Basic Information | |
---|---|
Family ID | F028882 |
Family Type | Metagenome |
Number of Sequences | 190 |
Average Sequence Length | 43 residues |
Representative Sequence | MTKDEMIEWFKSAPEGSRHQRMLWAARKIARLTGATEGGAY |
Number of Associated Samples | 110 |
Number of Associated Scaffolds | 190 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | No |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 89.89 % |
% of genes near scaffold ends (potentially truncated) | 95.79 % |
% of genes from short scaffolds (< 2000 bps) | 91.05 % |
Associated GOLD sequencing projects | 101 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.49 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (94.211 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (33.684 % of family members) |
Environment Ontology (ENVO) | Unclassified (51.053 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (55.263 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 36.23% β-sheet: 0.00% Coil/Unstructured: 63.77% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.49 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 190 Family Scaffolds |
---|---|---|
PF04392 | ABC_sub_bind | 2.63 |
PF01527 | HTH_Tnp_1 | 1.58 |
PF07045 | DUF1330 | 1.05 |
PF01381 | HTH_3 | 1.05 |
PF01695 | IstB_IS21 | 1.05 |
PF00226 | DnaJ | 0.53 |
PF03734 | YkuD | 0.53 |
PF01068 | DNA_ligase_A_M | 0.53 |
PF00083 | Sugar_tr | 0.53 |
PF01548 | DEDD_Tnp_IS110 | 0.53 |
PF13374 | TPR_10 | 0.53 |
PF04519 | Bactofilin | 0.53 |
PF13683 | rve_3 | 0.53 |
PF00239 | Resolvase | 0.53 |
PF13414 | TPR_11 | 0.53 |
PF01565 | FAD_binding_4 | 0.53 |
PF00043 | GST_C | 0.53 |
PF07647 | SAM_2 | 0.53 |
PF13592 | HTH_33 | 0.53 |
PF00196 | GerE | 0.53 |
PF03401 | TctC | 0.53 |
COG ID | Name | Functional Category | % Frequency in 190 Family Scaffolds |
---|---|---|---|
COG2984 | ABC-type uncharacterized transport system, periplasmic component | General function prediction only [R] | 2.63 |
COG1484 | DNA replication protein DnaC | Replication, recombination and repair [L] | 1.05 |
COG5470 | Uncharacterized conserved protein, DUF1330 family | Function unknown [S] | 1.05 |
COG0435 | Glutathionyl-hydroquinone reductase | Energy production and conversion [C] | 0.53 |
COG0625 | Glutathione S-transferase | Posttranslational modification, protein turnover, chaperones [O] | 0.53 |
COG1376 | Lipoprotein-anchoring transpeptidase ErfK/SrfK | Cell wall/membrane/envelope biogenesis [M] | 0.53 |
COG1423 | ATP-dependent RNA circularization protein, DNA/RNA ligase (PAB1020) family | Replication, recombination and repair [L] | 0.53 |
COG1664 | Cytoskeletal protein CcmA, bactofilin family | Cytoskeleton [Z] | 0.53 |
COG1793 | ATP-dependent DNA ligase | Replication, recombination and repair [L] | 0.53 |
COG1961 | Site-specific DNA recombinase SpoIVCA/DNA invertase PinE | Replication, recombination and repair [L] | 0.53 |
COG2452 | Predicted site-specific integrase-resolvase | Mobilome: prophages, transposons [X] | 0.53 |
COG3034 | Murein L,D-transpeptidase YafK | Cell wall/membrane/envelope biogenesis [M] | 0.53 |
COG3181 | Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctC | Energy production and conversion [C] | 0.53 |
COG3547 | Transposase | Mobilome: prophages, transposons [X] | 0.53 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 94.74 % |
Unclassified | root | N/A | 5.26 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300000655|AF_2010_repII_A100DRAFT_1023883 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1146 | Open in IMG/M |
3300004633|Ga0066395_10375523 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 796 | Open in IMG/M |
3300005178|Ga0066688_10219987 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1210 | Open in IMG/M |
3300005184|Ga0066671_10323499 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 973 | Open in IMG/M |
3300005332|Ga0066388_101042516 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1376 | Open in IMG/M |
3300005332|Ga0066388_101332920 | All Organisms → cellular organisms → Bacteria | 1240 | Open in IMG/M |
3300005332|Ga0066388_101718405 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1111 | Open in IMG/M |
3300005332|Ga0066388_105910563 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 618 | Open in IMG/M |
3300005332|Ga0066388_108111133 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 525 | Open in IMG/M |
3300005435|Ga0070714_101171358 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 750 | Open in IMG/M |
3300005445|Ga0070708_101727368 | Not Available | 581 | Open in IMG/M |
3300005467|Ga0070706_100206829 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. | 1833 | Open in IMG/M |
3300005467|Ga0070706_100261181 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1616 | Open in IMG/M |
3300005471|Ga0070698_100206275 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1901 | Open in IMG/M |
3300005546|Ga0070696_101394144 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 597 | Open in IMG/M |
3300005556|Ga0066707_10271856 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1108 | Open in IMG/M |
3300005569|Ga0066705_10739177 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 590 | Open in IMG/M |
3300005587|Ga0066654_10406018 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 743 | Open in IMG/M |
3300005713|Ga0066905_100435446 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1074 | Open in IMG/M |
3300005713|Ga0066905_100985837 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 742 | Open in IMG/M |
3300005713|Ga0066905_101008851 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 734 | Open in IMG/M |
3300005713|Ga0066905_102125156 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 523 | Open in IMG/M |
3300005718|Ga0068866_10903042 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 621 | Open in IMG/M |
3300005764|Ga0066903_100798487 | Not Available | 1687 | Open in IMG/M |
3300005764|Ga0066903_102369402 | All Organisms → Viruses → Predicted Viral | 1026 | Open in IMG/M |
3300005764|Ga0066903_103061294 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 905 | Open in IMG/M |
