| Basic Information | |
|---|---|
| Family ID | F028920 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 190 |
| Average Sequence Length | 45 residues |
| Representative Sequence | MITIECTWCDAELALDSLDATSVDCPDCRVTVEIAADPEPIAIAA |
| Number of Associated Samples | 149 |
| Number of Associated Scaffolds | 190 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 48.42 % |
| % of genes near scaffold ends (potentially truncated) | 18.95 % |
| % of genes from short scaffolds (< 2000 bps) | 85.79 % |
| Associated GOLD sequencing projects | 139 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.54 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (94.211 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere (14.211 % of family members) |
| Environment Ontology (ENVO) | Unclassified (30.526 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (44.211 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 21.92% Coil/Unstructured: 78.08% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.54 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 190 Family Scaffolds |
|---|---|---|
| PF03352 | Adenine_glyco | 56.84 |
| PF00230 | MIP | 27.89 |
| PF08486 | SpoIID | 4.74 |
| PF12867 | DinB_2 | 3.68 |
| PF00528 | BPD_transp_1 | 1.05 |
| PF06628 | Catalase-rel | 0.53 |
| PF02817 | E3_binding | 0.53 |
| PF00155 | Aminotran_1_2 | 0.53 |
| PF12773 | DZR | 0.53 |
| PF13581 | HATPase_c_2 | 0.53 |
| PF00005 | ABC_tran | 0.53 |
| COG ID | Name | Functional Category | % Frequency in 190 Family Scaffolds |
|---|---|---|---|
| COG2818 | 3-methyladenine DNA glycosylase Tag | Replication, recombination and repair [L] | 56.84 |
| COG0580 | Glycerol uptake facilitator or related aquaporin (Major Intrinsic protein Family) | Carbohydrate transport and metabolism [G] | 27.89 |
| COG2385 | Peptidoglycan hydrolase (amidase) enhancer domain SpoIID | Cell wall/membrane/envelope biogenesis [M] | 4.74 |
| COG0508 | Pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide acyltransferase (E2) component | Energy production and conversion [C] | 0.53 |
| COG0753 | Catalase | Inorganic ion transport and metabolism [P] | 0.53 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 94.21 % |
| Unclassified | root | N/A | 5.79 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2067725003|GPWSG_F5G3JLY01CLP4D | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 507 | Open in IMG/M |
| 3300000364|INPhiseqgaiiFebDRAFT_101806894 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 558 | Open in IMG/M |
| 3300000364|INPhiseqgaiiFebDRAFT_101809377 | All Organisms → cellular organisms → Bacteria | 507 | Open in IMG/M |
| 3300000956|JGI10216J12902_101581413 | Not Available | 1897 | Open in IMG/M |
| 3300000956|JGI10216J12902_107746031 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1693 | Open in IMG/M |
| 3300000956|JGI10216J12902_109668573 | All Organisms → cellular organisms → Bacteria | 1354 | Open in IMG/M |
| 3300000956|JGI10216J12902_123333634 | Not Available | 711 | Open in IMG/M |
| 3300001536|A1565W1_10043438 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 2441 | Open in IMG/M |
| 3300002568|C688J35102_118591328 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 575 | Open in IMG/M |
| 3300003319|soilL2_10095043 | All Organisms → cellular organisms → Bacteria | 1200 | Open in IMG/M |
| 3300003319|soilL2_10156673 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3750 | Open in IMG/M |
| 3300003322|rootL2_10156135 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1693 | Open in IMG/M |
| 3300003324|soilH2_10372837 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1001 | Open in IMG/M |
| 3300004081|Ga0063454_100834233 | All Organisms → cellular organisms → Bacteria | 718 | Open in IMG/M |
| 3300004114|Ga0062593_101459224 | All Organisms → cellular organisms → Bacteria | 735 | Open in IMG/M |
| 3300004114|Ga0062593_103013634 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 539 | Open in IMG/M |
| 3300004463|Ga0063356_100084753 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3368 | Open in IMG/M |
| 3300004479|Ga0062595_100040249 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2034 | Open in IMG/M |
| 3300004479|Ga0062595_100178584 | All Organisms → cellular organisms → Bacteria | 1281 | Open in IMG/M |
| 3300004479|Ga0062595_100681341 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 821 | Open in IMG/M |
| 3300004479|Ga0062595_101250391 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 664 | Open in IMG/M |
| 3300004479|Ga0062595_101746669 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 588 | Open in IMG/M |
| 3300004780|Ga0062378_10065539 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 831 | Open in IMG/M |
| 3300005093|Ga0062594_100868540 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 846 | Open in IMG/M |
| 3300005172|Ga0066683_10292893 | All Organisms → cellular organisms → Bacteria | 1011 | Open in IMG/M |
| 3300005180|Ga0066685_10778115 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 650 | Open in IMG/M |
| 3300005329|Ga0070683_101103543 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 762 | Open in IMG/M |
| 3300005329|Ga0070683_102082653 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 545 | Open in IMG/M |
| 3300005332|Ga0066388_100367170 | All Organisms → cellular organisms → Bacteria | 2086 | Open in IMG/M |
| 3300005336|Ga0070680_100265053 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1454 | Open in IMG/M |
| 3300005338|Ga0068868_101201724 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 701 | Open in IMG/M |
| 3300005406|Ga0070703_10014512 | All Organisms → cellular organisms → Bacteria | 2245 | Open in IMG/M |
| 3300005406|Ga0070703_10282247 | All Organisms → cellular organisms → Bacteria | 686 | Open in IMG/M |
| 3300005439|Ga0070711_100214725 | All Organisms → cellular organisms → Bacteria | 1492 | Open in IMG/M |
| 3300005440|Ga0070705_100120237 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1695 | Open in IMG/M |
| 3300005440|Ga0070705_101729853 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 529 | Open in IMG/M |
| 3300005444|Ga0070694_100052150 | All Organisms → cellular organisms → Bacteria | 2764 | Open in IMG/M |
| 3300005445|Ga0070708_100087239 | All Organisms → cellular organisms → Bacteria | 2835 | Open in IMG/M |
| 3300005445|Ga0070708_100142291 | All Organisms → cellular organisms → Bacteria | 2225 | Open in IMG/M |
| 3300005445|Ga0070708_100221800 | All Organisms → cellular organisms → Bacteria | 1773 | Open in IMG/M |
| 3300005445|Ga0070708_101158457 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 724 | Open in IMG/M |
| 3300005445|Ga0070708_101326173 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 672 | Open in IMG/M |
| 3300005467|Ga0070706_100274534 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1573 | Open in IMG/M |
| 3300005467|Ga0070706_100496159 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1136 | Open in IMG/M |
