NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F028883

Metagenome / Metatranscriptome Family F028883

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F028883
Family Type Metagenome / Metatranscriptome
Number of Sequences 190
Average Sequence Length 45 residues
Representative Sequence MRVPDRCLADLRERGYLLFEGFLEADELAAAQEALWLHYPRPE
Number of Associated Samples 155
Number of Associated Scaffolds 190

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 65.96 %
% of genes near scaffold ends (potentially truncated) 96.84 %
% of genes from short scaffolds (< 2000 bps) 88.95 %
Associated GOLD sequencing projects 148
AlphaFold2 3D model prediction Yes
3D model pTM-score0.49

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (57.895 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(15.263 % of family members)
Environment Ontology (ENVO) Unclassified
(24.737 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(43.158 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 28.17%    β-sheet: 0.00%    Coil/Unstructured: 71.83%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.49
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 190 Family Scaffolds
PF12680SnoaL_2 4.21
PF13671AAA_33 3.16
PF01636APH 2.63
PF13560HTH_31 2.63
PF03259Robl_LC7 2.11
PF01152Bac_globin 1.58
PF13551HTH_29 1.58
PF12089DUF3566 1.58
PF17206SeqA_N 1.05
PF10056DUF2293 1.05
PF08044DUF1707 1.05
PF13358DDE_3 1.05
PF00498FHA 1.05
PF05721PhyH 1.05
PF00583Acetyltransf_1 1.05
PF02195ParBc 0.53
PF02770Acyl-CoA_dh_M 0.53
PF00589Phage_integrase 0.53
PF00144Beta-lactamase 0.53
PF03372Exo_endo_phos 0.53
PF01590GAF 0.53
PF00239Resolvase 0.53
PF03160Calx-beta 0.53
PF04909Amidohydro_2 0.53
PF02517Rce1-like 0.53
PF12681Glyoxalase_2 0.53
PF12904Collagen_bind_2 0.53
PF11139SfLAP 0.53
PF01872RibD_C 0.53
PF00753Lactamase_B 0.53
PF12697Abhydrolase_6 0.53
PF02861Clp_N 0.53
PF01070FMN_dh 0.53
PF13442Cytochrome_CBB3 0.53
PF00171Aldedh 0.53
PF03925SeqA 0.53
PF03050DDE_Tnp_IS66 0.53
PF00106adh_short 0.53
PF02627CMD 0.53
PF00582Usp 0.53
PF03795YCII 0.53
PF03551PadR 0.53
PF13592HTH_33 0.53
PF08281Sigma70_r4_2 0.53
PF05977MFS_3 0.53
PF01163RIO1 0.53
PF03480DctP 0.53
PF01717Meth_synt_2 0.53
PF13186SPASM 0.53
PF00027cNMP_binding 0.53
PF12401FhaA_N 0.53
PF13586DDE_Tnp_1_2 0.53
PF00135COesterase 0.53
PF01494FAD_binding_3 0.53
PF00665rve 0.53
PF02371Transposase_20 0.53
PF13360PQQ_2 0.53

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 190 Family Scaffolds
COG2018Predicted regulator of Ras-like GTPase activity, Roadblock/LC7/MglB familySignal transduction mechanisms [T] 2.11
COG2346Truncated hemoglobin YjbIInorganic ion transport and metabolism [P] 1.58
COG5285Ectoine hydroxylase-related dioxygenase, phytanoyl-CoA dioxygenase (PhyH) familySecondary metabolites biosynthesis, transport and catabolism [Q] 1.05
COG06542-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductasesEnergy production and conversion [C] 1.05
COG4230Delta 1-pyrroline-5-carboxylate dehydrogenaseAmino acid transport and metabolism [E] 0.53
COG3547TransposaseMobilome: prophages, transposons [X] 0.53
COG3436TransposaseMobilome: prophages, transposons [X] 0.53
COG3316Transposase (or an inactivated derivative), DDE domainMobilome: prophages, transposons [X] 0.53
COG4449Predicted protease, Abi (CAAX) familyGeneral function prediction only [R] 0.53
COG3057Negative regulator of replication initiation SeqAReplication, recombination and repair [L] 0.53
COG2826Transposase and inactivated derivatives, IS30 familyMobilome: prophages, transposons [X] 0.53
COG2814Predicted arabinose efflux permease AraJ, MFS familyCarbohydrate transport and metabolism [G] 0.53
COG2801Transposase InsO and inactivated derivativesMobilome: prophages, transposons [X] 0.53
COG2452Predicted site-specific integrase-resolvaseMobilome: prophages, transposons [X] 0.53
COG2367Beta-lactamase class ADefense mechanisms [V] 0.53
COG2350YciI superfamily enzyme, includes 5-CHQ dehydrochlorinase, contains active-site pHisSecondary metabolites biosynthesis, transport and catabolism [Q] 0.53
COG4584TransposaseMobilome: prophages, transposons [X] 0.53
COG2272Carboxylesterase type BLipid transport and metabolism [I] 0.53
COG2128Alkylhydroperoxidase family enzyme, contains CxxC motifInorganic ion transport and metabolism [P] 0.53
COG1961Site-specific DNA recombinase SpoIVCA/DNA invertase PinEReplication, recombination and repair [L] 0.53
COG1266Membrane protease YdiL, CAAX protease familyPosttranslational modification, protein turnover, chaperones [O] 0.53
COG0069Glutamate synthase domain 2Amino acid transport and metabolism [E] 0.53
COG0262Dihydrofolate reductaseCoenzyme transport and metabolism [H] 0.53
COG0542ATP-dependent Clp protease, ATP-binding subunit ClpAPosttranslational modification, protein turnover, chaperones [O] 0.53
COG0578Glycerol-3-phosphate dehydrogenaseEnergy production and conversion [C] 0.53
COG0599Uncharacterized conserved protein YurZ, alkylhydroperoxidase/carboxymuconolactone decarboxylase familyGeneral function prediction only [R] 0.53
COG0620Methionine synthase II (cobalamin-independent)Amino acid transport and metabolism [E] 0.53
COG0644Dehydrogenase (flavoprotein)Energy production and conversion [C] 0.53
COG0665Glycine/D-amino acid oxidase (deaminating)Amino acid transport and metabolism [E] 0.53
COG1012Acyl-CoA reductase or other NAD-dependent aldehyde dehydrogenaseLipid transport and metabolism [I] 0.53
COG1985Pyrimidine reductase, riboflavin biosynthesisCoenzyme transport and metabolism [H] 0.53
COG1304FMN-dependent dehydrogenase, includes L-lactate dehydrogenase and type II isopentenyl diphosphate isomeraseEnergy production and conversion [C] 0.53
COG1680CubicO group peptidase, beta-lactamase class C familyDefense mechanisms [V] 0.53
COG1686D-alanyl-D-alanine carboxypeptidaseCell wall/membrane/envelope biogenesis [M] 0.53
COG1695DNA-binding transcriptional regulator, PadR familyTranscription [K] 0.53
COG1733DNA-binding transcriptional regulator, HxlR familyTranscription [K] 0.53
COG1846DNA-binding transcriptional regulator, MarR familyTranscription [K] 0.53
COG1960Acyl-CoA dehydrogenase related to the alkylation response protein AidBLipid transport and metabolism [I] 0.53
COG0014Gamma-glutamyl phosphate reductaseAmino acid transport and metabolism [E] 0.53


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms57.89 %
UnclassifiedrootN/A42.11 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2199352025|deepsgr__Contig_161291All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → unclassified Pseudonocardiales → Pseudonocardiales bacterium994Open in IMG/M
3300000033|ICChiseqgaiiDRAFT_c0876183All Organisms → cellular organisms → Bacteria1250Open in IMG/M
3300000956|JGI10216J12902_102675780All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia3000Open in IMG/M
3300000956|JGI10216J12902_103038318All Organisms → cellular organisms → Bacteria733Open in IMG/M
3300000956|JGI10216J12902_119410091Not Available579Open in IMG/M
3300004081|Ga0063454_102040691Not Available508Open in IMG/M
3300005093|Ga0062594_101129643Not Available769Open in IMG/M
3300005093|Ga0062594_101517027Not Available688Open in IMG/M
3300005332|Ga0066388_105863193All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria621Open in IMG/M
