| Basic Information | |
|---|---|
| Family ID | F029106 |
| Family Type | Metagenome |
| Number of Sequences | 189 |
| Average Sequence Length | 42 residues |
| Representative Sequence | MNKAQKVLIGLGVAGAVGLTYVITALKGMPEAFDWEDDEVDE |
| Number of Associated Samples | 108 |
| Number of Associated Scaffolds | 189 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 94.15 % |
| % of genes near scaffold ends (potentially truncated) | 8.47 % |
| % of genes from short scaffolds (< 2000 bps) | 54.50 % |
| Associated GOLD sequencing projects | 100 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.45 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (79.365 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater (21.693 % of family members) |
| Environment Ontology (ENVO) | Unclassified (51.852 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (56.614 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | Yes | Secondary Structure distribution: | α-helix: 40.00% β-sheet: 0.00% Coil/Unstructured: 60.00% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.45 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 189 Family Scaffolds |
|---|---|---|
| PF11753 | DUF3310 | 57.67 |
| PF01930 | Cas_Cas4 | 6.88 |
| PF00154 | RecA | 2.65 |
| PF13640 | 2OG-FeII_Oxy_3 | 2.12 |
| PF14579 | HHH_6 | 2.12 |
| PF13155 | Toprim_2 | 1.59 |
| PF13384 | HTH_23 | 1.59 |
| PF00565 | SNase | 1.59 |
| PF04860 | Phage_portal | 0.53 |
| PF06067 | DUF932 | 0.53 |
| PF02518 | HATPase_c | 0.53 |
| PF01370 | Epimerase | 0.53 |
| PF02867 | Ribonuc_red_lgC | 0.53 |
| PF05050 | Methyltransf_21 | 0.53 |
| PF02467 | Whib | 0.53 |
| PF03796 | DnaB_C | 0.53 |
| PF00255 | GSHPx | 0.53 |
| COG ID | Name | Functional Category | % Frequency in 189 Family Scaffolds |
|---|---|---|---|
| COG1468 | CRISPR/Cas system-associated exonuclease Cas4, RecB family | Defense mechanisms [V] | 6.88 |
| COG0468 | RecA/RadA recombinase | Replication, recombination and repair [L] | 2.65 |
| COG0209 | Ribonucleotide reductase alpha subunit | Nucleotide transport and metabolism [F] | 0.53 |
| COG0305 | Replicative DNA helicase | Replication, recombination and repair [L] | 0.53 |
| COG0386 | Thioredoxin/glutathione peroxidase BtuE, reduces lipid peroxides | Defense mechanisms [V] | 0.53 |
| COG1066 | DNA repair protein RadA/Sms, contains AAA+ ATPase domain | Replication, recombination and repair [L] | 0.53 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 79.37 % |
| All Organisms | root | All Organisms | 20.63 % |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 21.69% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 12.17% |
| Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 10.05% |
| Deep Subsurface | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface | 6.88% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 6.35% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 5.82% |
| Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 3.70% |
| Deep Subsurface Sediment | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface Sediment | 3.70% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 3.17% |
| Freshwater | Environmental → Aquatic → Freshwater → Ice → Glacial Lake → Freshwater | 3.17% |
| Estuarine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine | 3.17% |
| Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater And Sediment | 2.65% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 2.65% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 2.65% |
| Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater And Sediment | 1.59% |
| Freshwater | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater | 1.59% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 1.06% |
| Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 1.06% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 1.06% |
| Estuary Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water | 1.06% |
| Hypersaline | Environmental → Aquatic → Non-Marine Saline And Alkaline → Hypersaline → Unclassified → Hypersaline | 1.06% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 0.53% |
| Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater And Sediment | 0.53% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater | 0.53% |
| Freshwater | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater | 0.53% |
| Pond Fresh Water | Environmental → Aquatic → Freshwater → Pond → Unclassified → Pond Fresh Water | 0.53% |