| 3300005468|Ga0070707_100474279 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli | 1213 | Open in IMG/M |
| 3300005468|Ga0070707_100933358 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 833 | Open in IMG/M |
| 3300005545|Ga0070695_100038759 | All Organisms → cellular organisms → Bacteria | 3010 | Open in IMG/M |
| 3300005545|Ga0070695_100797371 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 756 | Open in IMG/M |
| 3300005554|Ga0066661_10549526 | All Organisms → cellular organisms → Bacteria | 691 | Open in IMG/M |
| 3300005563|Ga0068855_102583602 | All Organisms → cellular organisms → Bacteria | 504 | Open in IMG/M |
| 3300005569|Ga0066705_10416008 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 842 | Open in IMG/M |
| 3300005598|Ga0066706_10245570 | All Organisms → cellular organisms → Bacteria | 1392 | Open in IMG/M |
| 3300005616|Ga0068852_102700196 | All Organisms → cellular organisms → Bacteria | 516 | Open in IMG/M |
| 3300005617|Ga0068859_100253807 | All Organisms → cellular organisms → Bacteria | 1849 | Open in IMG/M |
| 3300005618|Ga0068864_100142676 | All Organisms → cellular organisms → Bacteria | 2162 | Open in IMG/M |
| 3300005719|Ga0068861_100522026 | All Organisms → cellular organisms → Bacteria | 1077 | Open in IMG/M |
| 3300005764|Ga0066903_102603074 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 981 | Open in IMG/M |
| 3300005764|Ga0066903_105588661 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 662 | Open in IMG/M |
| 3300005985|Ga0081539_10022979 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 4101 | Open in IMG/M |
| 3300006031|Ga0066651_10380749 | All Organisms → cellular organisms → Bacteria | 754 | Open in IMG/M |
| 3300006046|Ga0066652_100437909 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae | 1200 | Open in IMG/M |
| 3300006173|Ga0070716_100203481 | All Organisms → cellular organisms → Bacteria | 1318 | Open in IMG/M |
| 3300006173|Ga0070716_101815190 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 505 | Open in IMG/M |
| 3300006175|Ga0070712_100513125 | All Organisms → cellular organisms → Bacteria | 1006 | Open in IMG/M |
| 3300006573|Ga0074055_10004609 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 665 | Open in IMG/M |
| 3300006576|Ga0074047_11288872 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 572 | Open in IMG/M |
| 3300006604|Ga0074060_12053292 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 728 | Open in IMG/M |
| 3300006755|Ga0079222_10672910 | All Organisms → cellular organisms → Bacteria | 811 | Open in IMG/M |
| 3300006804|Ga0079221_10877370 | All Organisms → cellular organisms → Bacteria | 655 | Open in IMG/M |
| 3300006806|Ga0079220_10936126 | All Organisms → cellular organisms → Bacteria | 678 | Open in IMG/M |
| 3300006854|Ga0075425_101120628 | All Organisms → cellular organisms → Bacteria | 896 | Open in IMG/M |
| 3300006903|Ga0075426_10686997 | All Organisms → cellular organisms → Bacteria | 767 | Open in IMG/M |
| 3300006903|Ga0075426_10744477 | Not Available | 736 | Open in IMG/M |
| 3300006914|Ga0075436_101385439 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 533 | Open in IMG/M |
| 3300006954|Ga0079219_10317866 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 977 | Open in IMG/M |
| 3300009011|Ga0105251_10097218 | Not Available | 1348 | Open in IMG/M |
| 3300009012|Ga0066710_100805692 | All Organisms → cellular organisms → Bacteria | 1440 | Open in IMG/M |
| 3300009089|Ga0099828_11963010 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 513 | Open in IMG/M |
| 3300009093|Ga0105240_12029758 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 597 | Open in IMG/M |
| 3300009098|Ga0105245_10612670 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1116 | Open in IMG/M |
| 3300009162|Ga0075423_10578490 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1183 | Open in IMG/M |
| 3300009789|Ga0126307_10542256 | All Organisms → cellular organisms → Bacteria | 939 | Open in IMG/M |
| 3300009789|Ga0126307_11451275 | Not Available | 556 | Open in IMG/M |
| 3300009789|Ga0126307_11603797 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 528 | Open in IMG/M |
| 3300010039|Ga0126309_10059626 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1855 | Open in IMG/M |
| 3300010040|Ga0126308_10748733 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 674 | Open in IMG/M |
| 3300010041|Ga0126312_10488893 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 880 | Open in IMG/M |
| 3300010044|Ga0126310_10101031 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1747 | Open in IMG/M |
| 3300010166|Ga0126306_11551769 | Not Available | 550 | Open in IMG/M |
| 3300010329|Ga0134111_10283661 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 687 | Open in IMG/M |
| 3300010366|Ga0126379_12955803 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 569 | Open in IMG/M |
| 3300010373|Ga0134128_12326705 | Not Available | 590 | Open in IMG/M |
| 3300010375|Ga0105239_12318895 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 625 | Open in IMG/M |
| 3300010397|Ga0134124_10490574 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1186 | Open in IMG/M |
| 3300010397|Ga0134124_13041436 | Not Available | 513 | Open in IMG/M |
| 3300011431|Ga0137438_1061621 | All Organisms → cellular organisms → Bacteria | 1121 | Open in IMG/M |
| 3300011444|Ga0137463_1005648 | All Organisms → cellular organisms → Bacteria | 4159 | Open in IMG/M |
| 3300011444|Ga0137463_1195951 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 757 | Open in IMG/M |
| 3300011998|Ga0120114_1002041 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 5940 | Open in IMG/M |
| 3300012001|Ga0120167_1129065 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 502 | Open in IMG/M |
| 3300012074|Ga0154001_1029626 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 848 | Open in IMG/M |
| 3300012093|Ga0136632_10336294 | All Organisms → cellular organisms → Bacteria | 678 | Open in IMG/M |
| 3300012208|Ga0137376_10035679 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3984 | Open in IMG/M |
| 3300012209|Ga0137379_11472404 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 582 | Open in IMG/M |
| 3300012211|Ga0137377_10663156 | All Organisms → cellular organisms → Bacteria | 979 | Open in IMG/M |
| 3300012212|Ga0150985_109767556 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 709 | Open in IMG/M |
| 3300012469|Ga0150984_114397444 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 556 | Open in IMG/M |
| 3300012530|Ga0136635_10075554 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli | 1045 | Open in IMG/M |
| 3300012668|Ga0157216_10025822 | All Organisms → cellular organisms → Bacteria | 3035 | Open in IMG/M |
| 3300012683|Ga0137398_10852785 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 636 | Open in IMG/M |
| 3300012930|Ga0137407_11024996 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 782 | Open in IMG/M |
| 3300012944|Ga0137410_10731526 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 826 | Open in IMG/M |