3300005332|Ga0066388_106532710Not Available588Open in IMG/M
3300005332|Ga0066388_106876149All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia573Open in IMG/M
3300005338|Ga0068868_101791762All Organisms → cellular organisms → Bacteria → Terrabacteria group580Open in IMG/M
3300005341|Ga0070691_10776080All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium582Open in IMG/M
3300005344|Ga0070661_100268074All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales1322Open in IMG/M
3300005356|Ga0070674_102135239Not Available511Open in IMG/M
3300005435|Ga0070714_100421545All Organisms → cellular organisms → Bacteria1264Open in IMG/M
3300005435|Ga0070714_101312151Not Available706Open in IMG/M
3300005436|Ga0070713_100694108All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia971Open in IMG/M
3300005436|Ga0070713_101177886Not Available741Open in IMG/M
3300005436|Ga0070713_102116192Not Available545Open in IMG/M
3300005436|Ga0070713_102476225All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia501Open in IMG/M
3300005437|Ga0070710_10002108All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia9419Open in IMG/M
3300005437|Ga0070710_10022892All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia3275Open in IMG/M
3300005439|Ga0070711_100581316All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia932Open in IMG/M
3300005440|Ga0070705_100137815All Organisms → cellular organisms → Bacteria1602Open in IMG/M
3300005451|Ga0066681_10974758All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia506Open in IMG/M
3300005456|Ga0070678_102060947Not Available540Open in IMG/M
3300005458|Ga0070681_11836771All Organisms → cellular organisms → Bacteria → Terrabacteria group → Deinococcus-Thermus → Deinococci → Thermales → Thermaceae → Calidithermus → Calidithermus timidus533Open in IMG/M
3300005466|Ga0070685_11021948Not Available621Open in IMG/M
3300005518|Ga0070699_101259183Not Available678Open in IMG/M
3300005524|Ga0070737_10146792All Organisms → cellular organisms → Bacteria1021Open in IMG/M
3300005533|Ga0070734_10762072Not Available550Open in IMG/M
3300005535|Ga0070684_100594379All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1029Open in IMG/M
3300005548|Ga0070665_101234924All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium SG_bin7758Open in IMG/M
3300005559|Ga0066700_10109459All Organisms → cellular organisms → Bacteria1823Open in IMG/M
3300005586|Ga0066691_10748974Not Available577Open in IMG/M
3300005618|Ga0068864_102725554All Organisms → cellular organisms → Bacteria500Open in IMG/M
3300005712|Ga0070764_10506079Not Available727Open in IMG/M
3300005764|Ga0066903_104297886All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia762Open in IMG/M
3300005840|Ga0068870_10069322All Organisms → cellular organisms → Bacteria1918Open in IMG/M
3300006028|Ga0070717_10113038All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia2318Open in IMG/M
3300006028|Ga0070717_11614350All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia587Open in IMG/M
3300006028|Ga0070717_11692107Not Available572Open in IMG/M
3300006059|Ga0075017_100455510All Organisms → cellular organisms → Bacteria966Open in IMG/M
3300006175|Ga0070712_100039167All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia3243Open in IMG/M
3300006175|Ga0070712_100295001All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales1310Open in IMG/M
3300006358|Ga0068871_102429300Not Available500Open in IMG/M
3300006800|Ga0066660_11157621All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria609Open in IMG/M
3300006804|Ga0079221_10864012Not Available658Open in IMG/M
3300006845|Ga0075421_102026418All Organisms → cellular organisms → Bacteria612Open in IMG/M
3300006893|Ga0073928_10865964All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → unclassified Propionibacteriales → Propionibacteriales bacterium621Open in IMG/M
3300006954|Ga0079219_10047573Not Available1825Open in IMG/M
3300009012|Ga0066710_104575516Not Available517Open in IMG/M
3300009094|Ga0111539_11344648Not Available829Open in IMG/M
3300009100|Ga0075418_12814242All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia531Open in IMG/M
3300009101|Ga0105247_11151764All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia615Open in IMG/M
3300009137|Ga0066709_102845304All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria640Open in IMG/M
3300009148|Ga0105243_11047053All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium SG_bin7821Open in IMG/M
3300009174|Ga0105241_10423439Not Available1172Open in IMG/M
3300009176|Ga0105242_10267950Not Available1546Open in IMG/M
3300009686|Ga0123338_10279469All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → Microthrixaceae → Candidatus Microthrix735Open in IMG/M
3300009792|Ga0126374_11811036Not Available511Open in IMG/M
3300010043|Ga0126380_11600053Not Available581Open in IMG/M
3300010048|Ga0126373_10055055All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia3546Open in IMG/M
3300010048|Ga0126373_12356976Not Available592Open in IMG/M
3300010360|Ga0126372_10185791All Organisms → cellular organisms → Bacteria1712Open in IMG/M
3300010360|Ga0126372_10650506Not Available1020Open in IMG/M
3300010360|Ga0126372_11176330All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia790Open in IMG/M
3300010360|Ga0126372_12272973Not Available592Open in IMG/M
3300010361|Ga0126378_10126600Not Available2568Open in IMG/M
3300010361|Ga0126378_10276593All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1778Open in IMG/M
3300010361|Ga0126378_13068414Not Available532Open in IMG/M
3300010366|Ga0126379_11809093Not Available715Open in IMG/M
3300010373|Ga0134128_10484434Not Available1379Open in IMG/M
3300010373|Ga0134128_11167965All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia849Open in IMG/M
3300010375|Ga0105239_10158936All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia2524Open in IMG/M
3300010376|Ga0126381_100141575All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae3144Open in IMG/M
3300010396|Ga0134126_10545770All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → environmental samples → uncultured Solirubrobacteraceae bacterium1331Open in IMG/M
3300010401|Ga0134121_11509696Not Available687Open in IMG/M
3300010880|Ga0126350_11908664All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia731Open in IMG/M
3300012198|Ga0137364_10593350Not Available835Open in IMG/M
3300012200|Ga0137382_10221030All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1306Open in IMG/M
3300012208|Ga0137376_10441790All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1129Open in IMG/M
3300012356|Ga0137371_10078710All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia2556Open in IMG/M
3300012363|Ga0137390_11609472All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria587Open in IMG/M
3300012497|Ga0157319_1016095All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia675Open in IMG/M
3300012682|Ga0136611_10509633All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium756Open in IMG/M
3300012922|Ga0137394_11180012Not Available629Open in IMG/M
3300012930|Ga0137407_12275418All Organisms → cellular organisms → Bacteria → Proteobacteria518Open in IMG/M
3300012951|Ga0164300_10476129Not Available707Open in IMG/M
3300012958|Ga0164299_10126285All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1377Open in IMG/M