| Meromictic Pond | Environmental → Aquatic → Unclassified → Unclassified → Unclassified → Meromictic Pond | 0.53% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.53% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000405 | Hypersaline microbial communities from Lake Vida, Antarctica - sample: Brine Hole Two 0.1-0.2 micron | Environmental | Open in IMG/M |
| 3300000756 | Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB hypolimnion July 2011 | Environmental | Open in IMG/M |
| 3300001282 | Freshwater microbial communities from Lake Mendota, WI - Practice 20APR2010 epilimnion | Environmental | Open in IMG/M |
| 3300002161 | Freshwater and sediment microbial communities from dead zone in Sandusky Bay, Ohio, USA | Environmental | Open in IMG/M |
| 3300002303 | Freshwater microbial communities from Lake Mendota, WI - 07OCT2009 deep hole epilimnion ns | Environmental | Open in IMG/M |
| 3300002408 | Freshwater microbial communities from Lake Mendota, WI, sample - 15JUL2010 deep hole epilimnion (Lake Mendota Combined assembly, ASSEMBLY_DATE=20140123) | Environmental | Open in IMG/M |
| 3300002835 | Freshwater microbial communities from Lake Mendota, WI - (Lake Mendota Combined Ray assembly, ASSEMBLY_DATE=20140605) | Environmental | Open in IMG/M |
| 3300003491 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.SD | Environmental | Open in IMG/M |
| 3300005517 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (version 4) | Environmental | Open in IMG/M |
| 3300005527 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG | Environmental | Open in IMG/M |
| 3300005662 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 4) | Environmental | Open in IMG/M |
| 3300006484 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.535 | Environmental | Open in IMG/M |
| 3300007516 | Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - FRY-01 | Environmental | Open in IMG/M |
| 3300007538 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_2 Viral MetaG | Environmental | Open in IMG/M |
| 3300007544 | Estuarine microbial communities from the Columbia River estuary - metaG 1449B-3 | Environmental | Open in IMG/M |
| 3300007559 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.541 | Environmental | Open in IMG/M |
| 3300007560 | Estuarine microbial communities from the Columbia River estuary - metaG 1560A-02 | Environmental | Open in IMG/M |
| 3300007716 | Estuarine microbial communities from the Columbia River estuary - metaG 1546B-3 | Environmental | Open in IMG/M |
| 3300007972 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460ABC_3.0um | Environmental | Open in IMG/M |
| 3300007973 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460A_0.2um | Environmental | Open in IMG/M |
| 3300008107 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-3-NA | Environmental | Open in IMG/M |
| 3300008110 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0048-3-NA | Environmental | Open in IMG/M |
| 3300008113 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0050-3-NA | Environmental | Open in IMG/M |
| 3300008114 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-C-NA | Environmental | Open in IMG/M |
| 3300008116 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-3-NA | Environmental | Open in IMG/M |
| 3300008259 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0132-C-NA | Environmental | Open in IMG/M |
| 3300008262 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-C-NA | Environmental | Open in IMG/M |
| 3300008448 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - August 4, 2014 all contigs | Environmental | Open in IMG/M |
| 3300008450 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - Oct 27, 2014 all contigs | Environmental | Open in IMG/M |
| 3300009085 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 10-12cm September2015 | Environmental | Open in IMG/M |
| 3300009158 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG | Environmental | Open in IMG/M |
| 3300009159 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG | Environmental | Open in IMG/M |
| 3300009183 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG | Environmental | Open in IMG/M |
| 3300009419 | Subsurface microbial communities from deep shales in Ohio, USA - Utica-3 well 1 S input2 FT | Environmental | Open in IMG/M |
| 3300009466 | Aquatic microbial communities from different depth of meromictic Siders Pond, Falmouth, Massachusetts; Cast 1, 2m depth; DNA IDBA-UD | Environmental | Open in IMG/M |
| 3300010374 | Subsurface microbial communities from deep shales in Ohio, USA - Utica-3 well 1 S-1-Day17 | Environmental | Open in IMG/M |