| 3300012951|Ga0164300_10244029 | All Organisms → cellular organisms → Bacteria | 908 | Open in IMG/M |
| 3300012981|Ga0168316_111351 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1554 | Open in IMG/M |
| 3300012984|Ga0164309_10030896 | All Organisms → cellular organisms → Bacteria | 2937 | Open in IMG/M |
| 3300012985|Ga0164308_10414790 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1105 | Open in IMG/M |
| 3300012988|Ga0164306_10044336 | All Organisms → cellular organisms → Bacteria | 2653 | Open in IMG/M |
| 3300013100|Ga0157373_11485402 | Not Available | 517 | Open in IMG/M |
| 3300013297|Ga0157378_10339398 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1464 | Open in IMG/M |
| 3300013501|Ga0120154_1161394 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 501 | Open in IMG/M |
| 3300013503|Ga0120127_10008967 | All Organisms → cellular organisms → Bacteria | 1630 | Open in IMG/M |
| 3300013765|Ga0120172_1099528 | All Organisms → cellular organisms → Bacteria | 707 | Open in IMG/M |
| 3300014497|Ga0182008_10292882 | All Organisms → cellular organisms → Bacteria | 850 | Open in IMG/M |
| 3300014497|Ga0182008_10653873 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 596 | Open in IMG/M |
| 3300015162|Ga0167653_1022206 | All Organisms → cellular organisms → Bacteria | 1219 | Open in IMG/M |
| 3300015192|Ga0167646_1056966 | All Organisms → cellular organisms → Bacteria | 886 | Open in IMG/M |
| 3300015192|Ga0167646_1099613 | All Organisms → cellular organisms → Bacteria | 592 | Open in IMG/M |
| 3300015199|Ga0167647_1005044 | All Organisms → cellular organisms → Bacteria | 4416 | Open in IMG/M |
| 3300015242|Ga0137412_11004643 | Not Available | 597 | Open in IMG/M |
| 3300015371|Ga0132258_10049398 | All Organisms → cellular organisms → Bacteria | 9610 | Open in IMG/M |
| 3300015371|Ga0132258_10636142 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Caulobacterales → Caulobacteraceae → Caulobacter → unclassified Caulobacter → Caulobacter sp. OV484 | 2682 | Open in IMG/M |
| 3300015371|Ga0132258_13339170 | All Organisms → cellular organisms → Bacteria | 1103 | Open in IMG/M |
| 3300015372|Ga0132256_103344033 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 539 | Open in IMG/M |
| 3300015372|Ga0132256_103764557 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 510 | Open in IMG/M |
| 3300018059|Ga0184615_10182708 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli | 1182 | Open in IMG/M |
| 3300018071|Ga0184618_10085610 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1213 | Open in IMG/M |
| 3300018076|Ga0184609_10268030 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 799 | Open in IMG/M |
| 3300018431|Ga0066655_10382303 | All Organisms → cellular organisms → Bacteria | 927 | Open in IMG/M |
| 3300018433|Ga0066667_10767161 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 816 | Open in IMG/M |
| 3300018465|Ga0190269_10645098 | All Organisms → cellular organisms → Bacteria | 727 | Open in IMG/M |
| 3300018465|Ga0190269_10970841 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 638 | Open in IMG/M |
| 3300018476|Ga0190274_11282679 | All Organisms → cellular organisms → Bacteria | 819 | Open in IMG/M |
| 3300018476|Ga0190274_12400188 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 624 | Open in IMG/M |
| 3300018920|Ga0190273_12332174 | Not Available | 507 | Open in IMG/M |
| 3300019377|Ga0190264_11440939 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 593 | Open in IMG/M |
| 3300019377|Ga0190264_11450974 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 592 | Open in IMG/M |
| 3300019767|Ga0190267_11129200 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 566 | Open in IMG/M |
| 3300019767|Ga0190267_11451571 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 525 | Open in IMG/M |
| 3300019888|Ga0193751_1088686 | All Organisms → cellular organisms → Bacteria | 1216 | Open in IMG/M |
| 3300020022|Ga0193733_1077695 | All Organisms → cellular organisms → Bacteria | 932 | Open in IMG/M |
| 3300021080|Ga0210382_10033497 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1945 | Open in IMG/M |
| 3300021080|Ga0210382_10048289 | All Organisms → cellular organisms → Bacteria | 1667 | Open in IMG/M |
| 3300021080|Ga0210382_10454041 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 568 | Open in IMG/M |
| 3300021363|Ga0193699_10048543 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1637 | Open in IMG/M |
| 3300021413|Ga0193750_1023500 | All Organisms → cellular organisms → Bacteria | 1454 | Open in IMG/M |
| 3300022534|Ga0224452_1217909 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 586 | Open in IMG/M |
| 3300024284|Ga0247671_1002265 | All Organisms → cellular organisms → Bacteria | 4087 | Open in IMG/M |
| 3300025885|Ga0207653_10195552 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 761 | Open in IMG/M |
| 3300025904|Ga0207647_10416717 | All Organisms → cellular organisms → Bacteria | 755 | Open in IMG/M |
| 3300025910|Ga0207684_10002995 | All Organisms → cellular organisms → Bacteria | 16739 | Open in IMG/M |
| 3300025910|Ga0207684_10005661 | All Organisms → cellular organisms → Bacteria | 11478 | Open in IMG/M |
| 3300025910|Ga0207684_10078502 | All Organisms → cellular organisms → Bacteria | 2808 | Open in IMG/M |
| 3300025910|Ga0207684_10392681 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1193 | Open in IMG/M |
| 3300025912|Ga0207707_10147791 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 2055 | Open in IMG/M |
| 3300025913|Ga0207695_10835575 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 801 | Open in IMG/M |
| 3300025917|Ga0207660_10164099 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1716 | Open in IMG/M |
| 3300025922|Ga0207646_10032004 | All Organisms → cellular organisms → Bacteria | 4761 | Open in IMG/M |
| 3300025935|Ga0207709_11074222 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 660 | Open in IMG/M |
| 3300025939|Ga0207665_10783792 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 753 | Open in IMG/M |
| 3300025944|Ga0207661_10892185 | All Organisms → cellular organisms → Bacteria | 819 | Open in IMG/M |
| 3300026067|Ga0207678_10650069 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 926 | Open in IMG/M |
| 3300026088|Ga0207641_10659952 | All Organisms → cellular organisms → Bacteria | 1028 | Open in IMG/M |
| 3300026118|Ga0207675_101318893 | All Organisms → cellular organisms → Bacteria | 742 | Open in IMG/M |
| 3300026320|Ga0209131_1109636 | All Organisms → cellular organisms → Bacteria | 1445 | Open in IMG/M |
| 3300026538|Ga0209056_10404261 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 835 | Open in IMG/M |
| 3300027765|Ga0209073_10287522 | All Organisms → cellular organisms → Bacteria | 648 | Open in IMG/M |
| 3300028709|Ga0307279_10046851 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 695 | Open in IMG/M |
| 3300028711|Ga0307293_10293155 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 516 | Open in IMG/M |