3300012960|Ga0164301_10167933All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1363Open in IMG/M
3300012961|Ga0164302_10691893Not Available754Open in IMG/M
3300012985|Ga0164308_10448843All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1067Open in IMG/M
3300012987|Ga0164307_10518722Not Available904Open in IMG/M
3300013296|Ga0157374_11388760All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia725Open in IMG/M
3300013306|Ga0163162_12053812All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium655Open in IMG/M
3300013306|Ga0163162_12149537Not Available640Open in IMG/M
3300013307|Ga0157372_10645967Not Available1232Open in IMG/M
3300013307|Ga0157372_12472186Not Available596Open in IMG/M
3300014745|Ga0157377_10871328Not Available670Open in IMG/M
3300014969|Ga0157376_10856690Not Available924Open in IMG/M
3300014969|Ga0157376_12415631Not Available565Open in IMG/M
3300015190|Ga0167651_1038657Not Available1022Open in IMG/M
3300015372|Ga0132256_101834490Not Available714Open in IMG/M
3300016294|Ga0182041_11316041Not Available661Open in IMG/M
3300016371|Ga0182034_11483547Not Available594Open in IMG/M
3300016422|Ga0182039_10852175Not Available811Open in IMG/M
3300016445|Ga0182038_10725463All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia867Open in IMG/M
3300017947|Ga0187785_10499736Not Available606Open in IMG/M
3300018081|Ga0184625_10376644All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia735Open in IMG/M
3300021080|Ga0210382_10445028All Organisms → cellular organisms → Bacteria → Terrabacteria group574Open in IMG/M
3300021405|Ga0210387_11231555Not Available649Open in IMG/M
3300021432|Ga0210384_11668112Not Available543Open in IMG/M
3300021475|Ga0210392_10636269All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia792Open in IMG/M
3300021478|Ga0210402_10888510All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria817Open in IMG/M
3300021478|Ga0210402_11450435All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia613Open in IMG/M
3300021560|Ga0126371_10235323All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1941Open in IMG/M
3300021560|Ga0126371_12867361All Organisms → cellular organisms → Bacteria584Open in IMG/M
3300022724|Ga0242665_10404353Not Available500Open in IMG/M
3300024286|Ga0247687_1015348All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium SG_bin71058Open in IMG/M
3300024310|Ga0247681_1065186All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia571Open in IMG/M
3300025885|Ga0207653_10013376All Organisms → cellular organisms → Bacteria2569Open in IMG/M
3300025906|Ga0207699_10374573All Organisms → cellular organisms → Bacteria1009Open in IMG/M
3300025906|Ga0207699_10748936All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales717Open in IMG/M
3300025906|Ga0207699_10792824All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia696Open in IMG/M
3300025913|Ga0207695_10019316All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria7847Open in IMG/M
3300025915|Ga0207693_10438452All Organisms → cellular organisms → Bacteria1021Open in IMG/M
3300025915|Ga0207693_10450160All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1006Open in IMG/M
3300025921|Ga0207652_11481146All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia583Open in IMG/M
3300025928|Ga0207700_11118857All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia704Open in IMG/M
3300025931|Ga0207644_11557795All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia554Open in IMG/M
3300025941|Ga0207711_11641445All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium SG_bin7586Open in IMG/M
3300026095|Ga0207676_12194372All Organisms → cellular organisms → Bacteria550Open in IMG/M
3300026318|Ga0209471_1278192All Organisms → cellular organisms → Bacteria → Terrabacteria group560Open in IMG/M
3300026508|Ga0257161_1136745All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia515Open in IMG/M
3300027725|Ga0209178_1318258Not Available576Open in IMG/M
3300027889|Ga0209380_10118212All Organisms → cellular organisms → Bacteria1540Open in IMG/M
3300027889|Ga0209380_10160367Not Available1316Open in IMG/M
3300027915|Ga0209069_10271156All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia890Open in IMG/M
3300028006|Ga0247717_1042511Not Available713Open in IMG/M
3300028379|Ga0268266_11136388All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium SG_bin7756Open in IMG/M
3300028380|Ga0268265_12662091Not Available506Open in IMG/M
3300028592|Ga0247822_10357925Not Available1129Open in IMG/M
3300028828|Ga0307312_10262795All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1119Open in IMG/M
3300028828|Ga0307312_10629527All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae710Open in IMG/M
3300029636|Ga0222749_10555754Not Available625Open in IMG/M
3300031234|Ga0302325_10410005All Organisms → cellular organisms → Bacteria2105Open in IMG/M
3300031251|Ga0265327_10288501All Organisms → cellular organisms → Bacteria724Open in IMG/M
3300031543|Ga0318516_10290128All Organisms → cellular organisms → Bacteria → Terrabacteria group945Open in IMG/M
3300031546|Ga0318538_10628975Not Available582Open in IMG/M
3300031564|Ga0318573_10633366Not Available575Open in IMG/M
3300031572|Ga0318515_10093433All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1571Open in IMG/M
3300031640|Ga0318555_10517477Not Available647Open in IMG/M
3300031671|Ga0307372_10376957Not Available741Open in IMG/M
3300031681|Ga0318572_10864169Not Available537Open in IMG/M
3300031708|Ga0310686_109878907All Organisms → cellular organisms → Bacteria → Terrabacteria group1876Open in IMG/M
3300031708|Ga0310686_114068893Not Available1339Open in IMG/M
3300031712|Ga0265342_10713981Not Available500Open in IMG/M
3300031713|Ga0318496_10568704Not Available626Open in IMG/M
3300031726|Ga0302321_100106650All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → unclassified Acidimicrobiales → Acidimicrobiales bacterium2815Open in IMG/M
3300031748|Ga0318492_10761235Not Available520Open in IMG/M
3300031765|Ga0318554_10055316All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia2178Open in IMG/M
3300031778|Ga0318498_10496808Not Available537Open in IMG/M
3300031793|Ga0318548_10366463All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia707Open in IMG/M
3300031805|Ga0318497_10029555All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium2728Open in IMG/M
3300031805|Ga0318497_10151545All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1269Open in IMG/M
3300031860|Ga0318495_10287136Not Available733Open in IMG/M
3300031879|Ga0306919_11090383Not Available609Open in IMG/M
3300031893|Ga0318536_10616407All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → unclassified Pseudonocardiales → Pseudonocardiales bacterium542Open in IMG/M
3300031897|Ga0318520_10506974Not Available745Open in IMG/M
3300031912|Ga0306921_11180023All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → unclassified Pseudonocardiales → Pseudonocardiales bacterium854Open in IMG/M
3300031912|Ga0306921_11801131Not Available658Open in IMG/M
3300031946|Ga0310910_10881823Not Available702Open in IMG/M
3300031981|Ga0318531_10008583All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria3739Open in IMG/M