| 3300010388 | Freshwater microbial communities from the surface of the forest pond in Jussy, Geneva, Switzerland - JEBV, may 2015 | Environmental | Open in IMG/M |
| 3300011268 | Sub-surface freshwater microbial communities from San Francisco Estuary Delta, California, USA . Combined Assembly of Gp0173482, Gp0175554, Gp0175555 | Environmental | Open in IMG/M |
| 3300012000 | Freshwater microbial communities from Lake Lanier in Georgia, USA - LL_1007A | Environmental | Open in IMG/M |
| 3300012346 | Freshwater microbial communities from Emily Creek, Ontario, Canada - S29 | Environmental | Open in IMG/M |
| 3300012665 | Freshwater microbial communities from Talbot River, Ontario, Canada - S11 | Environmental | Open in IMG/M |
| 3300012667 | Freshwater microbial communities from Maskinonge River, Ontario, Canada - S15 | Environmental | Open in IMG/M |
| 3300013004 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES118 metaG | Environmental | Open in IMG/M |
| 3300013005 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES117 metaG | Environmental | Open in IMG/M |
| 3300019784 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.D | Environmental | Open in IMG/M |
| 3300020141 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_104 megahit1 | Environmental | Open in IMG/M |
| 3300020151 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_202 megahit1 | Environmental | Open in IMG/M |
| 3300020159 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_108 megahit1 | Environmental | Open in IMG/M |
| 3300020160 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_105 megahit1 | Environmental | Open in IMG/M |
| 3300020161 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_101 megahit1 | Environmental | Open in IMG/M |
| 3300020162 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_201 megahit1 | Environmental | Open in IMG/M |
| 3300020172 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_102 megahit1 | Environmental | Open in IMG/M |
| 3300020205 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_103 megahit1 | Environmental | Open in IMG/M |
| 3300020483 | Freshwater microbial communities from Lake Mendota, WI - 05AUG2008 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020487 | Freshwater microbial communities from Lake Mendota, WI - 13AUG2008 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020519 | Freshwater microbial communities from Lake Mendota, WI - 07OCT2009 deep hole epilimnion ns (SPAdes) | Environmental | Open in IMG/M |
| 3300020560 | Freshwater microbial communities from Lake Mendota, WI - 18JUN2009 deep hole epilimnion ns (SPAdes) | Environmental | Open in IMG/M |
| 3300020575 | Freshwater microbial communities from Lake Mendota, WI - 20MAY2010 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300021962 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649D | Environmental | Open in IMG/M |
| 3300021963 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_657D | Environmental | Open in IMG/M |
| 3300022200 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG (v3) | Environmental | Open in IMG/M |
| 3300023174 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1505 | Environmental | Open in IMG/M |
| 3300023301 | Hypersaline microbial communities from Lake Vida, Antarctica - Brine Hole Two >0.2 micron (SPAdes) | Environmental | Open in IMG/M |
| 3300024343 | Combined assembly of estuarine microbial communities from Columbia River, Washington, USA >3um size fraction | Environmental | Open in IMG/M |
| 3300024346 | Whole water sample coassembly | Environmental | Open in IMG/M |
| 3300024357 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Cont_RepB_8d | Environmental | Open in IMG/M |
| 3300027114 | Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Utica-2 Time Series FC 2014_7_16 (SPAdes) | Environmental | Open in IMG/M |
| 3300027144 | Freshwater microbial communities from St. Lawrence River, New York, United States - Law_Cont_RepA_0h | Environmental | Open in IMG/M |
| 3300027710 | Subsurface microbial communities from deep shales in Ohio, USA - Utica-3 well 1 S input2 FT (SPAdes) | Environmental | Open in IMG/M |
| 3300027720 | Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB epilimnion July 2011 (SPAdes) | Environmental | Open in IMG/M |
| 3300027728 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_14m | Environmental | Open in IMG/M |
| 3300027730 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_8m | Environmental | Open in IMG/M |