| 3300028714|Ga0307309_10123830 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 636 | Open in IMG/M |
| 3300028771|Ga0307320_10080633 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1223 | Open in IMG/M |
| 3300028803|Ga0307281_10277372 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 621 | Open in IMG/M |
| 3300028828|Ga0307312_10153874 | All Organisms → cellular organisms → Bacteria | 1461 | Open in IMG/M |
| 3300028878|Ga0307278_10125805 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1151 | Open in IMG/M |
| 3300031152|Ga0307501_10127372 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 671 | Open in IMG/M |
| 3300031740|Ga0307468_100431654 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1019 | Open in IMG/M |
| 3300031820|Ga0307473_10114495 | All Organisms → cellular organisms → Bacteria | 1467 | Open in IMG/M |
| 3300031995|Ga0307409_102921125 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 505 | Open in IMG/M |
| 3300032002|Ga0307416_101569627 | All Organisms → cellular organisms → Bacteria | 764 | Open in IMG/M |
| 3300032180|Ga0307471_101164566 | All Organisms → cellular organisms → Bacteria | 936 | Open in IMG/M |
| 3300034178|Ga0364934_0314933 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 593 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 14.21% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 13.16% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 7.89% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 4.21% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 4.21% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 4.21% |
| Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 3.16% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 3.16% |
| Glacier Forefield Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil | 2.63% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 2.63% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 2.63% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 2.63% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 2.11% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 1.58% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 1.58% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.58% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.58% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.58% |
| Sugarcane Root And Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Sugarcane Root And Bulk Soil | 1.58% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.58% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.58% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.58% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 1.58% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.58% |
| Polar Desert Sand | Environmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand | 1.05% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 1.05% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 1.05% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.05% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 1.05% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 1.05% |
| Wetland Sediment | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Wetland Sediment | 0.53% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.53% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 0.53% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.53% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.53% |
| Weathered Mine Tailings | Environmental → Terrestrial → Geologic → Mine → Unclassified → Weathered Mine Tailings | 0.53% |
| Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 0.53% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 0.53% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.53% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 0.53% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.53% |
| Sugarcane Root And Bulk Soil | Host-Associated → Plants → Rhizome → Unclassified → Unclassified → Sugarcane Root And Bulk Soil | 0.53% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.53% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.53% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.53% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.53% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 0.53% |
| Attine Ant Fungus Gardens | Host-Associated → Fungi → Mycelium → Unclassified → Unclassified → Attine Ant Fungus Gardens | 0.53% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2067725003 | Soil microbial communities from Great Prairies - Wisconsin, Switchgrass soil | Environmental | Open in IMG/M |
| 3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300001536 | Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A15-65cm-8A)- 1 week illumina | Environmental | Open in IMG/M |
| 3300002568 | Grasslands soil microbial communities from Hopland, California, USA - 2 | Environmental | Open in IMG/M |
| 3300003319 | Sugarcane bulk soil Sample L2 | Environmental | Open in IMG/M |
| 3300003322 | Sugarcane root Sample L2 | Host-Associated | Open in IMG/M |
| 3300003324 | Sugarcane bulk soil Sample H2 | Environmental | Open in IMG/M |
| 3300004081 | Grasslands soil microbial communities from Hopland, California, USA - 2 (version 2) | Environmental | Open in IMG/M |
| 3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
| 3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
| 3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
| 3300004780 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T0Bare1Fresh | Environmental | Open in IMG/M |
| 3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
| 3300005172 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 | Environmental | Open in IMG/M |
| 3300005180 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 | Environmental | Open in IMG/M |
| 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Environmental | Open in IMG/M |
| 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Host-Associated | Open in IMG/M |
| 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Environmental | Open in IMG/M |
| 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
| 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Environmental | Open in IMG/M |
| 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Environmental | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
| 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
| 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Environmental | Open in IMG/M |
| 3300005554 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 | Environmental | Open in IMG/M |
| 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Host-Associated | Open in IMG/M |
| 3300005569 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 | Environmental | Open in IMG/M |
| 3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
| 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Host-Associated | Open in IMG/M |
| 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Host-Associated | Open in IMG/M |
