |
| Ga0170824_1180014632 | 3300031231 | Forest Soil | MTLAERSIAHVLLVDDDDAVRNMMTVTLEHKGFNVVSAASVTD |
| Ga0302323_1025673172 | 3300031232 | Fen | MTPTERPVAYKVLLVDDDEAVSEMMKMTLESKGFDVVAATS |
| Ga0302324_1025877641 | 3300031236 | Palsa | LTLSEQPVPNKVLLVDDDDSVREMMTITLARKGFEVVAATNVTEALKLITI |
| Ga0265320_101634941 | 3300031240 | Rhizosphere | MTQTETGVAHRVLLVDDDGAVRAMMNEALTRKGFEVVTAECVPD |
| Ga0265325_102573512 | 3300031241 | Rhizosphere | MTQTTTSVPHRVLLVDDDDAVRTMMSLTLEHKSFEVVSAANVTEALKL |
| Ga0170819_150180301 | 3300031469 | Forest Soil | MIATQTPATHRILLVDDDDAVRAMMNATLERKGFKVVPA |
| Ga0170818_1080629681 | 3300031474 | Forest Soil | MIATETSATHRILLVDDDDAVRAMMNATLERKGFEVVPATNVSEALRQLN |
| Ga0302326_106180781 | 3300031525 | Palsa | MAPTEQPVPHRVLLVDDDDGVRAMMNAMLERKGFEVVAAANVTDA |
| Ga0310686_1153645291 | 3300031708 | Soil | MTPIDPPVAHRVLVVDDDNAVRAMMKATLERKGFD |
| Ga0265314_100127111 | 3300031711 | Rhizosphere | MTQTTTSVPHRVLLVDDDDAVRTMMSLTLEHKSFEVVSAANVTEALK |
| Ga0307476_104894501 | 3300031715 | Hardwood Forest Soil | MPPTERTVSHRVLLVDDDDAVRAMMNASLERKGFEVVSAANVADA |
| Ga0310813_111360211 | 3300031716 | Soil | MTVPERPAAHRVLLVDDDDAVRSMMNLTLESRGFDVVAAA |
| Ga0307474_101130631 | 3300031718 | Hardwood Forest Soil | MSPAGRPVAHRVPLVDDDNGVRAMMNATLERKGFEVVA |
| Ga0307474_105224284 | 3300031718 | Hardwood Forest Soil | MTPTEPRVSHKVLLVDDDEAIREMMTATLAHKGFDVVAAANVTE |
| Ga0307474_111430311 | 3300031718 | Hardwood Forest Soil | MSPTERPVAHKVLLVDDDDAVRGMMNATLERKGFAVVAAASVTQALRR |
| Ga0307477_104838311 | 3300031753 | Hardwood Forest Soil | MTPTASAVARKVLLVDDDDAVRDVMTETLERNGFHV |
| Ga0307475_101319852 | 3300031754 | Hardwood Forest Soil | MSPAGRPVAHRVPLVDDDNGVRAMMNATLERKGFEVVAAASVTEALRSLLRASTS |
| Ga0307475_107280332 | 3300031754 | Hardwood Forest Soil | MTPTELTVSHIHRVLLVDDDDAVRAMMNATLERRGFEVVPAANV |
| Ga0307475_113132471 | 3300031754 | Hardwood Forest Soil | MTPTEQTVAHRVLLVDDDDAVLAMMTATLTRKGFE |
| Ga0316046_1060091 | 3300031817 | Soil | MTPTERRIAHKVLLVDDDDAIREMMTVTLEHKGFAVIAAANVTEALKL |
| Ga0307478_110744532 | 3300031823 | Hardwood Forest Soil | MTPTELIVSHIHRVLLVDDDDAVRAMMNATLERRGFEVVPAA |
| Ga0311301_121275091 | 3300032160 | Peatlands Soil | MNPTEPRAGRRVLLVDDDLAVRSMMTQGLERKGFDVVG |
| Ga0307471_1034851891 | 3300032180 | Hardwood Forest Soil | MSPTGRLVAHRVPLVDEDNGVRAMMNATLERKGFEVVAAAS |
| Ga0315742_110988431 | 3300032756 | Forest Soil | MTPTERRIAHKVLLVDDDDAVRDMMTVTLEHKGFVVVAATNVTEALKL |
| Ga0334854_104618_566_679 | 3300033829 | Soil | MSPTKQGVSHRVLLVDDDEAVRTMMSATLERKGFEVVC |
| Ga0370484_0221286_3_137 | 3300034125 | Untreated Peat Soil | MTPTELSVAHRVLLVDDDHGVRAMMNATLERKGFDVVAVASVTEA |
| ⦗Top⦘ |