| 3300027733 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027759 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027782 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027797 | Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB hypolimnion July 2011 (SPAdes) | Environmental | Open in IMG/M |
| 3300027805 | Freshwater and sediment microbial communities from dead zone in Sandusky Bay, Ohio, USA (SPAdes) | Environmental | Open in IMG/M |
| 3300027969 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130626_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027976 | Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - FRY-01 (SPAdes) | Environmental | Open in IMG/M |
| 3300028025 | Subsurface sediment microbial communities from gas well in West Virginia, United States - MSEEL Well Study Marcellus 5H_FC | Environmental | Open in IMG/M |
| 3300029349 | Freshwater microbial communities from Iron Gate Dam, Klamath Basin, California, USA - IR103 | Environmental | Open in IMG/M |
| 3300031758 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA123 | Environmental | Open in IMG/M |
| 3300031857 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125 | Environmental | Open in IMG/M |
| 3300031963 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA116 | Environmental | Open in IMG/M |
| 3300032093 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA117 | Environmental | Open in IMG/M |
| 3300032116 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA119 | Environmental | Open in IMG/M |
| 3300033557 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D2_B | Environmental | Open in IMG/M |
| 3300033816 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME16Sep2004-rr0005 | Environmental | Open in IMG/M |
| 3300033994 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME25Jul2006D11-rr0046 | Environmental | Open in IMG/M |
| 3300034013 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Jun2018-rr0034 | Environmental | Open in IMG/M |
| 3300034062 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Jul2012-rr0045 | Environmental | Open in IMG/M |
| 3300034063 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Oct2008D10-rr0053 | Environmental | Open in IMG/M |
| 3300034066 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME11Jul2017-rr0087 | Environmental | Open in IMG/M |
| 3300034071 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Oct2008D10-rr0110 | Environmental | Open in IMG/M |
| 3300034082 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME05Jun2015-rr0088 | Environmental | Open in IMG/M |
| 3300034092 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME03Aug2012-rr0069 | Environmental | Open in IMG/M |
| 3300034093 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME08Jun2014-rr0072 | Environmental | Open in IMG/M |
| 3300034101 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME19Sep2005-rr0107 | Environmental | Open in IMG/M |
| 3300034104 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Aug2005-rr0120 | Environmental | Open in IMG/M |
| 3300034106 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME23Aug2013-rr0131 | Environmental | Open in IMG/M |
| 3300034107 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME21Apr2017-rr0133 | Environmental | Open in IMG/M |
| 3300034108 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME24Jun2014-rr0157 | Environmental | Open in IMG/M |
| 3300034111 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME03Oct2011-rr0186 | Environmental | Open in IMG/M |
| 3300034272 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Jul2017-rr0156 | Environmental | Open in IMG/M |
| 3300034279 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Jul2014-rr0163 | Environmental | Open in IMG/M |
| 3300034283 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Aug2003-rr0061 | Environmental | Open in IMG/M |
| 3300034284 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME08Jul2016-rr0075 | Environmental | Open in IMG/M |
| 3300034356 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Jun2014-rr0152 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| LV_Brine_h2_0102DRAFT_10018165 | 3300000405 | Hypersaline | MKKSQKLLIAIGVAGAVGITFVMTALKGMPEAFDWEEDESSE* |
| JGI12421J11937_100139884 | 3300000756 | Freshwater And Sediment | MNKLQKVIIGLGVAGAVGLTYLITALKGMPEAFTWENDEEEEYE* |
| B570J14230_100464143 | 3300001282 | Freshwater | MNKAQKILIGIGIAGAVGITFVLTALKGLPEAFDWDNDEENK* |
| JGI24766J26685_100116796 | 3300002161 | Freshwater And Sediment | MSKLQKIIIGLGIAGAVGFTYVITALRGMPEAFEWEDDEEEDYE* |
| JGI24766J26685_100273143 | 3300002161 | Freshwater And Sediment | MNKLQKVLIGLGVAGAVGLTYVITALKGMPEAFEWEDDEDIEYE* |