| 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Host-Associated | Open in IMG/M |
| 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Host-Associated | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Host-Associated | Open in IMG/M |
| 3300006031 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100 | Environmental | Open in IMG/M |
| 3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006573 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLAC (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006576 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLPA (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006604 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLMB (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
| 3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
| 3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
| 3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
| 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Host-Associated | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009789 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot28 | Environmental | Open in IMG/M |
| 3300010039 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot56 | Environmental | Open in IMG/M |
| 3300010040 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot55 | Environmental | Open in IMG/M |
| 3300010041 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot104A | Environmental | Open in IMG/M |
| 3300010044 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot60 | Environmental | Open in IMG/M |
| 3300010166 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot27 | Environmental | Open in IMG/M |
| 3300010329 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_11112015 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
| 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
| 3300011431 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT157_2 | Environmental | Open in IMG/M |
| 3300011444 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT800_2 | Environmental | Open in IMG/M |
| 3300011998 | Permafrost microbial communities from Nunavut, Canada - A30_35cm_6M | Environmental | Open in IMG/M |
| 3300012001 | Permafrost microbial communities from Nunavut, Canada - A24_80cm_12M | Environmental | Open in IMG/M |
| 3300012074 | Attine ant fungus gardens microbial communities from New Jersey, USA - TSNJ085 MetaG | Host-Associated | Open in IMG/M |
| 3300012093 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ611 (21.06) | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
| 3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
| 3300012530 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ85 (21.06) | Environmental | Open in IMG/M |
| 3300012668 | Arctic soils microbial communities. Combined Assembly of 23 SPs | Environmental | Open in IMG/M |
| 3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012951 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MG | Environmental | Open in IMG/M |
| 3300012981 | Weathered mine tailings microbial communities from Hibbing, Minnesota, USA - DT8 | Environmental | Open in IMG/M |
| 3300012984 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MG | Environmental | Open in IMG/M |
| 3300012985 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MG | Environmental | Open in IMG/M |
| 3300012988 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MG | Environmental | Open in IMG/M |
| 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Host-Associated | Open in IMG/M |
| 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
| 3300013501 | Permafrost microbial communities from Nunavut, Canada - A35_65cm_0.25M | Environmental | Open in IMG/M |
| 3300013503 | Permafrost microbial communities from Nunavut, Canada - A23_5cm_12M | Environmental | Open in IMG/M |
| 3300013765 | Permafrost microbial communities from Nunavut, Canada - A30_80cm_6M | Environmental | Open in IMG/M |
| 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Host-Associated | Open in IMG/M |
| 3300015162 | Arctic soil microbial communities from a glacier forefield, Storglaci?ren, Tarfala, Sweden (Sample st-4c, rock/ice/stream interface) | Environmental | Open in IMG/M |
| 3300015192 | Arctic soil microbial communities from a glacier forefield, Storglaci?ren, Tarfala, Sweden (Sample st-2a, rock/snow interface) | Environmental | Open in IMG/M |
| 3300015199 | Arctic soil microbial communities from a glacier forefield, Storglaci?ren, Tarfala, Sweden (Sample st-2c, rock/snow interface) | Environmental | Open in IMG/M |
| 3300015242 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300018059 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_65_coex | Environmental | Open in IMG/M |
| 3300018071 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_b1 | Environmental | Open in IMG/M |
| 3300018076 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_coex | Environmental | Open in IMG/M |
| 3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300018465 | Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 IS | Environmental | Open in IMG/M |
| 3300018476 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 T | Environmental | Open in IMG/M |
| 3300018920 | Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 IS | Environmental | Open in IMG/M |
| 3300019377 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 112 T | Environmental | Open in IMG/M |
| 3300019767 | Populus adjacent soil microbial communities from riparian zone of Oak Creek, Arizona, USA - 239 T | Environmental | Open in IMG/M |
| 3300019888 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1c2 | Environmental | Open in IMG/M |
| 3300020022 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1s2 | Environmental | Open in IMG/M |
| 3300021080 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_coex redo | Environmental | Open in IMG/M |
| 3300021363 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3c2 | Environmental | Open in IMG/M |
| 3300021413 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1c1 | Environmental | Open in IMG/M |
| 3300022534 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30_b1 | Environmental | Open in IMG/M |
| 3300024284 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK12 | Environmental | Open in IMG/M |
| 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026320 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026538 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 (SPAdes) | Environmental | Open in IMG/M |
| 3300027765 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 (SPAdes) | Environmental | Open in IMG/M |
| 3300028709 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_118 | Environmental | Open in IMG/M |
| 3300028711 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_150 | Environmental | Open in IMG/M |
| 3300028714 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_196 | Environmental | Open in IMG/M |
| 3300028771 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_369 | Environmental | Open in IMG/M |