3300005764|Ga0066903_103074240 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 903 | Open in IMG/M |
3300005764|Ga0066903_103095834 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 900 | Open in IMG/M |
3300005764|Ga0066903_104768712 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 721 | Open in IMG/M |
3300005764|Ga0066903_104816583 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 717 | Open in IMG/M |
3300005764|Ga0066903_105387893 | Not Available | 675 | Open in IMG/M |
3300005764|Ga0066903_105475991 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 669 | Open in IMG/M |
3300005764|Ga0066903_106248313 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 622 | Open in IMG/M |
3300005764|Ga0066903_107798462 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 550 | Open in IMG/M |
3300005764|Ga0066903_107949424 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 544 | Open in IMG/M |
3300005764|Ga0066903_108633506 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 518 | Open in IMG/M |
3300005764|Ga0066903_108748736 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 514 | Open in IMG/M |
3300006038|Ga0075365_10594990 | Not Available | 782 | Open in IMG/M |
3300006175|Ga0070712_100310374 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1279 | Open in IMG/M |
3300006178|Ga0075367_10906323 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 562 | Open in IMG/M |
3300006791|Ga0066653_10121721 | All Organisms → cellular organisms → Bacteria | 1226 | Open in IMG/M |
3300006847|Ga0075431_100676481 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1011 | Open in IMG/M |
3300006904|Ga0075424_101260569 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 786 | Open in IMG/M |
3300009137|Ga0066709_103117358 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 606 | Open in IMG/M |
3300010043|Ga0126380_11393568 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 615 | Open in IMG/M |
3300010046|Ga0126384_10142614 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1834 | Open in IMG/M |
3300010046|Ga0126384_10391049 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1171 | Open in IMG/M |
3300010046|Ga0126384_11939205 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 562 | Open in IMG/M |
3300010046|Ga0126384_12182863 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 533 | Open in IMG/M |
3300010047|Ga0126382_10055208 | All Organisms → cellular organisms → Bacteria | 2351 | Open in IMG/M |
3300010047|Ga0126382_10736241 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 832 | Open in IMG/M |
3300010047|Ga0126382_11956229 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 556 | Open in IMG/M |
3300010048|Ga0126373_10395000 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1406 | Open in IMG/M |
3300010301|Ga0134070_10245678 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 668 | Open in IMG/M |
3300010303|Ga0134082_10082508 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1259 | Open in IMG/M |
3300010337|Ga0134062_10133147 | All Organisms → cellular organisms → Bacteria | 1093 | Open in IMG/M |
3300010358|Ga0126370_10223290 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1441 | Open in IMG/M |
3300010358|Ga0126370_10413135 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1113 | Open in IMG/M |
3300010358|Ga0126370_11001893 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 763 | Open in IMG/M |
3300010358|Ga0126370_11308924 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 680 | Open in IMG/M |
3300010359|Ga0126376_12638292 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 551 | Open in IMG/M |
3300010360|Ga0126372_11171698 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 791 | Open in IMG/M |
3300010361|Ga0126378_10554822 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1263 | Open in IMG/M |
3300010361|Ga0126378_10913171 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 984 | Open in IMG/M |
3300010361|Ga0126378_11887160 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 680 | Open in IMG/M |
3300010361|Ga0126378_12216885 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 627 | Open in IMG/M |
3300010361|Ga0126378_12647019 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 573 | Open in IMG/M |
3300010361|Ga0126378_13236286 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 518 | Open in IMG/M |
3300010362|Ga0126377_10888192 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 953 | Open in IMG/M |
3300010362|Ga0126377_10951101 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 924 | Open in IMG/M |
3300010366|Ga0126379_10430469 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1376 | Open in IMG/M |
3300010366|Ga0126379_10565432 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1218 | Open in IMG/M |
3300010398|Ga0126383_10618093 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1156 | Open in IMG/M |
3300010398|Ga0126383_11693931 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 721 | Open in IMG/M |
3300010398|Ga0126383_13061899 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 546 | Open in IMG/M |
3300010868|Ga0124844_1022199 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1876 | Open in IMG/M |
3300012208|Ga0137376_11425655 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 583 | Open in IMG/M |
3300012355|Ga0137369_10174633 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1684 | Open in IMG/M |
3300012358|Ga0137368_10911982 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 534 | Open in IMG/M |
3300012923|Ga0137359_10532978 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1034 | Open in IMG/M |
3300012948|Ga0126375_11573453 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 565 | Open in IMG/M |
3300012971|Ga0126369_11860975 | All Organisms → cellular organisms → Bacteria | 690 | Open in IMG/M |
3300012972|Ga0134077_10467837 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 554 | Open in IMG/M |
3300016270|Ga0182036_10271343 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 1279 | Open in IMG/M |