3300032001|Ga0306922_12222659All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → unclassified Pseudonocardiales → Pseudonocardiales bacterium528Open in IMG/M
3300032002|Ga0307416_100507780Not Available1271Open in IMG/M
3300032063|Ga0318504_10571566Not Available542Open in IMG/M
3300032076|Ga0306924_10264299All Organisms → cellular organisms → Bacteria1976Open in IMG/M
3300032076|Ga0306924_10458563All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1455Open in IMG/M
3300032160|Ga0311301_10203975All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria3380Open in IMG/M
3300032205|Ga0307472_100281048All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1325Open in IMG/M
3300032770|Ga0335085_12408694All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia524Open in IMG/M
3300032805|Ga0335078_12137461All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Geodermatophilales → Geodermatophilaceae593Open in IMG/M
3300032896|Ga0335075_10951922All Organisms → cellular organisms → Bacteria → Terrabacteria group778Open in IMG/M
3300033134|Ga0335073_10052872All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae5420Open in IMG/M
3300033134|Ga0335073_11541895Not Available638Open in IMG/M
3300033158|Ga0335077_11983248Not Available541Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil15.26%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere11.58%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil7.89%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil6.32%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil5.26%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil4.74%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil3.68%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil3.16%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil2.11%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil2.11%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere2.11%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere2.11%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil1.58%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil1.58%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere1.58%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere1.58%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere1.58%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere1.58%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds1.05%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil1.05%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil1.05%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil1.05%
Agricultural SoilEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil1.05%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere1.05%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere1.05%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere1.05%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere1.05%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere1.05%
RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere1.05%
Groundwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment0.53%
Glacier ValleyEnvironmental → Aquatic → Freshwater → Ice → Glacier → Glacier Valley0.53%
Polar Desert SandEnvironmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand0.53%
Iron-Sulfur Acid SpringEnvironmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring0.53%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment0.53%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.53%
Glacier Forefield SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil0.53%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil0.53%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil0.53%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil0.53%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland0.53%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil0.53%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere0.53%
SoilEnvironmental → Terrestrial → Soil → Clay → Unclassified → Soil0.53%
FenEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Fen0.53%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa0.53%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere0.53%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere0.53%
Miscanthus RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere0.53%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere0.53%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere0.53%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere0.53%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere0.53%
Boreal Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil0.53%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2199352025Soil microbial communities from Rothamsted, UK, for project Deep Soil - DEEP SOILEnvironmentalOpen in IMG/M
3300000033Soil microbial communities from Great Prairies - Iowa, Continuous Corn soilEnvironmentalOpen in IMG/M
3300000956Soil microbial communities from Great Prairies - Kansas, Native Prairie soilEnvironmentalOpen in IMG/M
3300004081Grasslands soil microbial communities from Hopland, California, USA - 2 (version 2)EnvironmentalOpen in IMG/M
3300005093Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All BlocksEnvironmentalOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005338Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2Host-AssociatedOpen in IMG/M
3300005341Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaGEnvironmentalOpen in IMG/M
3300005344Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaGHost-AssociatedOpen in IMG/M
3300005356Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaGHost-AssociatedOpen in IMG/M
3300005435Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaGEnvironmentalOpen in IMG/M
3300005436Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaGEnvironmentalOpen in IMG/M
3300005437Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaGEnvironmentalOpen in IMG/M
3300005439Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaGEnvironmentalOpen in IMG/M
3300005440Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaGEnvironmentalOpen in IMG/M
3300005451Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130EnvironmentalOpen in IMG/M
3300005456Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaGHost-AssociatedOpen in IMG/M
3300005458Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaGEnvironmentalOpen in IMG/M
3300005466Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaGEnvironmentalOpen in IMG/M
3300005518Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaGEnvironmentalOpen in IMG/M
3300005524Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen10_05102014_R1EnvironmentalOpen in IMG/M
3300005533Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1EnvironmentalOpen in IMG/M
3300005535Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaGEnvironmentalOpen in IMG/M
3300005548Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaGHost-AssociatedOpen in IMG/M
3300005559Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149EnvironmentalOpen in IMG/M
3300005586Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140EnvironmentalOpen in IMG/M
3300005618Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2Host-AssociatedOpen in IMG/M