| 3300028803 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_120 | Environmental | Open in IMG/M |
| 3300028828 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202 | Environmental | Open in IMG/M |
| 3300028878 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_117 | Environmental | Open in IMG/M |
| 3300031152 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 15_S | Environmental | Open in IMG/M |
| 3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
| 3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
| 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Host-Associated | Open in IMG/M |
| 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Host-Associated | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300034178 | Sediment microbial communities from East River floodplain, Colorado, United States - 27_j17 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| GPWSG_00820710 | 2067725003 | Soil | MIIIECSWCDAELALETLVEASVDCPDCRITIHLAPDLDPIVAVAA |
| INPhiseqgaiiFebDRAFT_1018068942 | 3300000364 | Soil | MIFIECSWCDGEVALEGLDATSVDCPECRVSVEIAPDPEALAAAA* |
| INPhiseqgaiiFebDRAFT_1018093772 | 3300000364 | Soil | MITIECSWCDTDLVLESLDATSVDCPECLVTVEMASDPELVALAA* |
| JGI10216J12902_1015814132 | 3300000956 | Soil | MITIECSLCDTDLTLESLDATSVDCPECRVSVEIAPDPEPLALAA* |
| JGI10216J12902_1077460312 | 3300000956 | Soil | MITIECSLCDSDVTLESLDATSVDCPECRVSVEIAPDPEPLALAA* |
| JGI10216J12902_1096685732 | 3300000956 | Soil | MIFIECSWCDGEVALDGLDATSADCPECLVSVEIAPDPEALAAAA* |
| JGI10216J12902_1233336342 | 3300000956 | Soil | MITIECSWCDTDLTLDSLDATSVDCPECRVTVDIADDPEPLALAA* |
| A1565W1_100434383 | 3300001536 | Permafrost | MIIIECSWCDAELALETLVETSVDCPDCRVTIDLAPDADLIAVAA* |
| C688J35102_1185913282 | 3300002568 | Soil | MITIECTWCEAELTLDSLDAPILDCPDCRIAVEFAPEPETLAIAA* |
| soilL2_100950432 | 3300003319 | Sugarcane Root And Bulk Soil | MITLECAWCDAEVRIESVDAERVDCPDCLVSVEFAADRTELAAAA* |
| soilL2_101566735 | 3300003319 | Sugarcane Root And Bulk Soil | VAQTGLILPAMITIECSWCDGELALDDLDATSVDCPDCRITVEIAPDPDALALAA* |
| rootL2_101561353 | 3300003322 | Sugarcane Root And Bulk Soil | MITLECAWCDAELALDDLDATSVECADCRIVVEIAPDPEPLALAA* |
| soilH2_103728372 | 3300003324 | Sugarcane Root And Bulk Soil | MITFECSWCDGELALETLDATSVECPECRITVEIAPDPEPLAIAA* |
| Ga0063454_1008342332 | 3300004081 | Soil | MITIECSWCDADLILDSLDAASVDCPACRVTVDLAPDPEPMAMAA* |
| Ga0062593_1014592242 | 3300004114 | Soil | MITIECSWCDTDLVLESLDATSVDCPECRVTVEIASDPEALALAA* |
| Ga0062593_1030136342 | 3300004114 | Soil | MITIECTWCDADLALDSLDETVVDCPDCRITVEIAPDPEPIAIAA* |
| Ga0063356_1000847534 | 3300004463 | Arabidopsis Thaliana Rhizosphere | MIIIECSWCDAELALETLVEASVDCPDCRITIHLAPDLDPIVAVAA* |
| Ga0062595_1000402491 | 3300004479 | Soil | MITIECSWCEADLALERIDATTVECPDCQVTVEFAPDPEPLAIAA* |
| Ga0062595_1001785843 | 3300004479 | Soil | MITIECSWCDTDLTLESLDATSVDCQECLVTVDIAPDPEPLAKAA* |
| Ga0062595_1006813412 | 3300004479 | Soil | MITIECTWCDAELALETLVETSVDCPDCRITVDIAPDPDTIVIAVAA* |
| Ga0062595_1012503912 | 3300004479 | Soil | MIHIECSWCDGDLVLDGLDAVSVDCPDCRVTVDLAPDPDTLALAA* |
| Ga0062595_1017466692 | 3300004479 | Soil | MITIECSWCDTELVLERLDAPSVDCPECRVTIDFAPEPEPLAIAA* |
| Ga0062378_100655391 | 3300004780 | Wetland Sediment | MITIDCTWCDAELVLDRLDATSVDCADCRITVDIATDPEPIAVAA* |
| Ga0062594_1008685402 | 3300005093 | Soil | MITIECSWCDTDLVLESLDAPSVDCPECRVTVEIASDREALALAA* |
| Ga0066683_102928931 | 3300005172 | Soil | MITIECTWCDAELALDGLEATSVDCPDCRIIVEIAPDPEPLAI |
| Ga0066685_107781152 | 3300005180 | Soil | MITIECTWCDAELALNDLDATSVDCPDCRITVEIAPDPEPLAIAA* |
| Ga0070683_1011035432 | 3300005329 | Corn Rhizosphere | MITIECTWCDADLVLDGLDASSVDCPDCRITIDIVSDPEPIAIAA* |
| Ga0070683_1020826532 | 3300005329 | Corn Rhizosphere | MITIECTWCEAELALDSLDATSVDCADCRITVDIATDPEPIALAA* |
| Ga0066388_1003671702 | 3300005332 | Tropical Forest Soil | MITLECAWCDAELAIDNLDAMTIECADCRIVVEIAPDSEPLALAA* |
| Ga0070680_1002650532 | 3300005336 | Corn Rhizosphere | MIHIECSWCDADLVLDSLDAASVDCPDCRVTVDIAPDPDSLSLALAA* |
| Ga0068868_1012017241 | 3300005338 | Miscanthus Rhizosphere | MITIECTWCEAELALDSLDASSVDCADCRITVDIAIDPEPIALAA* |
| Ga0070703_100145122 | 3300005406 | Corn, Switchgrass And Miscanthus Rhizosphere | MNIIECPWCEAELALETLVETSVNCPDCRVTVDFAPDPAPIAIAA* |
| Ga0070703_102822472 | 3300005406 | Corn, Switchgrass And Miscanthus Rhizosphere | MIHIECSWCDADLVLDSLDAASVDCPDCRVTVDIAPDPDSLALAA* |
| Ga0070711_1002147252 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | MITIECSWCDTDLVLESLDAPSVDCPECRITVEIASDPEALALAA* |
| Ga0070705_1001202371 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | REAPAMNIIECPWCEAELALETLVETLVETSVDCPDCRVTVDFAPDPAPIAIAA* |
| Ga0070705_1017298531 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | MITIECTWCDAELALDSLDATSVDCPDCRVTVEIAADPEPIAIAA* |
| Ga0070694_1000521503 | 3300005444 | Corn, Switchgrass And Miscanthus Rhizosphere | MNIIECPWCEAELALETLVETSVDCPDCRVTVDFAPDPAPIAVAA* |
| Ga0070708_1000872394 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MITIECTWCDAELALDGLEATNVDCPDCRITVEIAPDPEPLAVAA* |
| Ga0070708_1001422912 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MITIECTWCDADLALDSLDATSVDCADCRITVEIAPDPEPIAIAA* |
| Ga0070708_1002218001 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MITVECTWCDAELALDSLDATSVDCPDCRITVEIAADPEPIAIAA* |
| Ga0070708_1011584572 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MILIECPWCEAELAVETLDEASVDCPDCRITVDFAPEPAPIAVAA* |
| Ga0070708_1013261731 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MITIECTWCDAELALDSLEATSVDCPDCRVTVEIAADPEPIAIAA* |
| Ga0070706_1002745341 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | ECTWCDAELALDGLEATNVDCPDCRITVEIAPDPEPLAVAV* |
| Ga0070706_1004961593 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | RPMITIECSWCEADLALDSLDALSVDCPECRVTVDIAPDPDSLALAA* |
| Ga0070707_1004742792 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | MITIECTWCDAELALETLVETSVDCPDCRITIDIAPDPDTIVVAVAA* |
| Ga0070707_1009333582 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | MILIECVWCEAELAVETLDEASVDCPDCRITVDFAPEPAPIAVAA* |
| Ga0070695_1000387595 | 3300005545 | Corn, Switchgrass And Miscanthus Rhizosphere | MNIIECPWCEAELALETLVETSVDCPDCRVTVDFAPDPAPIAIAA* |
| Ga0070695_1007973711 | 3300005545 | Corn, Switchgrass And Miscanthus Rhizosphere | MIHIECSWCDADLVLDSLDAASVDCPDCRVTVDIAPDPDSL |
| Ga0066661_105495262 | 3300005554 | Soil | MILIECPWCETDLAVETLEASSVDCPDCPITIDFAPDPAPIAVAA* |
| Ga0068855_1025836022 | 3300005563 | Corn Rhizosphere | MITIECTWCDADLALDSLDETVVDCPDCRITVEIAPD |
| Ga0066705_104160082 | 3300005569 | Soil | MITIECTWCDADLVLDRLDAPSVDCPDCRLTIDIASDPEPIAIAA* |
| Ga0066706_102455702 | 3300005598 | Soil | MITIECTWCDADLVLDSLDTSSVDCPDCRITIDIASDPEPIAIAA* |
| Ga0068852_1027001962 | 3300005616 | Corn Rhizosphere | MITIECSWCDTDLVLESLDAPSVDCPECRVTVEIASDPEA |
| Ga0068859_1002538071 | 3300005617 | Switchgrass Rhizosphere | MITIECTWCEAELALDSLDATSVDCADCRITVDIA |
| Ga0068864_1001426762 | 3300005618 | Switchgrass Rhizosphere | MITIECTWCDAELVLDSLDAEVIDCPDCRITVDIARDPEPIAIAA* |