3300016270|Ga0182036_10666283 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 839 | Open in IMG/M |
3300016270|Ga0182036_11252999 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 618 | Open in IMG/M |
3300016294|Ga0182041_10478023 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1076 | Open in IMG/M |
3300016319|Ga0182033_10327448 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1274 | Open in IMG/M |
3300016319|Ga0182033_11004751 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 742 | Open in IMG/M |
3300016319|Ga0182033_11356152 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 640 | Open in IMG/M |
3300016319|Ga0182033_11469435 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 615 | Open in IMG/M |
3300016319|Ga0182033_12210655 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 502 | Open in IMG/M |
3300016341|Ga0182035_10990360 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 745 | Open in IMG/M |
3300016341|Ga0182035_11393840 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 629 | Open in IMG/M |
3300016357|Ga0182032_10532944 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 969 | Open in IMG/M |
3300016357|Ga0182032_10653716 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 879 | Open in IMG/M |
3300016371|Ga0182034_10051395 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2725 | Open in IMG/M |
3300016371|Ga0182034_10097995 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 2092 | Open in IMG/M |
3300016371|Ga0182034_10761697 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 826 | Open in IMG/M |
3300016371|Ga0182034_11721515 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 552 | Open in IMG/M |
3300016387|Ga0182040_11115791 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 661 | Open in IMG/M |
3300016387|Ga0182040_11907351 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 509 | Open in IMG/M |
3300016404|Ga0182037_10274372 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1344 | Open in IMG/M |
3300016422|Ga0182039_12283297 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 500 | Open in IMG/M |
3300021560|Ga0126371_10759573 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1117 | Open in IMG/M |
3300025898|Ga0207692_10914928 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 577 | Open in IMG/M |
3300025905|Ga0207685_10833424 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 510 | Open in IMG/M |
3300025910|Ga0207684_10228299 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1606 | Open in IMG/M |
3300025915|Ga0207693_10667105 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 807 | Open in IMG/M |
3300025923|Ga0207681_11825759 | Not Available | 507 | Open in IMG/M |
3300026323|Ga0209472_1262584 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 551 | Open in IMG/M |
3300027874|Ga0209465_10131165 | All Organisms → cellular organisms → Bacteria | 1239 | Open in IMG/M |
3300028881|Ga0307277_10215747 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 843 | Open in IMG/M |
3300028885|Ga0307304_10073312 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1319 | Open in IMG/M |
3300031544|Ga0318534_10605588 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 622 | Open in IMG/M |
3300031545|Ga0318541_10009447 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 4329 | Open in IMG/M |
3300031545|Ga0318541_10173284 | Not Available | 1189 | Open in IMG/M |
3300031545|Ga0318541_10389833 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 778 | Open in IMG/M |
3300031545|Ga0318541_10454518 | All Organisms → cellular organisms → Bacteria | 716 | Open in IMG/M |
3300031545|Ga0318541_10513258 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 671 | Open in IMG/M |
3300031572|Ga0318515_10209167 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1046 | Open in IMG/M |
3300031572|Ga0318515_10423648 | Not Available | 712 | Open in IMG/M |
3300031573|Ga0310915_10510583 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 854 | Open in IMG/M |
3300031640|Ga0318555_10095135 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1564 | Open in IMG/M |
3300031640|Ga0318555_10558509 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 620 | Open in IMG/M |
3300031668|Ga0318542_10539299 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 607 | Open in IMG/M |
3300031679|Ga0318561_10828912 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 508 | Open in IMG/M |
3300031680|Ga0318574_10085571 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1726 | Open in IMG/M |
3300031719|Ga0306917_10380942 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1100 | Open in IMG/M |
3300031736|Ga0318501_10061149 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales | 1794 | Open in IMG/M |
3300031744|Ga0306918_10451869 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1004 | Open in IMG/M |
3300031744|Ga0306918_10847026 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 713 | Open in IMG/M |
3300031744|Ga0306918_11139525 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 603 | Open in IMG/M |
3300031748|Ga0318492_10090365 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 1493 | Open in IMG/M |
3300031748|Ga0318492_10303297 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 831 | Open in IMG/M |
3300031763|Ga0318537_10158160 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 844 | Open in IMG/M |
3300031764|Ga0318535_10367876 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 642 | Open in IMG/M |
3300031765|Ga0318554_10832103 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 516 | Open in IMG/M |
3300031765|Ga0318554_10874819 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 501 | Open in IMG/M |
3300031768|Ga0318509_10641924 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 591 | Open in IMG/M |
3300031769|Ga0318526_10029207 | Not Available | 2000 | Open in IMG/M |
3300031769|Ga0318526_10175660 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 873 | Open in IMG/M |
3300031771|Ga0318546_10171022 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1473 | Open in IMG/M |