3300005712Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4EnvironmentalOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300005840Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2Host-AssociatedOpen in IMG/M
3300006028Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaGEnvironmentalOpen in IMG/M
3300006059Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012EnvironmentalOpen in IMG/M
3300006175Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaGEnvironmentalOpen in IMG/M
3300006358Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2Host-AssociatedOpen in IMG/M
3300006800Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109EnvironmentalOpen in IMG/M
3300006804Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200EnvironmentalOpen in IMG/M
3300006844Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2Host-AssociatedOpen in IMG/M
3300006845Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5Host-AssociatedOpen in IMG/M
3300006893Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaGEnvironmentalOpen in IMG/M
3300006954Agricultural soil microbial communities from Georgia to study Nitrogen management - GA ControlEnvironmentalOpen in IMG/M
3300009012Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159EnvironmentalOpen in IMG/M
3300009094Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009100Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2Host-AssociatedOpen in IMG/M
3300009101Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaGHost-AssociatedOpen in IMG/M
3300009137Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158EnvironmentalOpen in IMG/M
3300009148Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaGHost-AssociatedOpen in IMG/M
3300009174Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaGHost-AssociatedOpen in IMG/M
3300009176Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaGHost-AssociatedOpen in IMG/M
3300009686Glacier valley bacterial and archeal communities from Borup Fiord, Nunavut, Canada, to study Microbial Dark Matter (Phase II) - groundupSSSS metaGEnvironmentalOpen in IMG/M
3300009792Tropical forest soil microbial communities from Panama - MetaG Plot_12EnvironmentalOpen in IMG/M
3300010043Tropical forest soil microbial communities from Panama - MetaG Plot_26EnvironmentalOpen in IMG/M
3300010048Tropical forest soil microbial communities from Panama - MetaG Plot_11EnvironmentalOpen in IMG/M
3300010360Tropical forest soil microbial communities from Panama - MetaG Plot_6EnvironmentalOpen in IMG/M
3300010361Tropical forest soil microbial communities from Panama - MetaG Plot_23EnvironmentalOpen in IMG/M
3300010366Tropical forest soil microbial communities from Panama - MetaG Plot_24EnvironmentalOpen in IMG/M
3300010373Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4EnvironmentalOpen in IMG/M
3300010375Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaGHost-AssociatedOpen in IMG/M
3300010376Tropical forest soil microbial communities from Panama - MetaG Plot_28EnvironmentalOpen in IMG/M
3300010396Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2EnvironmentalOpen in IMG/M
3300010401Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1EnvironmentalOpen in IMG/M
3300010880Boreal forest soil eukaryotic communities from Alaska, USA - C5-1 Metatranscriptome (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300012198Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaGEnvironmentalOpen in IMG/M
3300012200Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaGEnvironmentalOpen in IMG/M
3300012208Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaGEnvironmentalOpen in IMG/M
3300012356Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaGEnvironmentalOpen in IMG/M
3300012363Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaGEnvironmentalOpen in IMG/M
3300012497Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510Host-AssociatedOpen in IMG/M
3300012682Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ223 (23.06)EnvironmentalOpen in IMG/M
3300012922Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaGEnvironmentalOpen in IMG/M
3300012930Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012951Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MGEnvironmentalOpen in IMG/M
3300012958Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MGEnvironmentalOpen in IMG/M
3300012960Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MGEnvironmentalOpen in IMG/M
3300012961Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MGEnvironmentalOpen in IMG/M
3300012985Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MGEnvironmentalOpen in IMG/M
3300012987Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MGEnvironmentalOpen in IMG/M
3300013296Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaGHost-AssociatedOpen in IMG/M
3300013306Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaGHost-AssociatedOpen in IMG/M
3300013307Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaGHost-AssociatedOpen in IMG/M
3300014745Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaGHost-AssociatedOpen in IMG/M
3300014969Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaGHost-AssociatedOpen in IMG/M
3300015190Arctic soil microbial communities from a glacier forefield, Storglaci?ren, Tarfala, Sweden (Sample st-4a, rock/ice/stream interface)EnvironmentalOpen in IMG/M
3300015372Soil combined assemblyHost-AssociatedOpen in IMG/M
3300016294Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178EnvironmentalOpen in IMG/M
3300016371Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172EnvironmentalOpen in IMG/M
3300016422Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111EnvironmentalOpen in IMG/M
3300016445Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108EnvironmentalOpen in IMG/M
3300017947Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_4_20_MGEnvironmentalOpen in IMG/M
3300018081Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b1EnvironmentalOpen in IMG/M
3300018422Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 TEnvironmentalOpen in IMG/M
3300021080Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_coex redoEnvironmentalOpen in IMG/M
3300021405Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-OEnvironmentalOpen in IMG/M
3300021432Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-MEnvironmentalOpen in IMG/M
3300021475Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-OEnvironmentalOpen in IMG/M
3300021478Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-MEnvironmentalOpen in IMG/M
3300021560Tropical forest soil microbial communities from Panama - MetaG Plot_4EnvironmentalOpen in IMG/M
3300022724Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-17-M (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300024286Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK28EnvironmentalOpen in IMG/M
3300024310Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK22EnvironmentalOpen in IMG/M
3300025885Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025906Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025913Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025915Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025921Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025928Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025931Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025941Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026095Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026318Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 (SPAdes)EnvironmentalOpen in IMG/M