| Ga0068861_1005220262 | 3300005719 | Switchgrass Rhizosphere | MITIECSWCEADLALDSLDALSVDCPECRVTVDIAPDPDSLALAA* |
| Ga0066903_1026030742 | 3300005764 | Tropical Forest Soil | MIHIECSWCDADVVLESLDANRVDCPECLVSVEFAADTETLALAA* |
| Ga0066903_1055886612 | 3300005764 | Tropical Forest Soil | SRRAAILPAMILIECSWCDGDVALDGLDASSVDCPECCVSVEIASEPEVLAAAA* |
| Ga0081539_100229793 | 3300005985 | Tabebuia Heterophylla Rhizosphere | MITIECSWCDAELALDGLDATSVDCPDCRISVEIAADPEPVALAA* |
| Ga0066651_103807492 | 3300006031 | Soil | MLRRMITIECSWCDAELVVEGLDAATLECPDCRITVDIADDPEPLAAAA* |
| Ga0066652_1004379092 | 3300006046 | Soil | MIIIECSWCDGEVALDAIDATSVDCPDCLVSVEIAPDPEVLAAAA* |
| Ga0070716_1002034813 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | MILIECPWCETDLAIETLEASSVECPDCCITIDFAPDPAPLAVAA* |
| Ga0070716_1018151902 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | MILIECSWCDGDVALESLDATSVDCPECLVTVEFAPDPETLALAA* |
| Ga0070712_1005131252 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | MILIECSWCDGDVALESLDATSVDCPECLVSVELAPDPEVLAVAA* |
| Ga0074055_100046092 | 3300006573 | Soil | MITIECSWCDTDLVLESLDATSVDCPECLVTVEIASDPEALALAA* |
| Ga0074047_112888722 | 3300006576 | Soil | MITIECSWCDTDLVLESLDATSVDCPECLVSVEIASDAEALTLA |
| Ga0074060_120532921 | 3300006604 | Soil | DPPMITIECSWCDTDLVLESLDATSVDCPECRVTVEIASDPEVLALAA* |
| Ga0079222_106729102 | 3300006755 | Agricultural Soil | MITIECTWCEAELALDTLDVDRVDCPDCLVSVELAADPEVLAIAA* |
| Ga0079221_108773702 | 3300006804 | Agricultural Soil | MITIECTWCDGELALDSLDATTIDCADCGVSVEIAPDRDELALAA* |
| Ga0079220_109361262 | 3300006806 | Agricultural Soil | MITIECSWCDAELALDDLDAPSVECADCRIVVEIAADPQSLALAA* |
| Ga0075425_1011206282 | 3300006854 | Populus Rhizosphere | MITIECTWCDAELALDGLEATSVDCPDCRVTVEIAPDREPLAIAA* |
| Ga0075426_106869972 | 3300006903 | Populus Rhizosphere | MITIECSWCDKDLTLDRLDATSVDCPECRITVDIADDPEPLALAA* |
| Ga0075426_107444772 | 3300006903 | Populus Rhizosphere | VSRAPRIVPRMITIECSWCDTDLALDSLDALSVECPECRITVDIADDPEPIALAA* |
| Ga0075436_1013854391 | 3300006914 | Populus Rhizosphere | MITIECSWCDTDLALDSLDALSVECPECRITVDIADDPEPIALAA* |
| Ga0079219_103178662 | 3300006954 | Agricultural Soil | MITIECSWCDAELALDDLDAPSVECAECRIVVEIAADP |
| Ga0105251_100972182 | 3300009011 | Switchgrass Rhizosphere | MITIECTWCDAELVLDSLDAEVMDCPDCHITVDIARDPEPIAIAA* |
| Ga0066710_1008056922 | 3300009012 | Grasslands Soil | MITIECTWCDADLVLDSLDTSSVDCPDCRITIDIASDPEPIAIAA |
| Ga0099828_119630102 | 3300009089 | Vadose Zone Soil | MIIIECSWCDNELALDGLDATSVECPECLVTVEFADDAQVVAIAA* |
| Ga0105240_120297582 | 3300009093 | Corn Rhizosphere | ITIECSWCDTDLVLESLDAPSVDCPECRVTVEIASDPEALALAA* |
| Ga0105245_106126701 | 3300009098 | Miscanthus Rhizosphere | MITIQCSWCDTDLVLESLDAPSVDCPECRVTVEIASDREALALAA* |
| Ga0075423_105784901 | 3300009162 | Populus Rhizosphere | MITIECTWCDAELALDGLEATSVDCPDCRVTVEIAPDPEPLAIAA* |
| Ga0126307_105422562 | 3300009789 | Serpentine Soil | MITIECTWCDAELVLDSLDATSVDCADCRVTVDLSVDGEPLAVAA* |
| Ga0126307_114512752 | 3300009789 | Serpentine Soil | MITIECTWCDADLTIDGLDATSVECADCRIIVELAPDPVPIAIAA* |
| Ga0126307_116037972 | 3300009789 | Serpentine Soil | MIHIECGWCETELVLASLDAPTIDCPDCQITVEIAADREVLALAA* |
| Ga0126309_100596263 | 3300010039 | Serpentine Soil | MITIECSWCDADLILESLDATTVDCPDCRVTVEIAGDPEPLAVAA* |
| Ga0126308_107487332 | 3300010040 | Serpentine Soil | MITIECSWCDADLILESLDAATVDCPDCRVTVEIAGDPEPLAVAA* |
| Ga0126312_104888932 | 3300010041 | Serpentine Soil | MITVECTWCDADLTIESLDATSVECAECRITVELAADPEPIAIAA* |
| Ga0126310_101010312 | 3300010044 | Serpentine Soil | MITIECTWCEAELVLDSLDADRVDCPDCAVSVEFAQDPEALAIAA* |
| Ga0126306_115517692 | 3300010166 | Serpentine Soil | MIHIECGWCETELVLTSLDAPTIDCPDCQITVEIAADREVLALAA* |
| Ga0134111_102836611 | 3300010329 | Grasslands Soil | MITIECTWCDAELALDGLEATSVDCPDCRIIVEIAPDPEPLAIAA* |
| Ga0126379_129558031 | 3300010366 | Tropical Forest Soil | MILIECSWCDGDVALDGLDASSVDCPECCVSVEIVSEPEVLAAAA* |
| Ga0134128_123267051 | 3300010373 | Terrestrial Soil | MITIECSWCDTDLVLESLDAPSVECPECLVTVEFAADPEPLALAA* |
| Ga0105239_123188951 | 3300010375 | Corn Rhizosphere | MIHIECSWCDADLVLASLDAASVDCPDCRVTVDIAPDPDSLA |
| Ga0134124_104905742 | 3300010397 | Terrestrial Soil | MITIECTWCDAELALDNLDATSVDCRACQISVEIAPDPEPLAIAA* |
| Ga0134124_130414361 | 3300010397 | Terrestrial Soil | MITIECSWCDAELAIDDLDATSVECAECRIVVEFAPDPEPLALAA* |
| Ga0137438_10616212 | 3300011431 | Soil | MITIECTWCDAELALDGLDAASVDCADCRVTVDIAPDPEPIAIAA* |
| Ga0137463_10056485 | 3300011444 | Soil | MITIECTWCDADLALDSLDATSVDCADCRITVEIAPDPELIAIAA* |
| Ga0137463_11959511 | 3300011444 | Soil | MITIECTWCDAELAMDSLDAPSVDCPDCRVTVEIAADPEPIAIAA* |
| Ga0120114_10020417 | 3300011998 | Permafrost | MIIIECSWCDAELALETLVETSVDCPDCRVTIDLAPDADPLAVAA* |
| Ga0120167_11290651 | 3300012001 | Permafrost | AVPMIIIECSWCDAELALETLVETSVDCPDCRVTIDLAPDADLIAVAA* |
| Ga0154001_10296262 | 3300012074 | Attine Ant Fungus Gardens | MIIIECPWCDAELALETLVETSVDCADCRVTVDLAPDPELIAIAA* |
| Ga0136632_103362942 | 3300012093 | Polar Desert Sand | MIFIECPWCDAELALDSLDATSVDCPDCRVTVDFPVDPQSLAAAA* |
| Ga0137376_100356795 | 3300012208 | Vadose Zone Soil | MIIIECPWCDTELALETLVESSVDCPDCRVTVELAPDPAPVALAA* |
| Ga0137379_114724041 | 3300012209 | Vadose Zone Soil | MITIECTWCDADLVLDSLDTSSVDCPDCRITTELAPDPDPIAVAA |
| Ga0137377_106631562 | 3300012211 | Vadose Zone Soil | MITIECTWCDAELALDSLEATSVDCPDCRITVEIAADPEPIAIAA* |
| Ga0150985_1097675561 | 3300012212 | Avena Fatua Rhizosphere | MITIECTWCEAELTLDSLDAPILDCPDCRISVEFAPEPETLAIAA* |
| Ga0150984_1143974441 | 3300012469 | Avena Fatua Rhizosphere | CSWCETELVLDSLDADGVDCPECVVSVEFAPDPEPLAIAA* |
| Ga0136635_100755542 | 3300012530 | Polar Desert Sand | MIHIECTWCEADLVLASLDAPSVDCPACRITVEFASEPESIALAA* |
| Ga0157216_100258223 | 3300012668 | Glacier Forefield Soil | MILIECPWCDAELVLASLEVPSVDCPVCRVSVDFSPEPEALALAA* |
| Ga0137398_108527852 | 3300012683 | Vadose Zone Soil | AELALDTLVETSVDCPDCRVTVDLAPDPEPLAVAA* |
| Ga0137407_110249961 | 3300012930 | Vadose Zone Soil | MPFAASTSGCDTRAVTTIGEAPPMIIIECPWCDTELALETLVESSVDCPDCRVTVELGPDPAPVALAA* |
| Ga0137410_107315261 | 3300012944 | Vadose Zone Soil | MITIECTWCDTELTLETHVETSLDCPDCRITVEIAPDPDSVSVAVAA* |
| Ga0164300_102440292 | 3300012951 | Soil | MITIECSWCDTDLVLESLDATSVDCPECLVTVELASDPEALALAA* |
| Ga0168316_1113513 | 3300012981 | Weathered Mine Tailings | MILIDCTWCEAELVLEALDATSVECPDCRITVDIASDPRPIAAAA* |
| Ga0164309_100308963 | 3300012984 | Soil | MITVECSWCDTDLVLESLDATSVDCPECRVTVEIASDREALALAA* |
| Ga0164308_104147902 | 3300012985 | Soil | HDPPMITIECSWCDTDLVLESLDATSVDCPECRVTVEIASDPEALALAA* |
| Ga0164306_100443362 | 3300012988 | Soil | MITIECSWCDTDLVLESLDATSVDCPECRVTVEIASDREALALAA* |
| Ga0157373_114854022 | 3300013100 | Corn Rhizosphere | MITIECTWCEAELALDSLDASSVDCADCRVTVDLAPDPEVLALAA* |
| Ga0157378_103393983 | 3300013297 | Miscanthus Rhizosphere | MITIECSWCDTDLVLESLDAPSVDCPESRVTVEIASDREALALAA* |
| Ga0120154_11613941 | 3300013501 | Permafrost | MIIIECSWCDAELALETLVETSVDCPDCRVTVDLAPDA |
| Ga0120127_100089672 | 3300013503 | Permafrost | MIIIECSWCDAELALETLVETSVDCPDCRVTIDLAPDADPIAVAA* |
| Ga0120172_10995282 | 3300013765 | Permafrost | AVTAQGESVPMIIIECSWCDAELALETLVETSVDCPDCRVTIDLAPDADLIAVAA* |