3300031771|Ga0318546_10545604 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 814 | Open in IMG/M |
3300031771|Ga0318546_10763194 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 680 | Open in IMG/M |
3300031777|Ga0318543_10404976 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 611 | Open in IMG/M |
3300031780|Ga0318508_1124745 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 723 | Open in IMG/M |
3300031793|Ga0318548_10457913 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 624 | Open in IMG/M |
3300031797|Ga0318550_10445157 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 626 | Open in IMG/M |
3300031821|Ga0318567_10020766 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 3171 | Open in IMG/M |
3300031821|Ga0318567_10041540 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 2341 | Open in IMG/M |
3300031835|Ga0318517_10265195 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 775 | Open in IMG/M |
3300031846|Ga0318512_10025187 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 2498 | Open in IMG/M |
3300031859|Ga0318527_10023368 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 2226 | Open in IMG/M |
3300031890|Ga0306925_10223441 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2031 | Open in IMG/M |
3300031890|Ga0306925_10398345 | All Organisms → cellular organisms → Bacteria | 1475 | Open in IMG/M |
3300031890|Ga0306925_11677957 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 614 | Open in IMG/M |
3300031910|Ga0306923_11347463 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 754 | Open in IMG/M |
3300031910|Ga0306923_11710549 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 649 | Open in IMG/M |
3300031912|Ga0306921_10570067 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1311 | Open in IMG/M |
3300031912|Ga0306921_11790416 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 661 | Open in IMG/M |
3300031941|Ga0310912_10736894 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 763 | Open in IMG/M |
3300031941|Ga0310912_10983564 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 647 | Open in IMG/M |
3300031942|Ga0310916_10204225 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1654 | Open in IMG/M |
3300031942|Ga0310916_10333838 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1286 | Open in IMG/M |
3300031942|Ga0310916_10405914 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1159 | Open in IMG/M |
3300031942|Ga0310916_10574606 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 958 | Open in IMG/M |
3300031946|Ga0310910_10011888 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 5463 | Open in IMG/M |
3300031946|Ga0310910_10125711 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1936 | Open in IMG/M |
3300031947|Ga0310909_10292427 | All Organisms → cellular organisms → Bacteria | 1364 | Open in IMG/M |
3300031947|Ga0310909_10620891 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 902 | Open in IMG/M |
3300031954|Ga0306926_11640223 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 736 | Open in IMG/M |
3300031981|Ga0318531_10035658 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 2061 | Open in IMG/M |
3300032025|Ga0318507_10027928 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 2077 | Open in IMG/M |
3300032035|Ga0310911_10012475 | All Organisms → cellular organisms → Bacteria | 3908 | Open in IMG/M |
3300032035|Ga0310911_10582266 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 649 | Open in IMG/M |
3300032042|Ga0318545_10180710 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 753 | Open in IMG/M |
3300032043|Ga0318556_10623397 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 562 | Open in IMG/M |
3300032055|Ga0318575_10249101 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 896 | Open in IMG/M |
3300032059|Ga0318533_10162668 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1584 | Open in IMG/M |
3300032059|Ga0318533_10897662 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 650 | Open in IMG/M |
3300032064|Ga0318510_10031199 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1785 | Open in IMG/M |
3300032064|Ga0318510_10103721 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1084 | Open in IMG/M |
3300032065|Ga0318513_10471175 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 614 | Open in IMG/M |
3300032065|Ga0318513_10591074 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 544 | Open in IMG/M |
3300032094|Ga0318540_10083942 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1480 | Open in IMG/M |
3300033289|Ga0310914_10015248 | All Organisms → cellular organisms → Bacteria | 5831 | Open in IMG/M |
3300033290|Ga0318519_10808603 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 577 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 33.68% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 17.37% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 16.32% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 13.68% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 5.26% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 3.68% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 2.11% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 2.11% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.05% |
Populus Endosphere | Host-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere | 1.05% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.05% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.53% |
Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.53% |
Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.53% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.53% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.53% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300000655 | Forest soil microbial communities from Amazon forest - 2010 replicate II A100 | Environmental | Open in IMG/M |
3300004633 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio | Environmental | Open in IMG/M |
3300005178 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 | Environmental | Open in IMG/M |
3300005184 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120 | Environmental | Open in IMG/M |