| B570J29644_10101331 | 3300002303 | Freshwater | MNKLQRVVIGLGVAGAVGLTYVITALKGMPEAFDWEDDEEESNE* |
| B570J29032_1094819933 | 3300002408 | Freshwater | MNKAQKVLIGLGVAGAVGLTYVITALKGMPEAFDWEDDEVDE* |
| B570J40625_1000268044 | 3300002835 | Freshwater | MNKLQRVLIGLGVTGAVGLTYVVTALKGMPEAFDWEDDEEENNE* |
| B570J40625_1000489185 | 3300002835 | Freshwater | MNKLQRVVIGLGVAGAVGITYVITALKGMPEAFDWEDDEEESHE* |
| B570J40625_1000657461 | 3300002835 | Freshwater | MNKAQKILIGLGITGAVGITFVVTALKGLPEAFDWDDDEDID* |
| JGI25924J51412_10105692 | 3300003491 | Freshwater Lake | MNKAQKIIIALCVTGAVGLTYVATALRGXPEAFDWEDDEDNDELF* |
| Ga0070374_100177548 | 3300005517 | Freshwater Lake | MNKAQKIIIALCVTGAVGLTYVATALRGIPEAFDWEDDEDNDELF* |
| Ga0068876_1000014628 | 3300005527 | Freshwater Lake | MNKAQKVLIGLGVAGAVGITYVLTALRGLPEAFDWENDEDE* |
| Ga0078894_101199222 | 3300005662 | Freshwater Lake | MNKLQKVIIGLGVAGAVGLTYVITALKGMPEAFDWENEEEDDE* |
| Ga0078894_110732152 | 3300005662 | Freshwater Lake | MNKIQKVAIGLGVAGAVGLTYVVTALRGIPEAFDWEEDEEDDELF* |
| Ga0070744_100307014 | 3300006484 | Estuarine | MSKLQKIIVGLGVAGAVGFTYVITALRGMPEAFDWEDDEEEDHE* |
| Ga0070744_100340413 | 3300006484 | Estuarine | MNKAQKIIVALCVTGAVGLTYVATALRGIPEAFDWEDDEDNDELF* |
| Ga0070744_100524033 | 3300006484 | Estuarine | MNKLQKIIIGLGIAGAVGITYVVTALKGMPEAFDWEEDEDNE* |
| Ga0105050_1000467720 | 3300007516 | Freshwater | MNKFQKLFITVGVASAVGITFALAALKSIPEAFDWEKDDE* |
| Ga0105050_100188495 | 3300007516 | Freshwater | MNKFQKLFITVGVAGAVGITFALAALKGIPESFDWDEDDE* |
| Ga0105050_100376765 | 3300007516 | Freshwater | MNKFQKLFITVGVAGAVGITFALAALKGIPESFDWEEDDE* |
| Ga0099851_11020261 | 3300007538 | Aqueous | MNKLQKVVIGIGVAGAVGLTYVITALKGMPEAFEWEDDEDDE* |
| Ga0102861_10765362 | 3300007544 | Estuarine | MNKAQKIIIALCVTGAVGLTYVATALRGIPEAFDCEDDEDNDELF* |
| Ga0102828_10556732 | 3300007559 | Estuarine | MNKAQKIIIALCVTGAVGLTYVATALRGIPEAFDWEDDEEDE* |
| Ga0102913_12399911 | 3300007560 | Estuarine | MNKIQKIIIGLSVASAVGLTYVVTTLKGIPEAFDWEEEDDE* |
| Ga0102867_11720453 | 3300007716 | Estuarine | VKAMNKLQKVIIGLSVASAVGLTYVIAALKGIPEAFDWEEDDDE* |
| Ga0105745_11217141 | 3300007972 | Estuary Water | MNKLQKVVIGLGVAGAVGLTYVITALKGMPEAFTWENDE |
| Ga0105746_13555552 | 3300007973 | Estuary Water | MNKVQKIAIGLGIAGAVGITYVITALRGIPEAFDWEDDEDNDELF* |
| Ga0114340_1000035166 | 3300008107 | Freshwater, Plankton | MNRMQKLLIGLAVAGAVGITFVATSLRGMPEAFDWEDDEEKNYE* |
| Ga0114340_100017973 | 3300008107 | Freshwater, Plankton | MNKAQKVLIGIGIAGAVGLTYVITALKGMPEAFDWEEDESDE* |
| Ga0114340_10021377 | 3300008107 | Freshwater, Plankton | MNKTQKVLIGLGVAGAVGLTYLITALKGMPEAFEWEEDDEDY* |
| Ga0114340_10034816 | 3300008107 | Freshwater, Plankton | MNKAQRVLIGLGVAGAVGITFVMTALKGLPEAFEWEEDEDE* |
| Ga0114340_10086134 | 3300008107 | Freshwater, Plankton | MSKLQKIIVGLGVAGAVGFTYVITALRGMPEAFDWEDDEEEDYE* |
| Ga0114340_10191594 | 3300008107 | Freshwater, Plankton | MSKAQKVLIGLGIAGAVGVTYVFTALRGLPELFDWEVDDE* |
| Ga0114340_10213503 | 3300008107 | Freshwater, Plankton | MSKIQKLVIGLGVAGAVGITFVITALKGLPEAFEWEEDEDE* |
| Ga0114340_11250142 | 3300008107 | Freshwater, Plankton | MNKLQKVIIGLGVAGAVGITYVVTALKGMPEAFDWEDDDE* |
| Ga0114343_100201126 | 3300008110 | Freshwater, Plankton | MNKAQRVLIGLGVAGAVGITFVMTALKGLPEAFEWEEDDDE* |
| Ga0114343_10486083 | 3300008110 | Freshwater, Plankton | MNKVQKVLIGLGIAGAVGVTYVMTALKGMPEAFDWEEDEDSE* |
| Ga0114343_11766103 | 3300008110 | Freshwater, Plankton | MNKAQKVLIGLGVAGAVGLTYVLTALKGLPEAFEWEEDESDE* |
| Ga0114343_12014472 | 3300008110 | Freshwater, Plankton | MNKAQKVLIGIGIAGAVGLTYVVTALKGMPEAFDWEDDEPDE* |
| Ga0114346_10062164 | 3300008113 | Freshwater, Plankton | MSKAQKVLIGLGIAGAVGVTYVFTALRGLPELFDWEADDE* |
| Ga0114346_10629443 | 3300008113 | Freshwater, Plankton | MNKLQKIIIGLGIAGAVGFTYVITALRGMPEAFDWEDDEEENYE* |
| Ga0114347_10194835 | 3300008114 | Freshwater, Plankton | MSKTKKILIALGVIGAAGLTYVITTLKGLPEAFDWEDEEDET* |
| Ga0114350_10018993 | 3300008116 | Freshwater, Plankton | MSKTKKILIALGVIGAAGLTYVITSLKGLPEAFDWEDEEDET* |
| Ga0114841_12610321 | 3300008259 | Freshwater, Plankton | LIGLGVAGAVGITYVLTALRGLPEAFDWENDEDE* |
| Ga0114337_103713910 | 3300008262 | Freshwater, Plankton | MQKLLIGLAVAGAVGITFVATSLRGMPEAFDWEDDEEKNYE* |
| Ga0114337_10527911 | 3300008262 | Freshwater, Plankton | TMNKAQKVLIGIGIAGAVGLTYVITALKGMPEAFDWEEDESDE* |
| Ga0114876_10172855 | 3300008448 | Freshwater Lake | MNKLQKVIIGLGVAGAVGITYVVTALKGMPEAFDWADDDE* |
| Ga0114880_100562611 | 3300008450 | Freshwater Lake | MNKAQKVLIGIGIAGAVGLTYVITALKGIPEAFDWEEDESDE* |
| Ga0105103_107506343 | 3300009085 | Freshwater Sediment | MNKAQKILIGLGIAGAVGITYVVTALRGLPEAFDLDDDENIK* |