| Ga0182008_102928822 | 3300014497 | Rhizosphere | MITLECSWCDADLTIDRLDEPSVECADCRIVVEIAPDPEPLALAA* |
| Ga0182008_106538732 | 3300014497 | Rhizosphere | MTTIECTWCDTELALDSLDAPSVDCPECRVTVEFAPDPEPLAIAA* |
| Ga0167653_10222062 | 3300015162 | Glacier Forefield Soil | MIIIECAWCDAELVLETLVETSVDCRDCRVTVDLGPDPEPIAVAA* |
| Ga0167646_10569662 | 3300015192 | Glacier Forefield Soil | MISIECTWCDANLTLDSLDAASVDCPDCRVAVDIAPDPDSLAVAA* |
| Ga0167646_10996132 | 3300015192 | Glacier Forefield Soil | MITFECTWCDGELVVDSLDAASIDCPDCRITVEIAPDPEPIALAA* |
| Ga0167647_10050444 | 3300015199 | Glacier Forefield Soil | MISIECTWCDANLTLDSLDAASVDCPDCRVTVDIAPNPDPDPLAVAA* |
| Ga0137412_110046432 | 3300015242 | Vadose Zone Soil | MITIECTWCDADLTIDALDAMSVECADCRVSVEIAPDPEPIALAA* |
| Ga0132258_100493987 | 3300015371 | Arabidopsis Rhizosphere | MILIECSWCDGDVALESLDATSVDCPEGLVSVELAPDPEVLAVAA* |
| Ga0132258_106361425 | 3300015371 | Arabidopsis Rhizosphere | MILIECPWCDGDVALESLDASSVDCRECLVSVELAPEAEVLAA |
| Ga0132258_133391703 | 3300015371 | Arabidopsis Rhizosphere | MITIECSWCDTDLTLDSLDATSVDCPECLVTVEFAPDPEPLAKAA* |
| Ga0132256_1033440332 | 3300015372 | Arabidopsis Rhizosphere | MILIECSWCDRDVALESLDATSVDCPECLVSVELAPDPEVLAVAA* |
| Ga0132256_1037645572 | 3300015372 | Arabidopsis Rhizosphere | MITIECSWCDTDLVLESFDAPSVECPECLVTVEFAADPEPLALAA* |
| Ga0184615_101827082 | 3300018059 | Groundwater Sediment | MITIDCTWCDAALALDSLDATSVDCADCRITVDIATDPERIAVAA |
| Ga0184618_100856102 | 3300018071 | Groundwater Sediment | MIIIECPWCDTELALETLVESSVDCPDCRVTVELAPDPAPIALAA |
| Ga0184609_102680302 | 3300018076 | Groundwater Sediment | MIIIECSWCDAELALETLVETSVDCPDCRITIDLAPDLDPIAVAA |
| Ga0066655_103823032 | 3300018431 | Grasslands Soil | MITIECTWCDAELALNDLDATSVDCPDCRITVEIAPDPEPLAIAA |
| Ga0066667_107671612 | 3300018433 | Grasslands Soil | MITIECTWCDADLVLDRLDAPSVDCPDCRLTIDIASDPEPIAIAA |
| Ga0190269_106450982 | 3300018465 | Soil | MIHIECSWCEADLVLAALDAPSVDCPDCRITVEIAPDPEALALAA |
| Ga0190269_109708412 | 3300018465 | Soil | MIHIECSWCEADVVLAALDAPTVDCPDCRITVDIAPDAEALALAA |
| Ga0190274_112826792 | 3300018476 | Soil | MITIDCTWCDADLALDSLDATSVDCADCRITVEIAPDPEQLALAA |
| Ga0190274_124001882 | 3300018476 | Soil | MITIDCTWCDAELALDSLDATSVDCADCRITVEIAPDPEQVALAA |
| Ga0190273_123321742 | 3300018920 | Soil | MITIECTWCEAALAIDSLDATSVDCADCRITVEIAPDPEQLAIAA |
| Ga0190264_114409392 | 3300019377 | Soil | MILIECSWCDAELVLASLDAPSVDCPDCRVSVEFSPEPEAIALAA |
| Ga0190264_114509742 | 3300019377 | Soil | MIHIECSWCDADVVLAELDAPSVECAGCGVSVEFSPDPEVLAVAA |
| Ga0190267_111292001 | 3300019767 | Soil | MIHIECTWCDGDLVLSSLDAPSLDCPECGITVEIAPDTETLAIAA |
| Ga0190267_114515711 | 3300019767 | Soil | MIIIECAWCDAELALETLVETSVDCPDCRVTVELAPDPELIALAA |
| Ga0193751_10886862 | 3300019888 | Soil | MIIIECAWCDAELALDTLVETSVDCPDCRVTVDLAPDPDPLAVAA |
| Ga0193733_10776952 | 3300020022 | Soil | MITIECTWCDADLALDSLDATSVDCADCRITVDIAPDPEPIAIAA |
| Ga0210382_100334974 | 3300021080 | Groundwater Sediment | MIIIECPWCDTELALETLVESSVDCPDCRVTVELAPDPAPVALAA |
| Ga0210382_100482892 | 3300021080 | Groundwater Sediment | MITIECTWCDADLALDSLGTTSVDCPDCRITVEIAPDPEPIAIAA |
| Ga0210382_104540412 | 3300021080 | Groundwater Sediment | MITIECTWCDAELALETLVETSVDCPDCRITIDLASDLEPIAVAA |
| Ga0193699_100485433 | 3300021363 | Soil | MITIECTWCDADLALDSLETSSVDCPDCHITVEIAPDPEPIAIAA |
| Ga0193750_10235002 | 3300021413 | Soil | MIIIECAWCDAELALDPLVDTSVDCPDCRVTVDLAPDPDPLAAAA |
| Ga0224452_12179092 | 3300022534 | Groundwater Sediment | MIIIECSWCDAELALETLVETSVDCPDCRITIDLAPDLEPIAVAA |
| Ga0247671_10022654 | 3300024284 | Soil | MNIIECPWCEAELALETLVETSVDCPDCRVTVDFAPDPAPIAVAA |
| Ga0207653_101955522 | 3300025885 | Corn, Switchgrass And Miscanthus Rhizosphere | MNIIECPWCEAELALETLVETSVNCPDCRVTVDFA |
| Ga0207647_104167172 | 3300025904 | Corn Rhizosphere | MITIECTWCDADLALDSLDETVVDCPDCRITVEIAPDPEPIAIAA |
| Ga0207684_1000299515 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MITVECTWCDAELALDSLDATSVDCPDCRITVEIAADPEPIAIAA |
| Ga0207684_100056613 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MNIIECPWCEAELALETLVETSVNCPDCRVTVDFAPDPAPIAIAA |
| Ga0207684_100785024 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MITIECTWCDAELALDGLEATNVDCPDCRITVEIAPDPEPLAVAV |
| Ga0207684_103926812 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MIHIECSWCDVDLVLASLDAASVDCPDCRVTVDIAPDPDSLSLALAA |
| Ga0207707_101477914 | 3300025912 | Corn Rhizosphere | MITIECSWCEADLALDSLDALSVDCPECRVTVDIAPDPDSLALAA |
| Ga0207695_108355751 | 3300025913 | Corn Rhizosphere | MITIECTWCDADLALDSLDETVVDCPDCRITVEIA |
| Ga0207660_101640992 | 3300025917 | Corn Rhizosphere | MIHIECSWCDADLVLDSLDAASVDCPDCRVTVDIAPDPDSLSLALAA |
| Ga0207646_100320045 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | MITIECTWCDAELALDGLEATNVDCPDCRITVEIAPDPEPLAVAA |
| Ga0207709_110742221 | 3300025935 | Miscanthus Rhizosphere | MIHIECSWCDADLVLDSLDAASVDCPDCRVTVDIAPDPDSLALAA |
| Ga0207665_107837922 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | AMNIIECPWCEAELALETLVETSVNCPDCRVTVDFAPDPAPIAIAA |
| Ga0207661_108921852 | 3300025944 | Corn Rhizosphere | MITIECTWCDADLVLDGLDASSVDCPDCRITIDIASDPEPIAIAA |
| Ga0207678_106500691 | 3300026067 | Corn Rhizosphere | PLPMITIECTWCDADLALDSLDETVVDCPDCRITVEIAPDPEPIAIAA |
| Ga0207641_106599522 | 3300026088 | Switchgrass Rhizosphere | MITIECTWCDAELVLDSLDAEVIDCPDCRITVDIARDPEPIAIAA |
| Ga0207675_1013188932 | 3300026118 | Switchgrass Rhizosphere | MITIECTWCEAELALDSLDASSVDCADCRITVDIAIDPEPIALAA |
| Ga0209131_11096363 | 3300026320 | Grasslands Soil | MITIECTWCDADLVLDSLDATAVDCPDCRITVDIATDPEAIAIAA |
| Ga0209056_104042611 | 3300026538 | Soil | MITIECTWCDAELALNDLDATSVDCPDCRITVEIAPDPEPLAI |
| Ga0209073_102875222 | 3300027765 | Agricultural Soil | MITIECSWCDAELALDDLDAPSVECADCRIVVEIAADPQSLALAA |
| Ga0307279_100468512 | 3300028709 | Soil | MITIECTWCEAELVLSSLDADVIDCPDCRITVDIARDPEPIAIAA |
| Ga0307293_102931551 | 3300028711 | Soil | MIIIECSWCDAELALETLVETSVDCPDCRITIDLAPDLEPIAVA |
| Ga0307309_101238301 | 3300028714 | Soil | MITIECTWCDADLALDSLETASVDCPDCRITVEFAPDPEPIAIAA |
| Ga0307320_100806333 | 3300028771 | Soil | MIIIECSWCDAELAIETLVETSVDCPDCRITIDLAPDLEPIAVAA |
| Ga0307281_102773722 | 3300028803 | Soil | MITIECTWCDAELALDSLDATSVDCPDCRITVEIAADPEPIAIAA |
| Ga0307312_101538742 | 3300028828 | Soil | MITIECTWCDAELALETLVETSVDCPDCRITVEIAPDPDSIVVAVAA |
| Ga0307278_101258053 | 3300028878 | Soil | APPMIIIECPWCDTELALETLVESSVDCPDCRVTVELAPDPAPIALAA |
| Ga0307501_101273721 | 3300031152 | Soil | PGMITIECTWCDAELVLDSLDASRVDCADCRITVDLAIDPEPVALAA |
| Ga0307468_1004316541 | 3300031740 | Hardwood Forest Soil | MNTIECTWCDAELALETLVETSVDCPDCRITVDIAPDPDTIVVAVAA |
| Ga0307473_101144952 | 3300031820 | Hardwood Forest Soil | MITIECTWCDAELALDGLEATNVDCPDCRITVEIAPDPEPLAIAA |
| Ga0307409_1029211251 | 3300031995 | Rhizosphere | MITIECTWCDAELVLDSLDATSVDCGDCRVTVELAVDAE |
| Ga0307416_1015696272 | 3300032002 | Rhizosphere | MITIDCTWCDAALALDSLDATSVDCADCRITVEIAPDPEPLAVAA |
| Ga0307471_1011645662 | 3300032180 | Hardwood Forest Soil | MILIECPWCETDLAIEALEASSVECPDCCITIDFAPDPAPLAVAA |
| Ga0364934_0314933_197_334 | 3300034178 | Sediment | MITIECTWCDAELAMDSLDATSVDCPDCRITVEIAADPEPIAIAA |
| ⦗Top⦘ |