3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Environmental | Open in IMG/M |
3300005556 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 | Environmental | Open in IMG/M |
3300005569 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 | Environmental | Open in IMG/M |
3300005587 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103 | Environmental | Open in IMG/M |
3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Host-Associated | Open in IMG/M |
3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
3300006038 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Host-Associated | Open in IMG/M |
3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
3300006178 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Host-Associated | Open in IMG/M |
3300006791 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102 | Environmental | Open in IMG/M |
3300006847 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Host-Associated | Open in IMG/M |
3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
3300010301 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09082015 | Environmental | Open in IMG/M |
3300010303 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09182015 | Environmental | Open in IMG/M |
3300010337 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09082015 | Environmental | Open in IMG/M |
3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
3300010868 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (PacBio error correction) | Environmental | Open in IMG/M |
3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
3300012355 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaG | Environmental | Open in IMG/M |
3300012358 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_100_16 metaG | Environmental | Open in IMG/M |
3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
3300012972 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026323 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 (SPAdes) | Environmental | Open in IMG/M |
3300027874 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes) | Environmental | Open in IMG/M |
3300028881 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_116 | Environmental | Open in IMG/M |
3300028885 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_185 | Environmental | Open in IMG/M |
3300031544 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26 | Environmental | Open in IMG/M |
3300031545 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26 | Environmental | Open in IMG/M |
3300031572 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19 | Environmental | Open in IMG/M |
3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
3300031640 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23 | Environmental | Open in IMG/M |
3300031668 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f23 | Environmental | Open in IMG/M |
3300031679 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23 | Environmental | Open in IMG/M |
3300031680 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22 | Environmental | Open in IMG/M |
3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
3300031736 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f21 | Environmental | Open in IMG/M |
3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
3300031748 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f22 | Environmental | Open in IMG/M |
3300031763 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f29 | Environmental | Open in IMG/M |
3300031764 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f27 | Environmental | Open in IMG/M |
3300031765 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22 | Environmental | Open in IMG/M |
3300031768 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f22 | Environmental | Open in IMG/M |
3300031769 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f24 | Environmental | Open in IMG/M |
3300031771 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19 | Environmental | Open in IMG/M |
3300031777 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f24 | Environmental | Open in IMG/M |
3300031780 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f21 | Environmental | Open in IMG/M |
3300031793 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f21 | Environmental | Open in IMG/M |
3300031797 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f23 | Environmental | Open in IMG/M |
3300031821 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f20 | Environmental | Open in IMG/M |
3300031835 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f21 | Environmental | Open in IMG/M |
3300031846 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f19 | Environmental | Open in IMG/M |
3300031859 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f25 | Environmental | Open in IMG/M |
3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
3300031981 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f25 | Environmental | Open in IMG/M |
3300032025 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f20 | Environmental | Open in IMG/M |
3300032035 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF170 | Environmental | Open in IMG/M |
3300032042 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f26 | Environmental | Open in IMG/M |
3300032043 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f24 | Environmental | Open in IMG/M |
3300032055 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f23 | Environmental | Open in IMG/M |
3300032059 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27 | Environmental | Open in IMG/M |
3300032064 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f17 | Environmental | Open in IMG/M |
3300032065 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f20 | Environmental | Open in IMG/M |
3300032094 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f25 | Environmental | Open in IMG/M |
3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
3300033290 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