| Ga0114977_1000690811 | 3300009158 | Freshwater Lake | MSKLQKIMLGIGIAGAVGITYVVSALRGMPEVFDWDDDEDF* |
| Ga0114977_102153983 | 3300009158 | Freshwater Lake | MNKAQKIIIALCVTGAVGLTYVATALKGIPEAFDWEDDEDNDELF* |
| Ga0114978_100069806 | 3300009159 | Freshwater Lake | MNKIQKVVIGLGVAGAVGLTYVVTALKGMPEAFDWEDDEEDE* |
| Ga0114978_101174322 | 3300009159 | Freshwater Lake | MNKAQKVLIGIGIAGAVGLTYVITALKGLPEAFDWEDDSDYE* |
| Ga0114974_102461303 | 3300009183 | Freshwater Lake | MNKAQKILIGLGIASAVGITYVVTALRGLPEAFDWEDDDE* |
| Ga0114982_10015115 | 3300009419 | Deep Subsurface | MSKTKKILVGLGIAGAVGITYVVTALRGLPEVFDWEEDDNE* |
| Ga0114982_10027432 | 3300009419 | Deep Subsurface | MNKMQKLVIGLGIAGAVGITFVITALKGLPEAFEWEEDEDE* |
| Ga0114982_10041672 | 3300009419 | Deep Subsurface | MSKAQKVLIGLGIAGAVGVTYVFTALRGLPELFDWEAEDE* |
| Ga0114982_10235152 | 3300009419 | Deep Subsurface | MNKAQKIIIGLGVAGAVGITFVLTALKGMPEAFDWEDDEEESYE* |
| Ga0114982_10693084 | 3300009419 | Deep Subsurface | MNKLQKIAIGLGVAGAVGLTYVITALKGMPEAFSWEDEEEDDE* |
| Ga0126448_10035434 | 3300009466 | Meromictic Pond | MSKTQKVLIGLGIAGAVGITYVVTALRGLPEAFDWEDDESNE* |
| Ga0114986_10417242 | 3300010374 | Deep Subsurface | MNKIQKLVIGLGIAGAVGITFVITALKGLPEAFEWEEDEDE* |
| Ga0136551_10725532 | 3300010388 | Pond Fresh Water | MSRIQKAIIGVAVAGAVGITYVLTTLKGLPEAFDWNLEEDEDEND* |
| Ga0151620_12435641 | 3300011268 | Freshwater | MSKLQKIVIGLGVAGAVGFTYVLTALRGMPEAFDWEDDEEEDHE* |
| Ga0119951_10586004 | 3300012000 | Freshwater | MNKRQKFIIGIGIAGAVGLTYLISALKGLPDVFDWEEDCDE* |
| Ga0157141_100004546 | 3300012346 | Freshwater | MSKAKKFIIGLGLVGAVGLTYLVSALKDMPEAFDWMDEDE* |
| Ga0157210_100002446 | 3300012665 | Freshwater | MNKAQKVLIGLGIAGAVGITFVVTALKGLPEAFEWEEDEPHE* |
| Ga0157208_100322441 | 3300012667 | Freshwater | MNKLQKVIIGIGVAGAVGLTYVITALKGMPEAFDWENEEEDNE* |
| Ga0164293_100617955 | 3300013004 | Freshwater | MNKLQKVIIGLGVAGAVGLTYVITALKGMPEAFTWENDEEEEYE* |
| Ga0164293_107697252 | 3300013004 | Freshwater | MNKLQKVVIGLAVAGAVGLTYVVTALRGLPEVFDWEDEE* |
| Ga0164293_108963773 | 3300013004 | Freshwater | MNKVQKVLIGLGVAGAVGFTYLITALRGMPEVFDWKDDEEEEHE* |
| Ga0164292_104995793 | 3300013005 | Freshwater | MNKLQKVVIGLAVAGAVGLTYVVTALRGLPEVFDWED |
| Ga0181359_10061387 | 3300019784 | Freshwater Lake | MNKAQKIIIALCVTGAVGLTYVATALRGIPEAFDWEDDEDNDELF |
| Ga0211732_15774545 | 3300020141 | Freshwater | MNKLQKVIIGLGIAGAVGITYVVTALKGLPEAFDWEDEE |
| Ga0211736_103314333 | 3300020151 | Freshwater | MNKIQKVVIGLGIAGAVGVTFLLTALKGLPEAFEWEEDEDEQ |
| Ga0211736_1037904135 | 3300020151 | Freshwater | MNKLQKLMIGLGVSGAVGITFVMTALRGLPEAFEWEEDEKSE |
| Ga0211736_103884303 | 3300020151 | Freshwater | MSKIQKLVIGLGVAGAVGITFVITALKGLPEAFEWEEYEDE |
| Ga0211736_109225684 | 3300020151 | Freshwater | FIGIGVAGAVGLTYAITALRGLPEAFDWDDDEDVE |
| Ga0211734_100363662 | 3300020159 | Freshwater | MNKAQKIIIGLGIAGAVGITYVLTALKGMPEAFDLEDDEEESYE |
| Ga0211734_101706912 | 3300020159 | Freshwater | MNKVQKIAIGLGVAGAVGITYVITALRGIPEAFDWEDDEDNDELF |
| Ga0211734_101867625 | 3300020159 | Freshwater | MNKAQKIFIGIGVAGAVGLTYAITALRGLPETFDWDDDEDVE |
| Ga0211734_106778794 | 3300020159 | Freshwater | MSKLQKVIIGLGIAGAVGITYVITALKGMPDAFAWENDEEEEYE |
| Ga0211734_1087704720 | 3300020159 | Freshwater | MSKLQKIMLGIGIAGAVGITYVVTALKGMPEAFDWDEDEEDF |
| Ga0211733_102802831 | 3300020160 | Freshwater | MNKAQKIFIGIGVAGAVGLTYAITALRGLPEAFDWDD |
| Ga0211733_108114164 | 3300020160 | Freshwater | MSKIQKLVIGLGVAGAVGITFVITALKGLPEAFEWEEDEDE |
| Ga0211726_1001206443 | 3300020161 | Freshwater | MNKAQKIFIGIGVAGAVGLTYAITALRGLPEAFDWDDDEDVE |
| Ga0211726_102589373 | 3300020161 | Freshwater | MNKLQKFMIGLGISGAVGITFVITALKGLPEAFEWEEDEKNE |
| Ga0211726_102789393 | 3300020161 | Freshwater | MNRIQKVVIGLGIAGAVGVTFLLTALKGLPEAFEWEEDEDEQ |
| Ga0211735_111911953 | 3300020162 | Freshwater | MSKIQKLVIGLGVAGAVGITFVITTLKGLPEAFEWEEDEDE |
| Ga0211729_100209682 | 3300020172 | Freshwater | MNKAQKILIGLGIAGAVGITYVITALKGLPEAFDWDDDEENK |
| Ga0211729_107883122 | 3300020172 | Freshwater | MNKLQKIIIGLGIAGAVGLTYVATALKGLPEAFDWEDDTENG |
| Ga0211731_106385805 | 3300020205 | Freshwater | MNKAQRVLIGLGVAGAVGITFVITALKGLPEAFEWEEDEDEQ |
| Ga0211731_107711215 | 3300020205 | Freshwater | MSKIQKLVIGLGVAGAVGITFVVTALKGLPEAFEWEEDEDE |
| Ga0211731_117547202 | 3300020205 | Freshwater | MNKLQKIVIGLGIAGAVGITYVATALRGLPEAFDWEDDTENG |
| Ga0207418_1091822 | 3300020483 | Freshwater | MNKLQRVLIGLGVTGAVGLTYVVTALKGMPEAFDWEDDEEENNE |
| Ga0208200_1151141 | 3300020487 | Freshwater | MNKLQKVVIGLGLAGAVGLTYVVTALRGLPEVFDWEDDE |
| Ga0208223_10000327 | 3300020519 | Freshwater | MNKLQRVVIGLGVAGAVGITYVITALKGMPEAFDWEDDEEESHE |
| Ga0208852_10045964 | 3300020560 | Freshwater | MNKAQKILIGLGITGAVGITFVVTALKGLPEAFDWDDDEDID |