3300026508Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NR-01-AEnvironmentalOpen in IMG/M
3300027725Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 (SPAdes)EnvironmentalOpen in IMG/M
3300027889Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes)EnvironmentalOpen in IMG/M
3300027915Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 (SPAdes)EnvironmentalOpen in IMG/M
3300028006Soil microbial communities from hillslope of Landscape Evolution Observatory, University of Arizona, Oracle, AZ, United States - 2-4-E_NEnvironmentalOpen in IMG/M
3300028379Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300028380Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300028592Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Cellulose_Day30EnvironmentalOpen in IMG/M
3300028828Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202EnvironmentalOpen in IMG/M
3300029636Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031234Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2EnvironmentalOpen in IMG/M
3300031251Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaGHost-AssociatedOpen in IMG/M
3300031543Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20EnvironmentalOpen in IMG/M
3300031546Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23EnvironmentalOpen in IMG/M
3300031564Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21EnvironmentalOpen in IMG/M
3300031572Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19EnvironmentalOpen in IMG/M
3300031640Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23EnvironmentalOpen in IMG/M
3300031671Soil microbial communities from Risofladan, Vaasa, Finland - OX-1EnvironmentalOpen in IMG/M
3300031681Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20EnvironmentalOpen in IMG/M
3300031708FICUS49499 Metagenome Czech Republic combined assemblyEnvironmentalOpen in IMG/M
3300031712Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaGHost-AssociatedOpen in IMG/M
3300031713Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f22EnvironmentalOpen in IMG/M
3300031726Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_1EnvironmentalOpen in IMG/M
3300031748Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f22EnvironmentalOpen in IMG/M
3300031765Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22EnvironmentalOpen in IMG/M
3300031778Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f24EnvironmentalOpen in IMG/M
3300031793Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f21EnvironmentalOpen in IMG/M
3300031805Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f23EnvironmentalOpen in IMG/M
3300031860Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f25EnvironmentalOpen in IMG/M
3300031879Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2)EnvironmentalOpen in IMG/M
3300031893Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f28EnvironmentalOpen in IMG/M
3300031897Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16EnvironmentalOpen in IMG/M
3300031912Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2)EnvironmentalOpen in IMG/M
3300031946Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172EnvironmentalOpen in IMG/M
3300031981Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f25EnvironmentalOpen in IMG/M
3300032001Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2)EnvironmentalOpen in IMG/M
3300032002Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3Host-AssociatedOpen in IMG/M
3300032063Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f17EnvironmentalOpen in IMG/M
3300032076Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2)EnvironmentalOpen in IMG/M
3300032160Sb_50d combined assembly (MetaSPAdes)EnvironmentalOpen in IMG/M
3300032205Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05EnvironmentalOpen in IMG/M
3300032770Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5EnvironmentalOpen in IMG/M
3300032805Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2EnvironmentalOpen in IMG/M
3300032896Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.4EnvironmentalOpen in IMG/M
3300033134Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.2EnvironmentalOpen in IMG/M
3300033158Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
deepsgr_026819202199352025SoilMRVPDRCLADLRERGYLLFEGFLEADELAAAQEALWLHYPRPEGISPT
ICChiseqgaiiDRAFT_087618323300000033SoilVRVPDRSLTELRERGYLVLEGFLGADELAAAREALWLHYPR
JGI10216J12902_10267578013300000956SoilMRVPDRCLADLRERGYLLFEGFLEAGELAAAREALWLHYPRP
JGI10216J12902_10303831823300000956SoilMRVPDGCVADLRHRGHLVFEDFLEADELAAAQDALWLHYPRPEE
JGI10216J12902_11941009113300000956SoilMRVPDRCVADLQQRGYLLFEGFLAADELAAAQEALWLHYPRPEEYF
Ga0063454_10204069133300004081SoilMRVPDRCVVELHQLGYLVFEGFLEADELAAAQEALWLHYPRPDQYFADPAAHAWLAA
Ga0062594_10112964323300005093SoilMRVPDRCLADLRQRGYLVFEDFLDPDELAAAQEALWLHYPRPEEYFA
Ga0062594_10151702723300005093SoilMRVPDHCLAQLRERGYLVLEGFRGTDELAAAQEALWLHYPRPDEYFADLTPYG*
Ga0066388_10586319323300005332Tropical Forest SoilMRVPDGCLAELRERGFLVFEDFLGTDELAAAQAALWLHYPRPEEYFADPAAHAWL
Ga0066388_10653271023300005332Tropical Forest SoilMRVPDSCVADLRERGYLLFEGFLEAGELAAAREALWLHYPRPE
Ga0066388_10687614923300005332Tropical Forest SoilMRVPDGCLVDLRERGYLLFEGFLGADELAAAREALWLHYPRPE
Ga0068868_10179176213300005338Miscanthus RhizosphereMRVPDRCVADLRDQGYLVFEGFLDRDELEAAQEALWLHYPRPEEYFA
Ga0070691_1077608013300005341Corn, Switchgrass And Miscanthus RhizosphereMRVPDRCLADLREQGYLLFEGFLEADELTAAQEALWLHYPRPEVYFADPAAHAW
Ga0070661_10026807413300005344Corn RhizosphereVPDRCLTELRERGYLVFEGFLGADELAAAQEALWLHFPRPE
Ga0070674_10213523923300005356Miscanthus RhizosphereMRVPDRCLADLCEQGYLVFEGFLNADELAAAQEALWLHYPRPEEYFADPAA
Ga0070714_10042154533300005435Agricultural SoilVPDRCLTELRERGYLVFEGFLGAGELAAAQEALWLHFPRP
Ga0070714_10131215133300005435Agricultural SoilMRVPDRCVADLRDRGYLIFEGFLGAGELAAAQEALWLHYPRPGEYFADPAAYAWL
Ga0070713_10069410833300005436Corn, Switchgrass And Miscanthus RhizosphereMKVPDRCLADLRERGYLLFEGFLEADELAAAQEALWLHYPR
Ga0070713_10117788613300005436Corn, Switchgrass And Miscanthus RhizosphereVPERCLTELRERGYLVFEGFLGAGELAAAQEALWLHFPRP
Ga0070713_10211619223300005436Corn, Switchgrass And Miscanthus RhizosphereMRVPDRCLADLRERGYLLFEGFLEADELAAAQEALWLHYPR
Ga0070713_10247622513300005436Corn, Switchgrass And Miscanthus RhizosphereVRVPDRCLTELRERGYLVFEGFLGADELAAAQEALWLHFP
Ga0070710_1000210813300005437Corn, Switchgrass And Miscanthus RhizosphereVPDRCLTELRERGYLVFEGFLGADELAAAQEALWLHFPRPEEYFA
Ga0070710_1002289253300005437Corn, Switchgrass And Miscanthus RhizosphereMRVPDRCVADLREQGYLLFEGFLGADELAAAQEALWLHYPQPEVYFADPAAHAWL
Ga0070711_10058131613300005439Corn, Switchgrass And Miscanthus RhizosphereVPDRCLADLRERGYLLFEGFLEADELAAAQEALWLHYPRPESYFADPAA
Ga0070705_10013781513300005440Corn, Switchgrass And Miscanthus RhizosphereVADLRERGYLVFEGFLDAEELAEAQEALWLHYPRPEDYFA
Ga0066681_1097475813300005451SoilMRVPDRCLGDLRERGYLVFEGFLAADELAVAQAALWLRYPRPDEYFAHRAAH
Ga0070678_10206094713300005456Miscanthus RhizosphereMRVPDRCVTDLRERGFLVFEDFLAADELAAAQEALWLHYPRPEEYFADPAAH
Ga0070681_1183677113300005458Corn RhizosphereMRVPDRCVADLRDQGYLIFEGFLEADELAAAQDALWLHYPRPEEYFADPAAHAWLA