AF_2010_repII_A100DRAFT_10238834 | 3300000655 | Forest Soil | MARMTEHDMIGWFNAAPMGSRQQRMLWAAHKIARLTGATAG |
Ga0066395_103755231 | 3300004633 | Tropical Forest Soil | MARMTEHDMIGWFNAAPTGSRKQRMLWAAHKIARLTGATAGGVYQMLE |
Ga0066688_102199872 | 3300005178 | Soil | MIEWFKSAPEGSRHQRMLWAARKIAHLTGVTEGGAYQVLLGVV* |
Ga0066671_103234992 | 3300005184 | Soil | MTKGNMIEWFKSAPMSSRHERMLWAAHKIAGLTGTTAGGAYQMLLIT |
Ga0066388_1010425163 | 3300005332 | Tropical Forest Soil | MIAKITKDEMIGWFKSAPKGSRHERILWAARKIARLTGAAEGGAYR |
Ga0066388_1013329203 | 3300005332 | Tropical Forest Soil | MTRDEIIEWFKSAPKGSRHQRMLWAAHKIARLTGVTEGGAYQMLL |
Ga0066388_1017184051 | 3300005332 | Tropical Forest Soil | MTKEEMIGWFKSAPKGSRHERMLWAAHKIAHLSGVTDGRAYQML |
Ga0066388_1059105631 | 3300005332 | Tropical Forest Soil | MTKDEMIEWFKSAPEGSRHERMLWAAHKIARLTGATEGGVYQL |
Ga0066388_1081111332 | 3300005332 | Tropical Forest Soil | FKSAPKGSRHQRMLWAARKIARLTGVAEGGAYQMLLSALIEAERPRG* |
Ga0070714_1011713582 | 3300005435 | Agricultural Soil | MTKDEMIGWFKSAPMGSRHQRMLWAAHKIARLTGATEGGAYQMLLV |
Ga0070708_1017273681 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MTQDEMIEWFKSTKGSRHQRMLGAAHKIARLTGVTEGGAYQMLLGALIEAERQ |
Ga0070706_1002068291 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | MTQDEMIEWFKSAPKGSRHQRMLWAACKIARLTGVTEGGAYQMLLSAL |
Ga0070706_1002611813 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | MVKITKDEMIEWFKSAPEGSRHQRMLWAARKIAHLTGVTEGGAYQVLLGVV* |
Ga0070698_1002062751 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | MVKITKDEMIEWFKSAPEGSRHQRMLWAARKIAHLTGVTE |
Ga0070696_1013941441 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | MTKDEIIGLFKSAPTGSRHQRILWAAHKIAGLTGATEGGTYQMLLVALIE |
Ga0066707_102718561 | 3300005556 | Soil | MTQDEMIEWFKSAPKGSRHQRMLWAACKIARLTGVTEGGAYQMLLSALIEA |
Ga0066705_107391771 | 3300005569 | Soil | MTKGNMIEWFKSAPMSSRHERMLWAAHKIAGLTGTTAGGAYQML |
Ga0066654_104060182 | 3300005587 | Soil | MTNDEMIEWFKSAPMGSRHERLLWAAHKIAHLTGTTEGGAY |
Ga0066905_1004354461 | 3300005713 | Tropical Forest Soil | MTKDEMIKWFKSAPKGSRHQRMLWAAQKIARLTGATEGGAYQTLLVVL |
Ga0066905_1009858371 | 3300005713 | Tropical Forest Soil | MVKMTKDEMVEWFKSAPEGSRHQRMLWAARKIARLTGATE |
Ga0066905_1010088511 | 3300005713 | Tropical Forest Soil | MTTDEMIEWFKSAPKGSRHERMLWAARKIAHLTGVTEGRAYQMLLGALIEAE |
Ga0066905_1021251561 | 3300005713 | Tropical Forest Soil | MTNGEMIECFKSAPKGSRHQRMLWAACKIAHLTGVTEGRAYQ |
Ga0068866_109030422 | 3300005718 | Miscanthus Rhizosphere | MTKDEIIGLFKSAPTGSRHQRILWAAHKIAGLTGATEGGTY |
Ga0066903_1007984871 | 3300005764 | Tropical Forest Soil | MVKTTRDEMIGWFKSAPEGSRHQRMLWAARKIARLTGATE |
Ga0066903_1023694026 | 3300005764 | Tropical Forest Soil | MTKDEMVEWFKSAPEGSRHERMLWAARKIAGLSRATE |
Ga0066903_1030612941 | 3300005764 | Tropical Forest Soil | MTKDTMIEWFKSAPMGSRHERMLWAAHKIARLTGATEGGTYQMLL |
Ga0066903_1030742403 | 3300005764 | Tropical Forest Soil | MTKDEMVEWFKSAPEGSRHQRMLWAAHKIACLTGATAGGAYQMLLVALIEAE |
Ga0066903_1030958343 | 3300005764 | Tropical Forest Soil | MTKDEMIGWFKSAPMGSRHERMLWAARKIARLTGATEGGSYQVLLIALAE |
Ga0066903_1047687121 | 3300005764 | Tropical Forest Soil | MTKDEMIEWFKSAPMGSRHQRMLWTAHKIARLTGA |
Ga0066903_1048165831 | 3300005764 | Tropical Forest Soil | MTTDEMINCFESAPMGSRHQRMLWAAQKIARLTGATEGDTYQKLLVAL |
Ga0066903_1053878932 | 3300005764 | Tropical Forest Soil | MTKDEMIELFKSAPEGSRHERVLWAARKSAQFTGVTEGRAYQMLLIALIEAE |
Ga0066903_1054759912 | 3300005764 | Tropical Forest Soil | MTKDEMIGWFKSAPMGSRHERMLWAARKIARLTGATEGG |
Ga0066903_1062483133 | 3300005764 | Tropical Forest Soil | MAPMTEHDMIGWFNAAPMGSRQQRMLWAAHKIARLTGATEGN |
Ga0066903_1077984621 | 3300005764 | Tropical Forest Soil | MTKDEMIKWFKSAPEGSRHHRMVWTAHKIARLTGATEGGAYQMLLGL |
Ga0066903_1079494242 | 3300005764 | Tropical Forest Soil | MTKDEMLGWFKSAPMGSRHERMLWAARKIARLTGATEGGRYQVLLIA |
Ga0066903_1086335062 | 3300005764 | Tropical Forest Soil | MTTDEMVQWFNSAPERSRHERVLWAARKIAHLTGITEGRAYQMLLIALIEAE |
Ga0066903_1087487361 | 3300005764 | Tropical Forest Soil | MTKDEMIGWFKSAPKGSRHERTLWTARKIAHLTGVT |
Ga0075365_105949902 | 3300006038 | Populus Endosphere | MTKDEMIKWFKSAPMGSRYERLLWAARKIAHLTDVTEGSAYRMLLLALID |
Ga0070712_1003103741 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | MTTDEMIKWFKSAPMGSRHERILWAASKIAHLTGVT |
Ga0075367_109063232 | 3300006178 | Populus Endosphere | MVECFRSAPKGSRHERLLWATRKIAHLTGGAEGGAYKRLLIALIE |
Ga0066653_101217211 | 3300006791 | Soil | MTKGNMIEWFKSAPMSSRHERMLWAAHKIAGLTGTTAGGAYQMLLIT* |
Ga0075431_1006764811 | 3300006847 | Populus Rhizosphere | MTKDEMIGWFKLTPMGSRHQRMLWAAHKIARLRGLPKAVLIKPCCLC* |
Ga0075424_1012605692 | 3300006904 | Populus Rhizosphere | MIEWFKSAPMGSRHQRLLWAAHKIAHLTGTIEGGTYQMLLVAL |
Ga0066709_1031173582 | 3300009137 | Grasslands Soil | MTKDEMIEWFKSAPKGSRHQRMLWAVCKIARLTGVTEGGA |
Ga0126380_113935683 | 3300010043 | Tropical Forest Soil | MIKDEMIECFNSAPTGSRHERMLWAARKIARLTGATEGGAYKMLLVALIEA |
Ga0126384_101426141 | 3300010046 | Tropical Forest Soil | MTKDEMVEWFKSAPESPRHQRMLWAARKIALLTGRCLSD |
Ga0126384_103910493 | 3300010046 | Tropical Forest Soil | MTKDEMIGWFNSAPKGSQHQRILWAAHKIARLTGVTEGGAYQML |
Ga0126384_119392051 | 3300010046 | Tropical Forest Soil | MVKMTKDEMVEWFKSAPEGSRHQRMLWAARKIARLTGATEGGAYQLLLGAL |
Ga0126384_121828632 | 3300010046 | Tropical Forest Soil | MSKDEMIEWFKSAPEGSRHQRMLWAARKIARLTRITEGGAYT |
Ga0126382_100552084 | 3300010047 | Tropical Forest Soil | MERMTEHDMIGWFNAAPMGSRQQRMLWAAHKIARLTGA |
Ga0126382_107362411 | 3300010047 | Tropical Forest Soil | MTKDEMVKWFKSAPKGSRHERMLWAAHKIAHLTGVTEGRAYQMLL |
Ga0126382_119562292 | 3300010047 | Tropical Forest Soil | MVKITKVEMIEWFKSAPDGSRHERMLWAARKIAHLTGVTEGGAYQVLLGV |
Ga0126373_103950001 | 3300010048 | Tropical Forest Soil | MSKDEMIEWFKSAPEGSRHQRMLWAARKIARLTRITEGGAYTML |
Ga0134070_102456783 | 3300010301 | Grasslands Soil | MTKDEMIDWFKSAPKGSRHQRMLWAAHKIARLTGVTEGGAYK |
Ga0134082_100825081 | 3300010303 | Grasslands Soil | MTKDEMLGWFKSAPKGSRHQRMLWAAQKIARLTGATEGDA |
Ga0134062_101331471 | 3300010337 | Grasslands Soil | MTKDEIIEWFKSAPKASRHQRMLWTARKIARLTGVTEGGAYQMLLVALIN |
Ga0126370_102232903 | 3300010358 | Tropical Forest Soil | MASMTEHDMIGWFNAAPMGSRQQRMLWAAHKIARLTGATEGN |
Ga0126370_104131352 | 3300010358 | Tropical Forest Soil | MTKDEMIGWFRAAPIGSRHERMLWAAHKIARLTGATESGAYQILESVVIE |