| Ga0208852_10255452 | 3300020560 | Freshwater | MNKAQKILIGIGIAGAVGITFVLTALKGLPEAFDWDNDEENK |
| Ga0208053_10459803 | 3300020575 | Freshwater | MNKLQKVIIGLGVAGAVGLTYLITALKGMPEAFTWENDEEEEYE |
| Ga0222713_101932253 | 3300021962 | Estuarine Water | MNKLQKVVLGLGIAGAVGITYVVTALKGMPEAFDWEDNEDE |
| Ga0222713_103287254 | 3300021962 | Estuarine Water | QKVLIGLGVAGAVGITYVLTALKGLPEAFEWEEDESDE |
| Ga0222712_101141763 | 3300021963 | Estuarine Water | MNKAQKVLIGLGVAGAVGLTYVLTALKGLPEAFEWEEDESDE |
| Ga0222712_102336382 | 3300021963 | Estuarine Water | MNKIQKVIIGLGVAGAVGLTYVVTALKGMPEAFDWEDEEEDDE |
| Ga0222712_103462013 | 3300021963 | Estuarine Water | MNKMQKIVIGLGIAGAVGLTYVVTALKGLPEAFDWEDDE |
| Ga0196901_10029583 | 3300022200 | Aqueous | MNKLQKVVIGIGVAGAVGLTYVITALKGMPEAFEWEDDEDDE |
| Ga0214921_1000079450 | 3300023174 | Freshwater | MSKLQKIIIGLGVASAVGFTYVITALRGIPEAFDWEDDEEENYE |
| Ga0214921_1000187752 | 3300023174 | Freshwater | MNKAQKILIGVGIAGAVGLTYVVTALKGLLEAFDWEEDENE |
| Ga0214921_100580683 | 3300023174 | Freshwater | MNKLQKVAIGLGVAGAVGITFVITALKGMPEAFDWEEEDDE |
| Ga0214921_100653644 | 3300023174 | Freshwater | MNKRQKFIIGIGIAGAVGLTYLISALKGLPDVFDWEEDCDE |
| Ga0209414_10124975 | 3300023301 | Hypersaline | MKKSQKLLIAIGVAGAVGITFVMTALKGMPEAFDWEEDESSE |
| Ga0244777_101661474 | 3300024343 | Estuarine | MNKLQKVIIGLSVASAVGLTYVIAALKGIPEAFDWEEDDDE |
| Ga0244775_102139554 | 3300024346 | Estuarine | MNKLQKIIIGLGIAGAVGITYVVTALKGMPEAFDWEEDEDNE |
| Ga0244775_103541672 | 3300024346 | Estuarine | MSKLQKIIVGLGVAGAVGFTYVITALRGMPEAFDWEDDEEEDHE |
| Ga0244775_112914551 | 3300024346 | Estuarine | MNKIQKVAIGLGVAGAVGLTYVVTALRGIPEAFDWEEDDEDDELF |
| Ga0255165_10537782 | 3300024357 | Freshwater | MNKLQKVIIGLSVAGAVGVAYVVTALKGMPEVFDWEDDE |
| Ga0208009_10795523 | 3300027114 | Deep Subsurface | MNKVRKVLVGLGIAGAVGITFVMTALKGLPEAFEWEEDDDE |
| Ga0255102_10523702 | 3300027144 | Freshwater | MNKLQKIIIGLSVAGAVGITYVVTALRGMPEVLDWEDEDE |
| Ga0209599_100013525 | 3300027710 | Deep Subsurface | MNKIQKLVIGLGIAGAVGITFVITALKGLPEAFEWEEDEDE |
| Ga0209599_100023483 | 3300027710 | Deep Subsurface | MSKTKKILVGLGIAGAVGITYVVTALRGLPEVFDWEEDDNE |
| Ga0209599_100052425 | 3300027710 | Deep Subsurface | MNKAQKIIIGLGVAGAVGITFVLTALKGMPEAFDWEDDEEESYE |
| Ga0209599_100425594 | 3300027710 | Deep Subsurface | MSKAQKVLIGLGIAGAVGVTYVFTALRGLPELFDWEVDDE |
| Ga0209599_100505164 | 3300027710 | Deep Subsurface | MNKLQKIAIGLGVAGAVGLTYVITALKGMPEAFSWEDEEEDDE |
| Ga0209599_100805462 | 3300027710 | Deep Subsurface | MNKAQRVLIGLGVAGAVGITFVMTALKGLPEAFEWEEDEDE |
| Ga0209617_102141643 | 3300027720 | Freshwater And Sediment | MNKIQKLAIGLGIAGAVGITFVVTALKGLPEAFEWEEDEDE |
| (restricted) Ga0247836_100347426 | 3300027728 | Freshwater | MNKTQKVLIGLGVAGAVGLTYVITALKGLPEAFEWEEDEYE |
| (restricted) Ga0247836_11297463 | 3300027728 | Freshwater | MNKAQKVLLGLGIAGAVGLTYVITALKGMPEAFDWEEDEPDE |
| (restricted) Ga0247833_100687214 | 3300027730 | Freshwater | MNKAQKVLLGLGIAGAVGLTYVVTALKGMPEAFDWEEDEPDE |
| Ga0209297_10164244 | 3300027733 | Freshwater Lake | MSKLQKIMLGIGIAGAVGITYVVSALRGMPEVFDWDDDEDF |
| Ga0209297_10605161 | 3300027733 | Freshwater Lake | QKIIIALCVTGAVGLTYVATALKGIPEAFDWEDDEDNDELF |
| Ga0209296_10801472 | 3300027759 | Freshwater Lake | MNKIQKVVIGLGVAGAVGLTYVVTALKGMPEAFDWEDDEEDE |
| Ga0209296_12065861 | 3300027759 | Freshwater Lake | MNKAQKVLIGIGIAGAVGLTYVVTALKGMPEAFDWEDDEPDE |
| Ga0209500_100167345 | 3300027782 | Freshwater Lake | MNKAQKIIIALCVTGAVGLTYVATALKGIPEAFDWEDDEDNDELF |
| Ga0209500_102583572 | 3300027782 | Freshwater Lake | MNKAQKVLIGIGIAGAVGLTYVITALKGLPEAFDWEDDSDYE |
| Ga0209107_101306094 | 3300027797 | Freshwater And Sediment | MNKIQKVILGLSVASAVGLTYVLTALKGIPEAFDWEEDEEDE |
| Ga0209107_105229371 | 3300027797 | Freshwater And Sediment | MSKLQKIIIGMGIAGAVGFTYVITALRGMPEAFDWEDDEEENYE |
| Ga0209229_100039977 | 3300027805 | Freshwater And Sediment | MSKLQKIIIGLGIAGAVGFTYVITALRGMPEAFEWEDDEEEDYE |
| Ga0209229_100140595 | 3300027805 | Freshwater And Sediment | MNKLQKVLIGLGVAGAVGLTYVITALKGMPEAFEWEDDEDIEYE |
| Ga0209229_102100142 | 3300027805 | Freshwater And Sediment | MNKIYKIFIVIGITSAVGLTYVLTALRGMPEVFDWEDDEEEDYE |
| Ga0209191_12866402 | 3300027969 | Freshwater Lake | MNKAQKVIIGLGVASAVGLTYVITALRGIPEAFDWEDDEDNDELF |
| Ga0209702_1000412612 | 3300027976 | Freshwater | MNKFQKLFITVGVASAVGITFALAALKSIPEAFDWEKDDE |
| Ga0209702_1000623811 | 3300027976 | Freshwater | MNKFQKLFITVGVAGAVGITFALAALKGIPESFDWDEDDE |
| Ga0209702_102383043 | 3300027976 | Freshwater | MNKFQKLFITVGVAGAVGITFALAALKGIPESFDWEEDDE |
| Ga0247723_1000016123 | 3300028025 | Deep Subsurface Sediment | MNRKQKLLIAIGIAGAVGITYVISALKGLPEVFDWEDDINE |