Ga0070685_1102194823300005466Switchgrass RhizosphereMRVPDRCLADLCERGFLVFEGFLDADELAAAQEALWLHYPRPEEYFADPAAH
Ga0070699_10125918323300005518Corn, Switchgrass And Miscanthus RhizosphereVKVPDRNLQELREQGFTIVEAFLAPDELEAAQEALWVHYPRPEQYFADRSAHQEYTRS
Ga0070737_1014679223300005524Surface SoilVRVPERCLTELRQQGFFVFEGFLGTDELAAAQAALWRHYP
Ga0070734_1076207223300005533Surface SoilMRVPDRCVADLRDRGYLIFEGFLEADELAAAQDALWLHYPRPGEYFADP
Ga0070684_10059437913300005535Corn RhizosphereMRVPDRCLADLRERGYLLFEGFLEADELAAAQEALWLHYPRPEVYFAD
Ga0070665_10123492423300005548Switchgrass RhizosphereVPERCVADLRERGYLVFEGFLGAGELAAAQEALWLHYPRPGEYFADPA
Ga0066700_1010945913300005559SoilMRVPDRCLADLRELGYLVFEGFLNADELAAAQEALWLHYPRPEEFFADP
Ga0066691_1074897423300005586SoilMRVPDRCLAELRERGYLVFESFLGADELAGAQKALWLHYPRPEEYF
Ga0068864_10272555413300005618Switchgrass RhizosphereMKVPDRCLADLRERGYLVFEGFLEADELAAAQEALWLHYPQPEEYF
Ga0070764_1050607913300005712SoilMRVPDRCLADLRERGYLLFEGFLEADELAAAQEALWLHYPRP
Ga0066903_10429788613300005764Tropical Forest SoilVPDRCLADLRERGYLLFEGFLEADELAAAQEALWLHYPRPEVY
Ga0068870_1006932213300005840Miscanthus RhizosphereVPDRCLTELRERGYLVFEGFLGADELAAAQEALWLH
Ga0070717_1011303813300006028Corn, Switchgrass And Miscanthus RhizosphereMRVPDRCLADLRERGYLLFEGFLEADELATAREALWLHYPRPETYFADPAAHAWLA
Ga0070717_1161435023300006028Corn, Switchgrass And Miscanthus RhizosphereVPDRCLADLRERGYLLFEGFLEADELAAAQEALWL
Ga0070717_1169210733300006028Corn, Switchgrass And Miscanthus RhizosphereVPDRCLTVLRERGYLVFEGFLGADELAAAQEALWLHFPRP
Ga0075017_10045551013300006059WatershedsMRVPDRCLAELRERGYLVFESFLAAHELAAAQEALWLHYPRPEEYFANPAAHT
Ga0070712_10003916753300006175Corn, Switchgrass And Miscanthus RhizosphereMRVPDRCVVDLRDRGYLIFEGFLEADELAAAQDALWLHYPRPEEYFADPAAHAWLAT
Ga0070712_10029500133300006175Corn, Switchgrass And Miscanthus RhizosphereVPDRCLTVLRERGYLVFEGFLGADELAAAQEALWLHFPRPEEYFADP
Ga0068871_10242930013300006358Miscanthus RhizosphereMRVPDRCLADLRQRGYLVFEDFLDPDELAAAQEALWLHYPRPEEYFADPAAH
Ga0066660_1115762133300006800SoilMRVPDGCLAQLRERGYLVFEGFLGADELAAAQEALWLHYPRPEEYFAD
Ga0079221_1086401213300006804Agricultural SoilMKVPDRCLADLRERGYLLFEGFLEADEMAAAQEALWLHYPRPESYFADPAA
Ga0075428_10231614113300006844Populus RhizosphereVKVPDRNLHDLREQGFTIVEGFLAPDELKAAQEALWLH
Ga0075421_10202641823300006845Populus RhizosphereVKVPDRNLHDLREQGFTIVEGFLAPDELKAAQEALWLHYPRPEEYFADP
Ga0073928_1086596423300006893Iron-Sulfur Acid SpringMRVPDRCLADLRERGYLLFEGFLEADELAAAQEALWLHYPRPEV
Ga0079219_1004757313300006954Agricultural SoilVPDRCLTELRERGYLVFEGFLGADELAAAQEALWLHFPRPEEYFADP
Ga0066710_10457551623300009012Grasslands SoilMRVPDHCLADLREKGYLLFEGFLSPDELSAAQDALWLHYPR
Ga0111539_1134464813300009094Populus RhizosphereVKVPDRKVHELRERGFTIVEGFLAPDELEAAREALWLHYPRPEEYF
Ga0075418_1281424213300009100Populus RhizosphereVKVPDRNLHDLREQGFTIVEGFLAPDEAEAAQEALWLHYPRPEEYFADPSAHHEYA
Ga0105247_1115176423300009101Switchgrass RhizosphereVPDRCLTELRERGYLVFEGFLGADELAAAQEALWLHF
Ga0066709_10284530423300009137Grasslands SoilMRVPDRCVAELQDRGYLVFEGFLEADELAAAQEALWLHYPRPEEYFAD
Ga0105243_1104705313300009148Miscanthus RhizosphereVADLRERGYLVFEGFLGAGELAAAQEALWLHYPRPGEYFADPAAYAW
Ga0105241_1042343933300009174Corn RhizosphereVPDRCLTVLRERGYLVFEGFLGADELAAAQEALWLHFPR
Ga0105242_1026795013300009176Miscanthus RhizosphereVADLRERGYLVFEGFLGAGELAAAQEALWLHYPRPGEYFADPAAYAWLATSQ
Ga0123338_1027946913300009686Glacier ValleyMRIPDAAIDAVREHGYVVVPGFLGARELERAQEALWLHYPKPDEYFADPAAHAKY
Ga0126374_1181103613300009792Tropical Forest SoilMRVPDRCVTDLRERGYLVFEGFLAGDELAEAQDALWLHYPRPEEYFSDPA
Ga0126380_1160005333300010043Tropical Forest SoilMRVPDRCLADLRERGYLVFEGFLDADELAAAQEALWLHY
Ga0126373_1005505513300010048Tropical Forest SoilMRVPDRCLADLRERGYLLFEGFLEADELAAAQEALW
Ga0126373_1235697613300010048Tropical Forest SoilMRVPDRCLADLRERGYLLFEGFLEADELAAAQEALWLHYPRPEVYFADPAAHAWL
Ga0126372_1018579113300010360Tropical Forest SoilMRVPDRCLADLRERGYLLFEGFLEADELAAAQDAL
Ga0126372_1065050613300010360Tropical Forest SoilMRVPDRCLADLRERGYLLFEGFLEADELAAAQEAL
Ga0126372_1117633013300010360Tropical Forest SoilMRVPDRCLADLRERGYLLFEGFLEADELAAAREAL
Ga0126372_1227297323300010360Tropical Forest SoilMRVPDPRLADLRERGYLLFEGFLEADELAAAREALWLHYP
Ga0126378_1012660013300010361Tropical Forest SoilMRVPDRCLADLRERGYLLFEGFLEADELAAAQEALWLHY
Ga0126378_1027659343300010361Tropical Forest SoilMRVPDRCLADLRERGYLLFEGFLEADELAAAQEALWLHYPRPEVYFA
Ga0126378_1306841413300010361Tropical Forest SoilLTDLRERGYLLFEGFLEADELAAAQEALWLHYPRPEVYFADPAAHAWLATDQ
Ga0126379_1180909313300010366Tropical Forest SoilLADLRERGYLLFEGFLEADELAAAQEALWLHYPRPEVYFADPAAH
Ga0134128_1048443423300010373Terrestrial SoilVPGRCLTELRERGYLVFEGFLGADELAAAQEALWLHF
Ga0134128_1116796513300010373Terrestrial SoilVRVPDRCLTELRERGYLVFEGFLGADELAAAQEALWLHFPRPEEYFADPA
Ga0105239_1015893643300010375Corn RhizosphereVADLRERGYLVFEGFLGAGELAAAQEALWLHYPRPGEYFADPAAYAWLATS
Ga0126381_10014157513300010376Tropical Forest SoilMRVPDRCLADLRERGYLLFEGFLEADELAAAQEALWLHYPRPE
Ga0134126_1054577013300010396Terrestrial SoilMRVPDRCVVDLRDRGYLIFEGFLEADELAAAQDALWLHY
Ga0134121_1150969613300010401Terrestrial SoilVGVPDRCLTELRERGYLVFEGFLGADELAAAQEALWLHF
Ga0126350_1190866413300010880Boreal Forest SoilMRVPDRCLADLRHRGYLLFEGFLEADELAAAQEALWLHYPRPEVYFADPAAH
Ga0137364_1059335013300012198Vadose Zone SoilMRVPDHCLADLREKGYLLFEGFLSADELAAAQEALWLHYPRPEVYFADPA
Ga0137382_1022103043300012200Vadose Zone SoilMRVPDHCLADLREKGYLLYEGFLSADELAAAQEALWLHYP
Ga0137376_1044179013300012208Vadose Zone SoilMRVPDHCLADLREKGYLLYEGFLSADELAAAQEALWLHYPRPEE
Ga0137371_1007871013300012356Vadose Zone SoilMKVPDRCLADLRERGYLLFEGFLEADELAAAREALWLHYPRP
Ga0137390_1160947223300012363Vadose Zone SoilMRVPDRCLADLRERGYLVFEGFLGADELAAAQEALWLHYPTPEQYFADPAA
Ga0157319_101609513300012497Arabidopsis RhizosphereVRVPDRCLTELRERGYLVFEGFLGADELAAAQEALWLHFPRPGEY
Ga0136611_1050963313300012682Polar Desert SandMRVPDRCVADLRERGYLVFEGFLEADELIAAKEALWLHYPQ
Ga0137394_1118001213300012922Vadose Zone SoilLADLRERGYLLFEGFLEADELAAAQEALWLHYPRPEEYFADPAAHAWL
Ga0137407_1227541823300012930Vadose Zone SoilMRVPDRCLADLRELGYLVFEGFLNADELVAAQEALWLHYPR
Ga0164300_1047612923300012951SoilVPDRCLTELRERGYLVFEGFLGADELAAAQEALWLHFPRPEEYFADPAAYAWLA
Ga0164299_1012628523300012958SoilVRVPDRCLTELRERGYLVFEGFLGADELAAAQEAL*
Ga0164301_1016793333300012960SoilMRVPDRCVADLRKQGYLVVEDFLAADELEAAQEALWLHYPRPDEYFADPA
Ga0164302_1069189313300012961SoilMRVPDRCVADLRKQGYLVVEDFLAADELEAAQEALWLHYPRP
Ga0164308_1044884333300012985SoilMRVPDRGVADLREVGALVFEGFLAADELAAAQEALWLHYPRPEEYFADPAAHAWLA
Ga0164307_1051872233300012987SoilMRVPDLGVADLRQQGYLVVEDFRAADELEAAQEALWLHYP
Ga0157374_1138876013300013296Miscanthus RhizosphereMRVPDHCLADLREQGYLLFEGFLEADELAAAQEALWL
Ga0163162_1205381213300013306Switchgrass RhizosphereMRVPEHCLSDLRERGFLVCEGFLGRDELAAAQEALWLHDPRPEKYFEDPAAF
Ga0163162_1214953723300013306Switchgrass RhizosphereMRVPDRCLADLRQRGYLVFEGFLEADELAAAQEALWLHYPRPEEYFADP
Ga0157372_1064596713300013307Corn RhizosphereVRVPDRCLTVLRERGYLVFEGFLGADELAAAQEALWLHFPRPEEYFADPAAYA
Ga0157372_1247218623300013307Corn RhizosphereMKVPDRCLADLRERGYLLFEGFLEADELAAAQEALWLHYPRP
Ga0157377_1087132813300014745Miscanthus RhizosphereVRVPDRCLTELREQGYLVFEGFLGADELAAAQEALWLHFPRPEEYFADPA
Ga0157376_1085669013300014969Miscanthus RhizosphereVRVPDRCLTVLRERGYLVFEGFLGADELAAAQEALWLHFPRPEEYFA
Ga0157376_1241563123300014969Miscanthus RhizosphereMRVPDRCLADLRQRGYLVFEGFLAADELAAAQEALWLHYPRPEEYFADPAAHA
Ga0167651_103865723300015190Glacier Forefield SoilLADLRQRGYLVFEGFLEADELAAAQEALWLHYPRPEE