Ga0126370_110018931 | 3300010358 | Tropical Forest Soil | MVKMTKDEMVEWFKSAPEGSRHQRMLWAARKIARLTGATEG |
Ga0126370_113089241 | 3300010358 | Tropical Forest Soil | MTKDEMVEWFKSVPMGSRHQRMLRTTCKIAHLTGVT |
Ga0126376_126382921 | 3300010359 | Tropical Forest Soil | MTTDEMIDCFESAPMGSRHQRMLWAAQKIARLTGAAEGDTYQKL |
Ga0126372_111716981 | 3300010360 | Tropical Forest Soil | MVKITKVEMIEWFKSAPEGSRHERMLWAARKIAHLTGATVGGAYRVLLLA |
Ga0126378_105548223 | 3300010361 | Tropical Forest Soil | MTKDEMIGWFKSAPKGSRHQRMLWAARKIARLTGATEGGSYQ |
Ga0126378_109131711 | 3300010361 | Tropical Forest Soil | MVKMTKDEMVEWFKSAPEGSRHQRMLWAARKIARLTGATEGGAYQMLLGTLIE |
Ga0126378_118871601 | 3300010361 | Tropical Forest Soil | MTKDEIIEWFKSAPKGSRHQRMVWTARKIAHLTGVTEGGAYQML |
Ga0126378_122168851 | 3300010361 | Tropical Forest Soil | MTKGEIIEWFKSAPKGSRHQRMVWTARKIAHLTGVTEGGAYQML |
Ga0126378_126470193 | 3300010361 | Tropical Forest Soil | MTEHDMIGWFNAAPMGSRQQRMLWAAHKIARLTGAT |
Ga0126378_132362862 | 3300010361 | Tropical Forest Soil | MTKDEMVAWFKSAPEGSRHERTLWAARKIARLTGATEGGAYQTLLVALIEAE |
Ga0126377_108881922 | 3300010362 | Tropical Forest Soil | MTEHDMIGWFNAAPMGSRQQRMLWAAHKIARLTGATKGSVYQ |
Ga0126377_109511014 | 3300010362 | Tropical Forest Soil | MTKDEMVKWFKSAPKSSRHERMLWAARKIAHLTGVTE |
Ga0126379_104304691 | 3300010366 | Tropical Forest Soil | MMTKDEMIGWFRAAPMGSRHQRMLWAARKIARLTGATEGGAYQTLLVVLIE |
Ga0126379_105654323 | 3300010366 | Tropical Forest Soil | MTKDEMIEWFKSAPMGSRHERMLWAARKIARLTGATEGGSYQ |
Ga0126383_106180931 | 3300010398 | Tropical Forest Soil | MTKDEMVGRFKAAPMGSRHERMLWAARKIAHLTGVTEG |
Ga0126383_116939311 | 3300010398 | Tropical Forest Soil | MMTKDEMIRWFRAAPMGSRHQRMLWAARKIARLTGATE |
Ga0126383_130618991 | 3300010398 | Tropical Forest Soil | MTKEEMIDWFKSAPKGSRHQRMLWATRKIARLTGATEGGAYKM |
Ga0124844_10221994 | 3300010868 | Tropical Forest Soil | MERMTEHDMIGWFNAAPMGSRQQRMLWAAHKIARLTGATEGNVYQ |
Ga0137376_114256551 | 3300012208 | Vadose Zone Soil | MTKDKMVDWFKSAPKGSRHQCMVWAARKIAPLTGVTEGGAY |
Ga0137369_101746331 | 3300012355 | Vadose Zone Soil | MTKDEMIEWFKSAPKGSRQQRMLWAARQIARLTRITEGGAYQM |
Ga0137368_109119821 | 3300012358 | Vadose Zone Soil | MSKDEMIEWFKSAPMGSRQQRMLWAARKIARLTGT |
Ga0137359_105329782 | 3300012923 | Vadose Zone Soil | MTKDEMIEWFKSAPKGSRHQRMLWATCKIARLTGVTEGGAYQMLLSALIEAE |
Ga0126375_115734531 | 3300012948 | Tropical Forest Soil | MVKITNVEMIEWFKSAPEGSRHERMLWAARKIAHLTGVTEGGVYQVL |
Ga0126369_118609751 | 3300012971 | Tropical Forest Soil | MTKDEMIGWFKSAPEGSRHERMLWAARKIARLTGVTEGRAYQMLLIAQSRSRTA |
Ga0134077_104678371 | 3300012972 | Grasslands Soil | MTKDKMIEWFKSAPMGSRHQRMLWTARKIACLTGATDGSAYLALLSA |
Ga0182036_102713431 | 3300016270 | Soil | MTKDEMVEWFKSAPEGSRHERMLWAARKIAHLTGVT |
Ga0182036_106662831 | 3300016270 | Soil | MTKDEMIDWFKSAPKGSRHQRMLWAAREIARLTGVTEGSAYQ |
Ga0182036_112529992 | 3300016270 | Soil | MTKDEMIGWFNSAPKGSRHQRILWAAHKIARLTGVTEGGA |
Ga0182041_104780231 | 3300016294 | Soil | MVKMTKDEMVAWFKSAPKGSRHERMLWAARKIARLTGATEGGIYQMLLVALIE |
Ga0182033_103274485 | 3300016319 | Soil | MTKDEMIECFKSAPEGSRHERILWTARKIARLTGATEGGAYQV |
Ga0182033_110047511 | 3300016319 | Soil | MTKDEMIEWFKSAPMGSRHQRMLWAAHKIARLTGATDGGAYQ |
Ga0182033_113561521 | 3300016319 | Soil | MTRDEMVEWFKSAPMGSRHQRMLWAAHKIARLTGATEGGAYQVLLGAL |
Ga0182033_114694352 | 3300016319 | Soil | MTKHEMIDWFKSAPEGSRHQRMLWAAHKIARLTGATEGGAYQ |
Ga0182033_122106551 | 3300016319 | Soil | MTKDEMIEWFKSAPESSRHERMLWAARKVAYLTGVSEGRAYQMLLIALIE |
Ga0182035_109903603 | 3300016341 | Soil | MVKMTKDEMVEWFKSAPEGSRHQRMLWAARKIARLTGA |
Ga0182035_113938402 | 3300016341 | Soil | MTKDEMIGWFKSAPMGSRHERMLWAARKIARLTGATE |
Ga0182032_105329442 | 3300016357 | Soil | MTKDEMIEWFKSAPEGSRHHRMVWTAHKIARLTGATEGGAYQMLLG |
Ga0182032_106537161 | 3300016357 | Soil | MVKMTKNKMIEWFRSAPKNSRHQRMLWTARKIARLTGVTEGRAYQML |
Ga0182034_100513955 | 3300016371 | Soil | MSKDEMVEWFKSAPEGSRHQRMLWAAHKIARLTRITEGGAYQMLLGALIEAERLP |
Ga0182034_100979951 | 3300016371 | Soil | MTKDEMIEWFKSAPEGSRHQRMLWAAHKIARLTGATEGGI |
Ga0182034_107616971 | 3300016371 | Soil | MMTKDEMIGWFRAAPMGSRHQRMLWAARKIARLTGVTEGGAYQMLLVAL |
Ga0182034_117215151 | 3300016371 | Soil | MTKDEMIEWFKSAPEGSRHERMLWAAHKIARLTGATEGGVYQMLLV |
Ga0182040_111157912 | 3300016387 | Soil | MTKDEILEWFKSAPKGSRHQRMVWTARKLAHLTGVTEGGAYQMLLVALLEA |
Ga0182040_119073511 | 3300016387 | Soil | MVKMTKNKMIEWFRSAPKNSRHERMLWTARKIARLTGVTEGRAYQMLLGALIEAER |
Ga0182037_102743723 | 3300016404 | Soil | MTKDEMIEWFKSAPEGSRHQRMLWAAHKIARLTGATEGG |
Ga0182039_122832971 | 3300016422 | Soil | MTKDEMIEWFKSARHQRMLWAARKIARLTGATEGGA |
Ga0126371_107595731 | 3300021560 | Tropical Forest Soil | MTQDEMIKWFKSAPKSSRHERMLWAARKIARLTGATEGGA |
Ga0207692_109149281 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | MTKDEMIEWFKSAPMGSRHQRLLWAAHKIAHLTGT |
Ga0207685_108334241 | 3300025905 | Corn, Switchgrass And Miscanthus Rhizosphere | MTKDEMIKWFKSAPMGSRHERILWAASKIAHLTGVTEGGAYRMLL |
Ga0207684_102282993 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MVKITKDEMIEWFKSAPEGSRHQRMLWAARKIAHLTGVTEGGAYQVLLGVV |
Ga0207693_106671051 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | MTKDEIIGWFKSAPMGSRHQRMLWAAHKIACLTGATEGNAYQML |
Ga0207681_118257591 | 3300025923 | Switchgrass Rhizosphere | MTKDEMIKWFKSAPMGSRYERLLWAARKIAPLAQVTEGGAYRMLLL |
Ga0209472_12625841 | 3300026323 | Soil | MTKDEMLGWFKSAPKGSRHQRMLWAAQKIARLTGATEGD |
Ga0209465_101311651 | 3300027874 | Tropical Forest Soil | MTKDEMIGWFKSAPEGSRHERMLWAARKIARLTGVTEGRAYQML |
Ga0307277_102157471 | 3300028881 | Soil | MTKDKMLGWLKSAPKGSRHQRMLWAAHKIACLTGATEGNA |
Ga0307304_100733121 | 3300028885 | Soil | MTKDEMIGLFKSAPMGSRHQRMLWAAHKIAQLTGATELIKCCCWP |
Ga0318534_106055883 | 3300031544 | Soil | MVKMSKDEMVEWFKSAPEGSRHQRMLWAAHKIARLT |
Ga0318541_100094477 | 3300031545 | Soil | MTKDEMIEWFKSAPMGSRHQRMLWAAHKIARLTGAT |
Ga0318541_101732844 | 3300031545 | Soil | MARMTEHDMIGWFNAAPMGSRQQRMLWAAHKIARLTGVTEGNVY |
Ga0318541_103898332 | 3300031545 | Soil | MTKDEMIEWFKSAPMGSRHERMLWAARKIARLTGATEGGSY |
Ga0318541_104545182 | 3300031545 | Soil | MTKDEMVRWFKSAPKGSRHERILWATCKIARLTGATEGGA |
Ga0318541_105132582 | 3300031545 | Soil | MTKDEMIGWFNSAPKGSRHQRILWAAHKIARLTGVT |