| Ga0247723_10238373 | 3300028025 | Deep Subsurface Sediment | MNKIQKVVIGLGIAGAVGITYVVTALKGLPEAFEWDGEDE |
| Ga0247723_10472072 | 3300028025 | Deep Subsurface Sediment | MNKAQKIFIGLGIAGAVGITFVITALKGLPEAFEWEDDEDDE |
| Ga0247723_10882344 | 3300028025 | Deep Subsurface Sediment | MNKMQKLVIGLGIAGAVGITFVITALKGLPEAFEWEEDEDE |
| Ga0247723_10934023 | 3300028025 | Deep Subsurface Sediment | MNKMQKLVIGLGIAGAVGITFVVTALKGLPEAFEWEEDEDE |
| Ga0247723_11211163 | 3300028025 | Deep Subsurface Sediment | MNKAQKIFIGIGIVGAVGISYAITALKGLPEAFDWDDDEENK |
| Ga0247723_11260002 | 3300028025 | Deep Subsurface Sediment | MSKAQKVLIGLGIAGAVGVTYVFTALRGLPELFDWDEDDE |
| Ga0238435_1134132 | 3300029349 | Freshwater | MNKAQKIFIAIGVAGAVGLTYAIAALRGLPEAFDWDDDEDIE |
| Ga0315907_100223654 | 3300031758 | Freshwater | MSKTKKILIALGVIGAAGLTYVITTLKGLPEAFDWEDEEDET |
| Ga0315907_102430663 | 3300031758 | Freshwater | MNKAQKVLIGIGIAGAVGLTYVITALKGMPEAFDWEEDESDE |
| Ga0315909_100317862 | 3300031857 | Freshwater | MSKTKKILIALGVIGAAGLTYVITSLKGLPEAFDWEDEEDET |
| Ga0315909_100345848 | 3300031857 | Freshwater | MNKAQKVLIGIGIAGAVGLTYVITALKGMPEAFDWEEEDSNE |
| Ga0315901_103088043 | 3300031963 | Freshwater | MNKAQRVLIGLGVAGAVGITFVMTALKGLPEAFEWEEDDDE |
| Ga0315902_106796532 | 3300032093 | Freshwater | MNKTQKVLIGLGVAGAVGLTYLITALKGMPEAFEWEEDDEDY |
| Ga0315903_107973753 | 3300032116 | Freshwater | MNKLQKVIIGLGVAGAVGITYVVTALKGMPEAFDWEDDDE |
| Ga0316617_1002790953 | 3300033557 | Soil | MSKTKKILVALGVAGAVGLTYVITTLKGLPEAFDWENEEDET |
| Ga0334980_0026058_392_526 | 3300033816 | Freshwater | MNKIQKLVIGLGVAGAVGITFVITALKGLPEAFDWEDDEEESYE |
| Ga0334996_0007630_1373_1492 | 3300033994 | Freshwater | MNKVQKIIIGLSVAGAVGLTYVITALKGLPEAFEWEEDE |
| Ga0334996_0040594_1601_1720 | 3300033994 | Freshwater | MNKLQKVVIGLAVAGAVGLTYVVTALRGLPEVFDWEDEE |
| Ga0334996_0073338_112_237 | 3300033994 | Freshwater | MNKAQKFLIGLGITGAVGITYVLTALKGLPEAFEWEEDDEQ |
| Ga0334991_0431709_15_143 | 3300034013 | Freshwater | MNKLQKTIIGLGIAGAVGITYILTIFKVLPEAFDLEEDEPIE |
| Ga0334995_0039713_2079_2207 | 3300034062 | Freshwater | MTKKQKFLIGVGILGAVGLTYAISTLKGLPDVFDWEDDELDA |
| Ga0334995_0067353_915_1043 | 3300034062 | Freshwater | MNKAQKVLIGLGVAGAVGLTYVITALKGMPEAFDWEDDEVDE |
| Ga0334995_0168979_1450_1557 | 3300034062 | Freshwater | MNKIQKVVIGLGIAGAVGITYVLTALKGLPEAFEWD |
| Ga0335000_0294825_2_115 | 3300034063 | Freshwater | MNKLQRVVIGLGVAGAVGLTYVITALKGMPEAFDWEDD |
| Ga0335019_0691278_283_405 | 3300034066 | Freshwater | MNKIQKVVIGLGIASAVGITYVVTALKGLPEAFEWDGEDE |
| Ga0335028_0390848_558_692 | 3300034071 | Freshwater | MNKLQRVVIGLGVAGAVGLTYVITALKGMPEAFDWEDDEEESNE |
| Ga0335020_0000032_50132_50257 | 3300034082 | Freshwater | MNKLQKVIIAVGVAGAVGITYVLTALKGMPEAFDWEDEEDE |
| Ga0335020_0040232_436_564 | 3300034082 | Freshwater | MNKAQKILIGLGIAGAVGITYVVTALRGLPEAFDWEDDESNE |
| Ga0335020_0488653_74_199 | 3300034082 | Freshwater | MNKAQKVIIGLGVAGAVGITFVMTALKGLPEAFEWEEDEDE |
| Ga0335010_0114887_122_250 | 3300034092 | Freshwater | MTKKQKFLIGVGILGAVGLTYAISTLKGLPDVFDWEDDELDT |
| Ga0335010_0368698_3_116 | 3300034092 | Freshwater | MNKAQKILIGLGIAGAVGITYVVTALKGLPEAFDWEDD |
| Ga0335012_0186100_540_668 | 3300034093 | Freshwater | MNKAQKVLIGIGIAGAVGITYVLTALKRLPEAFDWEDDEPDE |
| Ga0335027_0000061_63770_63904 | 3300034101 | Freshwater | MNKLQKVVVAVGIAGAVGLTYVITALKGMPEAFDWEDDEEENYE |
| Ga0335027_0316221_807_935 | 3300034101 | Freshwater | MNKIQKIIIGLGIAGAVGLTYVVTALKGLPEAFDWEDDTENG |
| Ga0335031_0421905_536_664 | 3300034104 | Freshwater | MNKIQKIIIGLGIAGAVGLTYVATALKGLPEAFDWEDDTENG |
| Ga0335036_0044478_1613_1741 | 3300034106 | Freshwater | MNKAQKVLIGIGIAGAVGLTYVITALKGMPEAFDWEDEESDE |
| Ga0335037_0000027_46966_47100 | 3300034107 | Freshwater | MNKLQKVIIGLGVAGAVGLTYVITALKGMPEAFTWENDEEEEYE |
| Ga0335050_0521252_389_502 | 3300034108 | Freshwater | KVVIGLGIAGAVGITYVLTALKGLPEAFEWDEDEDEQ |
| Ga0335063_0000392_4314_4448 | 3300034111 | Freshwater | MNKVQKVIIGLGIAGAVGITYVLTTLKGMPEAFDWEDDEEESYE |
| Ga0335049_0529907_374_499 | 3300034272 | Freshwater | MNKVQKLVIGLGVASAVGITFVMTALKGLPEAFEWEEDEDE |
| Ga0335052_0604286_429_548 | 3300034279 | Freshwater | IQKVVIGLGIAGAVGITYVLTALKGLPEAFEWDEDEDEQ |
| Ga0335052_0691930_358_483 | 3300034279 | Freshwater | MNKAQKIFIGLGIAGAVGITYVITALKGLPEAFDWEEDDYE |
| Ga0335007_0002368_10664_10786 | 3300034283 | Freshwater | MSKAQKILIGLGIAGAVGVTYVFTALRGLPELFDWEADDE |
| Ga0335013_0811526_49_171 | 3300034284 | Freshwater | MNKLQKVIIGLGVAGAVGITYVVTALRGMPEVLDWEDEDE |
| Ga0335048_0068199_633_767 | 3300034356 | Freshwater | MSKLQKIFIGLGVAGAVGFTYVLTALRGMPEAFDWEDDEEEDYE |
| ⦗Top⦘ |