Ga0132256_10183449013300015372Arabidopsis RhizosphereVKVPDRNLRELRERGFTVVEGFLGRDELTAAQAALWLHYPRPEEYFA
Ga0182041_1131604123300016294SoilVPEGCLADLRERGYLLFEGFLEADELAAAQEALWL
Ga0182034_1148354723300016371SoilVPDRCVADLRERGYLLFEGFLEADELAAAQEALWLHY
Ga0182039_1085217513300016422SoilVPDRCLADLRERGYLLFEGFLEADELAAAQEALWLHYPRPEAYF
Ga0182038_1072546313300016445SoilVPHGCLADLRERGYLLFEGFLEADALAAAQEALWLHYPRPEAYF
Ga0187785_1049973623300017947Tropical PeatlandVPDRCLADLRERGYLLFEGFLGADELAAAREALWLH
Ga0184625_1037664423300018081Groundwater SedimentMRVPDRCLADLRERGYMAFEGFLEADEVAAARDAL
Ga0190265_1041357923300018422SoilVEVPDRNLRDLREQGFTIVEGFLAPDELEAAQEALWVHYPRPEEYF
Ga0210382_1044502823300021080Groundwater SedimentMLVRVPDRCVTELRERGYFVFEGFLGADELAAAQEALWLHYPRPEEYFADSGAHAW
Ga0210387_1123155513300021405SoilMRVPDQCLADLRERGYFVFEGFLKADELAAAQEALWTYFP
Ga0210384_1166811223300021432SoilMRVPDQCVSDLRERGFLVFEGFLGTEELAMAREMLWRHFPRPEEYFA
Ga0210392_1063626923300021475SoilVPDRCLADLRERGYLLFEGFLEADELAAAQEALWLHYPRPESYFADPAAHAWLAT
Ga0210402_1088851013300021478SoilVPDRCLTELRERGYLVFEGFLEADELAAAREALWLHFP
Ga0210402_1145043513300021478SoilMKVPDRCLADLRERGYLLFEGFLEADELAAAQEALWLHYPRPESYFADPAAHAWL
Ga0126371_1023532333300021560Tropical Forest SoilVPDHCLADLRERGYLLFEGFLEADELAAAQEALWLHYPRPEVYFADPAAHA
Ga0126371_1286736123300021560Tropical Forest SoilMRVPDRCVTDLRERGYLVFEGFLAGDELAEAQDALWLHYP
Ga0242665_1040435313300022724SoilVPNRCLAALRERGYLLFEGFLEADELAAAQEALWLHYPRPEVYFADPAAHAWLAT
Ga0247687_101534823300024286SoilVPERCVADLRERGYLVFEGFLGAGELAAAQEALWLHYPRPG
Ga0247681_106518623300024310SoilVPDRCLTELRERGYLVFEGFLGADELAAAQEALWL
Ga0207653_1001337613300025885Corn, Switchgrass And Miscanthus RhizosphereVPDRCLTELRERGYLVFEGFLGADELAAAQEALWLHFPRP
Ga0207699_1037457313300025906Corn, Switchgrass And Miscanthus RhizosphereMRVPDRCLAGLRERGYLLFEGFLEADELAAAQEALWLHYPRPEVYFADPAA
Ga0207699_1074893623300025906Corn, Switchgrass And Miscanthus RhizosphereVPDRCLADLRERGYLLFEGFLEADELAAAREALWLHY
Ga0207699_1079282423300025906Corn, Switchgrass And Miscanthus RhizosphereVPDRCLADLRERGYLLFEGFLEADELAAAQEALWLHYPRPEVYFADPAAHAW
Ga0207695_1001931673300025913Corn RhizosphereMRVPDRCVADLREVGALVFEGFLAADELAAAQEAL
Ga0207693_1043845243300025915Corn, Switchgrass And Miscanthus RhizosphereVPDRCLADLRERGYLLFEGFLEADELAAAQEALWLH
Ga0207693_1045016033300025915Corn, Switchgrass And Miscanthus RhizosphereMKVPDRCLADLRERGYLLFEGFLEADELAAAQEALWLHYP
Ga0207652_1148114623300025921Corn RhizosphereMRVPDRCLADLRERGYLLFEGFLGADELAAAREALWLHYPRPEV
Ga0207700_1111885723300025928Corn, Switchgrass And Miscanthus RhizosphereVPDRCLADLRERGYLLFEGFLEADELAAAQEALWLHYP
Ga0207644_1155779523300025931Switchgrass RhizosphereVPDRCLTELRERGYLVFEGFLGADELAAAQEALWLHFPRPEEYFADPAA
Ga0207711_1164144513300025941Switchgrass RhizosphereVPERCLTELRERGYLVFEGFLGAGELAAAQEALWLHFP
Ga0207676_1219437213300026095Switchgrass RhizosphereMKVPDRCLADLRERGYLVFEGFLEADELAAAQEALWLHYPQPEEYFAH
Ga0209471_127819223300026318SoilMRAPDRCLAELRERGYLVFESFLGADELAAAQEALWLHYPRPEEYFANPA
Ga0257161_113674523300026508SoilVPDRCLADLRERGYLLFEGFLEADELAAAQEALWLHYPRPESY
Ga0209178_131825813300027725Agricultural SoilVRGMKVPDRCLADLRERGYLLFEGFLEADEMAAAQEALWLHYPRPESY
Ga0209380_1011821223300027889SoilMRVPDRCLMDLRERGYFVFEGFLGADELAAAQEALWLHYPRPEEYFANPAAHAWLANS
Ga0209380_1016036713300027889SoilVPDRCLADLRERGYLLFEGFLEADELAAAQEALWLHYPRPEVYFADP
Ga0209069_1027115613300027915WatershedsMRVPDRCVADLRESGYLVFEGFLDADELAAAQEALWLHYPRPEEY
Ga0247717_104251113300028006SoilMRVPDRYLAGLREQGYLVFEGFLAADELAAAQESLWFHYPRPHE
Ga0268266_1113638823300028379Switchgrass RhizosphereVPERCLTELRERGYLVFEGFLGAGELAAAQEALWLHFPRPGEYFADPAA
Ga0268265_1266209123300028380Switchgrass RhizosphereMRVPDRCLADLRERGYLVFEGFLEADELAAAQEALWLHY
Ga0247822_1035792523300028592SoilMRVPDRCLADLRDRGFLVFEGFLGADELAAAQEALWLHYPRPEEYF
Ga0307312_1026279513300028828SoilMRVPDRCLAGLRERGYLLLEGFLEADELAAAQEALW
Ga0307312_1062952713300028828SoilVPDRCLTELRERGYLVFEGFLGADELAAAQEALWLHFPRPGEYFADPAAY
Ga0222749_1055575413300029636SoilMRVPDRCVADLRQRGYLVFEGFLDADELAAAQEALWLHYPRPEEYFADPAAH
Ga0302325_1041000513300031234PalsaMRVPDQCLADLRERGYLVFEGFLAADELAAAQRALWSHFPRPEEYFAD
Ga0265327_1028850123300031251RhizosphereMRPGQLASMRMPDRCVAELRERGYLVFEGFLGTDELAAAQEALWLH
Ga0318516_1029012823300031543SoilVPDGCLADLREQGYLLFEGFLGADELAAGSAATGLPGPRPEAYF
Ga0318538_1062897513300031546SoilVPDGCLADLRERGYLLFEGFLEADELAAAQEALWLH
Ga0318573_1063336613300031564SoilVPDGCLADLRERGYLLFEGFLEADELAAAQEALWLHYPRPA
Ga0318515_1009343313300031572SoilMRVPDRCVADLRERGYLLFEGFLEADELAAAQEALWLHY
Ga0318555_1051747723300031640SoilVPDRCVADLRERGYLLFEGFLEADELAAAQEALWLHYP
Ga0307372_1037695713300031671SoilMLVKVPDRCLTDLRERGYLIFEGFLAANELAAAREALWLHYPP
Ga0318572_1086416913300031681SoilVPDRCLADLRERGYLLFEGFLEADELAAAQEALWLHYPRPEVYFADPA
Ga0310686_10987890733300031708SoilMRVPDRRVVDLRDRGYLIFEGFLEADELAAAQDALWLHYPRPEEYF
Ga0310686_11406889313300031708SoilVSELRERGFLVCEGFLGTKELEAAQEALWLRYPGPEEYFSDPTTHASL
Ga0265342_1071398113300031712RhizosphereMRPGQLASMRMPDRCVAELRERGYLVFEGFLGTDELAAAQEALWLHYPRPEE
Ga0318496_1056870413300031713SoilVPDGCLADLREQGYLLFEGFLGADELAAAQEALWLHYPRPEAYF
Ga0302321_10010665013300031726FenMRVPDRCLADLRQQGYLVFEGFLEADELAAAQEALWFHYPRPGEYFADP
Ga0318492_1076123513300031748SoilVPEGCLADLRERGYLLFEGFLEADELAAAQEALWLHYPRPEV
Ga0318554_1005531613300031765SoilMRVPDRCVADLRERGYLLFEGFLEADELAAAQEALWLHYPRPEAY
Ga0318498_1049680813300031778SoilVPDRCLADLRERGYLLFEGFLGADELAAAQEALWLHYPR
Ga0318548_1036646333300031793SoilVPDGCLADLRERGYLLFEGFLEADELAAAQEALWLHYP
Ga0318497_1002955513300031805SoilVPDGCLADLREQGYLLFEGFLGADELAAAQEALWLHYPR
Ga0318497_1015154513300031805SoilVPDRCLADLRERGYLLFEGFLEADELAAAQEALWLHYPRPEAY
Ga0318495_1028713613300031860SoilVPDGCLADLRERGYLLFEGFLEADELAAAQEALWLHYPRPEAYF
Ga0306919_1109038313300031879SoilVPDRCLADLRERGYLLFEGFLEADELAAAQEALWLHY
Ga0318536_1061640723300031893SoilMRVPDRCLADLRERGYLLFEGFLEADEMAAAQEALWLHYPRPEVY
Ga0318520_1050697413300031897SoilVPDRCLADLRERGYLLFEGFLEADELAAGSAATGLP
Ga0306921_1118002333300031912SoilMRVPDRCLADLRERGYLLFEGFLEADEMAAAQEALWLHYPRPEVYFADPA
Ga0306921_1180113113300031912SoilVPDGCLADLRERGYLLFEGFLEADELAAAQEALWLHYPRPEVY
Ga0310910_1088182323300031946SoilVPDRCVADLRERGYLLFEGFLEADELAAAQEALWLHYPRPEA
Ga0318531_1000858373300031981SoilMRVPDRCLADLRERGYLLFEGFLEADELAAAQEALWLH
Ga0306922_1222265923300032001SoilMRVPDRCLADLRERGYLLFEGFLEADEMAAAQEALWLHYPRPEVYFAD
Ga0307416_10050778013300032002RhizosphereMRVPDRCVRDLRERGFLVFEGFLEADELAAAQEALWLHYPRPEEYFADPA
Ga0318504_1057156613300032063SoilVPDGCLADLREQGYLLFEGFLGADELAAAQEALWLHYPRPARQPRGN
Ga0306924_1026429913300032076SoilMRVPDGCLADLRERGYLLFEGFLEADELAAAREAL
Ga0306924_1045856313300032076SoilMRVPDRCVADLRERGYLLFEGFLEADELAAAQEALWLHYP
Ga0311301_1020397563300032160Peatlands SoilMRVPDAALEEIRERGFTIVEGFLDADELRAAQDALWLHYPKPEEYFADPAGHARYA
Ga0307472_10028104823300032205Hardwood Forest SoilVPDRCLTELRERGYLVFEGFLGADELAAAQEALWLHFPRPEEYFADPAAYAW
Ga0335085_1240869413300032770SoilMRVPDGCLTDLREQGYLLFEGFLEAGELAAARDAL
Ga0335078_1213746113300032805SoilMRVPDRCLADLREQGYLLFEGFLGADELAAAREALWL
Ga0335075_1095192223300032896SoilMRVPDRCVVDLRDRGYLIFEGFLEADELAAAQDALWLHYPRPEEYFADPAAHAWL
Ga0335073_1005287213300033134SoilVPDRCLADLRERGYLLFEGFLEADELAAAQEALWLHYPRPE
Ga0335073_1154189513300033134SoilMRVPDRCVADLRDRGYLIFEGFLEADELAAAQDALWLHYPRPEEYFADPAAHA
Ga0335077_1198324813300033158SoilVPDRCLADLREQGYLLFEGFLGADELAAAQEALWLHY


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.