Ga0318515_102091674 | 3300031572 | Soil | MVKMTKDEMVEWFKSAPEGSRHQRMLWAARKIARLTGVTEGGAYQVLLGALIEAE |
Ga0318515_104236481 | 3300031572 | Soil | MARMTEHDMIGWFNAAPMGSRQQRMLWVAHKMTDQ |
Ga0310915_105105833 | 3300031573 | Soil | MTKDEMIEWFKSAPKGSRHQRILWAAHKIARLTGVTEGGAYQMLLV |
Ga0318555_100951353 | 3300031640 | Soil | MVKMTKDEMVEWFKSAPEGSRHQRMLWAARKIARLTG |
Ga0318555_105585092 | 3300031640 | Soil | MTKDEMLGWFNSAPEGSRHQRMLWAARKIARLTGATEGGSYQV |
Ga0318542_105392991 | 3300031668 | Soil | MARMTEHDMIGWFNAAPMGSRQQRMLWAAHKIARLTG |
Ga0318561_100367731 | 3300031679 | Soil | MARMTEHDVIGWFNAAPMGSRQQRMLWAAHKIARLT |
Ga0318561_108289121 | 3300031679 | Soil | MTKDEMIEWFKSAPEDSRHGRVLWAARKIAHLTGVTEGRAYE |
Ga0318574_100855711 | 3300031680 | Soil | MTKDEMIGWFNSAPKGSRHQRILWAAHKIARLTGVTEGGAY |
Ga0306917_103809423 | 3300031719 | Soil | MTKDEMVEWFKSAPRGSRHERMLWAAYKIARLTGVTEGRAYQ |
Ga0318501_100611491 | 3300031736 | Soil | MTKDEMVEWFKSAPEGSRHQRMLWAARKIARLTGATEGGA |
Ga0306918_104518693 | 3300031744 | Soil | MTTDEMVQWFNSAPEGSQHERLLWAACKIAHLSGITEGRAYQMLLI |
Ga0306918_108470263 | 3300031744 | Soil | MTKDEMIECFKSAPEGSRHERILWTARKIARLTGATEGG |
Ga0306918_111395251 | 3300031744 | Soil | MTKDEMIDWFKSAPNGSRHQRMLWAARKIARVTGVTEGG |
Ga0318492_100903654 | 3300031748 | Soil | MSKDEMVEWFKSAPEGSRHQRMLWAAHKIARLTRITEGGAYQMLLGA |
Ga0318492_103032973 | 3300031748 | Soil | MTKDEMIGWFKSAPKGSRHQRMLWAARKIAPLTGATEG |
Ga0318537_101581601 | 3300031763 | Soil | MTKHEMIDWFKSAPEGSRHQRMLWAAHKIARLTGAT |
Ga0318535_103678761 | 3300031764 | Soil | MVKMTKDEMVEWFKSAPEGSRHRRMLWAADKIARLTGVTEGGAYQMLL |
Ga0318554_108321031 | 3300031765 | Soil | MTKDEMLGWFKSAPMGSRHERMLWAARKIARLTGATEGGSYQMLLIA |
Ga0318554_108748192 | 3300031765 | Soil | MIGWFRAAPIGSRHERMLWAARKIARLTGATEGGAYQMLLV |
Ga0318509_106419241 | 3300031768 | Soil | MTNDEMIECFNSAPKGSRHERMLWAACKIAGLTGATEGGAYKMLLVALI |
Ga0318526_100292071 | 3300031769 | Soil | MTKDEMIEWFKSAPEGSRHQRMLWAARKIARLTGATEGGAY |
Ga0318526_101756601 | 3300031769 | Soil | MERMTEHDMIGWFNAAPMGSRQQRMLWAAHKIARLTGVTEGNV |
Ga0318546_101710221 | 3300031771 | Soil | MVKMTKDEMVEWFKSAPEGSRHQRMLWAARKIARL |
Ga0318546_105456043 | 3300031771 | Soil | MTKDEMLGWFNSAPEGSRHQRMLWAARKIARLTGATEGGSYQ |
Ga0318546_107631941 | 3300031771 | Soil | MVKMTKDEMVEWFKSAPEGSRHQRMLWAARKIARLTGATEGGAYQLL |
Ga0318543_104049761 | 3300031777 | Soil | MTKDEMLGWFKSAPMGSRHERMLWAARKIARLTGATEGGSYQML |
Ga0318508_11247452 | 3300031780 | Soil | MTKDEMIEWFKSAPMGSRHQRMLWAAHKIARLTGATDGGA |
Ga0318548_104579131 | 3300031793 | Soil | MTKHEMIDWFKSAPEGSRHQRMLWAAHKIARLTGATEGGAYQMLLAALIE |
Ga0318550_104451572 | 3300031797 | Soil | MTKHEMIDWFKSAPEGSRHQRMLWAAHKIARLTGATEGGAYQMLL |
Ga0318567_100207661 | 3300031821 | Soil | MSKDEMVEWFKSAPEGSRHQRMLWAAHKIARLTRITEGGAYQMLL |
Ga0318567_100415401 | 3300031821 | Soil | MVEWFKSAPEGSRHQRMLWAAYKIARLTGVTEGGAYQMLLG |
Ga0318517_102651951 | 3300031835 | Soil | MTKDEMIEWFKSAPMGSRHQRMLWAAHKIARLTGATDGGAYQML |
Ga0318512_100251871 | 3300031846 | Soil | MVEWFKSAPEGSRHQRMLWAAYKIARLTGVTEGGAYQM |
Ga0318527_100233685 | 3300031859 | Soil | MTKDEMIEWFKSARHQRMLWAARKIARLTGATEGGAYLTLESAVTEA |
Ga0318527_100941903 | 3300031859 | Soil | MARMTEHDVIGWFNAAPMGSRQQRMLWAAHKIARL |
Ga0306925_102234411 | 3300031890 | Soil | MAKMTKDEMVEWFKSAPRGSRHERMLWAAYKIARLTGVTEGRAYQML |
Ga0306925_103983451 | 3300031890 | Soil | MIDWFKSAPKGSRHQRMLWAAREIARLTGVTEGSAYQM |
Ga0306925_116779571 | 3300031890 | Soil | MTKDEMVEWFKSAPMGSRHQRMLWAAHKIARVTGATAGGAYQVLLG |
Ga0306923_113474631 | 3300031910 | Soil | MTKDEMVEWFKSAPMGSRHQRMLWAAHKIARVTGATAGGA |
Ga0306923_117105491 | 3300031910 | Soil | MTKDEMIGWFNSAPKGSRHQRILWAAHKIARLTGV |
Ga0306921_105700674 | 3300031912 | Soil | MERMTEHDMIGWFNAAPMGSRQQRMLWAAHKIARLTG |
Ga0306921_117904162 | 3300031912 | Soil | MTKDEMIECFKSAPEGSRHERILWTARKIARLTGATEGGAY |
Ga0310912_107368941 | 3300031941 | Soil | MTKDEMIECFKSAPEGSRHERILWTARKIARLTGATEGGAYQVL |
Ga0310912_109835641 | 3300031941 | Soil | MTKDEMIDWFKSAPNGSRHQRMLWAARKIARVTGVTEGGAYQMLLSALI |
Ga0310916_102042253 | 3300031942 | Soil | KSKDRNMTKDEMLGWFKSAPMGSRHERMLWAARKIARLTGAT |
Ga0310916_103338385 | 3300031942 | Soil | MVKMTKDEMVEWFKSAPEGSRHQRTLWAARKIARLTGVTEGGAYQVLLGALIEA |
Ga0310916_104059141 | 3300031942 | Soil | MTKDEMLGWFKSAPMGSRHERMLWAARKIARLTGAT |
Ga0310916_105746063 | 3300031942 | Soil | MIGWFRAAPIGSRHERMLWAARKIARLTGATEGGAYQML |
Ga0310910_100118881 | 3300031946 | Soil | MTTDEMVQWFNSAPELSRHERVLWAARKIAHLTGITEGRAYQMLL |
Ga0310910_101257114 | 3300031946 | Soil | MTKDEMIDWFKSAPNGSRHQRMLWAARKIARVTGVTEGGAYQM |
Ga0310909_102924273 | 3300031947 | Soil | MIDWFKSAPKGSRHQRMLWAAREIARLTGVTEGSAYQMLL |
Ga0310909_106208913 | 3300031947 | Soil | MTKDEMVEWFKSAPNGSRHQRMLWAARKIARLTKITE |
Ga0306926_116402232 | 3300031954 | Soil | MAKMTKDEMVEWFKSAPRGSRHERMLWAAYKIARLTGV |
Ga0318531_100356586 | 3300031981 | Soil | MVKMTKDEMVEWFKSAPEGSRHQRMFWAARKIARLTGVTEGGAYQVLLGA |
Ga0318507_100279281 | 3300032025 | Soil | MTKDEMIEWFKSAPMGSRHQRMLWAAHKIARLTGATEG |
Ga0310911_100124751 | 3300032035 | Soil | MTNDEMIEWFKLAPKGSRHQRMLWAAHKIARLTGV |
Ga0310911_105822661 | 3300032035 | Soil | MTNDEMIEWFKSAPEGSRHQRMLWAARKIAHLTGVTEGRAYQMLLVAL |
Ga0318545_101807101 | 3300032042 | Soil | MTTDEMVQWFNSAPELSRHERVLWAARKIAHLTGITEGRAYQMLLIALIE |
Ga0318556_106233971 | 3300032043 | Soil | MIEWFKSAPKGSRHQRMLWAAHKIARLTGATEGGAYQM |
Ga0318575_102491012 | 3300032055 | Soil | MTKDEMIEWFKSAPEGSRHQRMLWAAHKIARLTGATEGGIYQLLLVAL |
Ga0318533_101626681 | 3300032059 | Soil | MTKDEMIDWFKSAPNGSRHQRMLWAARKIARVTGVTEGGAYQMLLSALIEGER |
Ga0318533_108976621 | 3300032059 | Soil | MTKDEMVAWFKSAPKGSRHERMLWAARKIARLTGATEGGIYQMLL |
Ga0318510_100311991 | 3300032064 | Soil | MTKDEMIGWFNSAPKGSRHQRILWAAHKIARLTGVSEGG |
Ga0318510_101037211 | 3300032064 | Soil | MVKMTKDEMVEWFKSAPEGSRHQRMLWAARKIARLTGVTEGGAYQVLLGALIE |
Ga0318513_104711751 | 3300032065 | Soil | MIEWFKSAPKGSRHQRMLWAAHKIARLTGATEGGAYQMLLVALIEAER |
Ga0318513_105910742 | 3300032065 | Soil | MTKDEMIGCFKSAPMGSRHQRMLWAARKIARLTGATEGGAYQTLLVVLI |
Ga0318540_100839421 | 3300032094 | Soil | MTTDEMVQWFNSAPERSRHERVLWAARKIAHLTGITEGRAYQMLLIPAWRH |
Ga0310914_1001524813 | 3300033289 | Soil | MIEWFKSAPESSRHERMLWAVRKVAHLTGVSEGRAYQMLLIA |
Ga0318519_108086031 | 3300033290 | Soil | LSVEKDDMIGWFRAAPIGSRHERMLWAARKIARLTGATEGGAYQMLL |
⦗Top⦘ |