| Basic Information | |
|---|---|
| Family ID | F028879 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 190 |
| Average Sequence Length | 45 residues |
| Representative Sequence | EPYLMALVLLVATPRRYLSWPYLGMIAACVLPALLVVARRRTLYM |
| Number of Associated Samples | 161 |
| Number of Associated Scaffolds | 190 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 5.79 % |
| % of genes near scaffold ends (potentially truncated) | 95.79 % |
| % of genes from short scaffolds (< 2000 bps) | 92.11 % |
| Associated GOLD sequencing projects | 154 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.38 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (57.895 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (23.684 % of family members) |
| Environment Ontology (ENVO) | Unclassified (20.526 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (47.895 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 49.32% β-sheet: 0.00% Coil/Unstructured: 50.68% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.38 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 190 Family Scaffolds |
|---|---|---|
| PF01370 | Epimerase | 10.00 |
| PF16363 | GDP_Man_Dehyd | 6.32 |
| PF03721 | UDPG_MGDP_dh_N | 1.05 |
| PF00248 | Aldo_ket_red | 0.53 |
| PF00535 | Glycos_transf_2 | 0.53 |
| PF13546 | DDE_5 | 0.53 |
| PF00171 | Aldedh | 0.53 |
| PF03720 | UDPG_MGDP_dh_C | 0.53 |
| PF01571 | GCV_T | 0.53 |
| PF00528 | BPD_transp_1 | 0.53 |
| PF02770 | Acyl-CoA_dh_M | 0.53 |
| COG ID | Name | Functional Category | % Frequency in 190 Family Scaffolds |
|---|---|---|---|
| COG0240 | Glycerol-3-phosphate dehydrogenase | Energy production and conversion [C] | 1.05 |
| COG0677 | UDP-N-acetyl-D-mannosaminuronate dehydrogenase | Cell wall/membrane/envelope biogenesis [M] | 1.05 |
| COG1004 | UDP-glucose 6-dehydrogenase | Cell wall/membrane/envelope biogenesis [M] | 1.05 |
| COG1250 | 3-hydroxyacyl-CoA dehydrogenase | Lipid transport and metabolism [I] | 1.05 |
| COG1893 | Ketopantoate reductase | Coenzyme transport and metabolism [H] | 1.05 |
| COG0014 | Gamma-glutamyl phosphate reductase | Amino acid transport and metabolism [E] | 0.53 |
| COG1012 | Acyl-CoA reductase or other NAD-dependent aldehyde dehydrogenase | Lipid transport and metabolism [I] | 0.53 |
| COG1960 | Acyl-CoA dehydrogenase related to the alkylation response protein AidB | Lipid transport and metabolism [I] | 0.53 |
| COG4230 | Delta 1-pyrroline-5-carboxylate dehydrogenase | Amino acid transport and metabolism [E] | 0.53 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 57.89 % |
| All Organisms | root | All Organisms | 42.11 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2209111022|2221194595 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → Streptomyces humicola | 1305 | Open in IMG/M |
| 3300000364|INPhiseqgaiiFebDRAFT_100859977 | Not Available | 501 | Open in IMG/M |
| 3300003219|JGI26341J46601_10071441 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae | 1049 | Open in IMG/M |
| 3300004091|Ga0062387_100373475 | Not Available | 950 | Open in IMG/M |
| 3300004091|Ga0062387_101768431 | Not Available | 504 | Open in IMG/M |
| 3300005103|Ga0066813_1015343 | Not Available | 516 | Open in IMG/M |
| 3300005336|Ga0070680_100024054 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 4862 | Open in IMG/M |
| 3300005344|Ga0070661_100210135 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1489 | Open in IMG/M |
| 3300005363|Ga0008090_14908830 | Not Available | 508 | Open in IMG/M |
| 3300005435|Ga0070714_100529428 | Not Available | 1126 | Open in IMG/M |
| 3300005436|Ga0070713_100928996 | All Organisms → cellular organisms → Bacteria | 837 | Open in IMG/M |
| 3300005437|Ga0070710_11389586 | Not Available | 524 | Open in IMG/M |
| 3300005439|Ga0070711_100069688 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → Streptomyces humicola | 2474 | Open in IMG/M |
| 3300005445|Ga0070708_101517778 | Not Available | 624 | Open in IMG/M |
| 3300005537|Ga0070730_10803260 | Not Available | 593 | Open in IMG/M |
| 3300005537|Ga0070730_10964194 | Not Available | 533 | Open in IMG/M |
| 3300005549|Ga0070704_100367037 | Not Available | 1219 | Open in IMG/M |
| 3300005564|Ga0070664_100430491 | Not Available | 1209 | Open in IMG/M |
| 3300005577|Ga0068857_100350741 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1366 | Open in IMG/M |
| 3300005587|Ga0066654_10841559 | Not Available | 523 | Open in IMG/M |
| 3300005591|Ga0070761_10625871 | Not Available | 671 | Open in IMG/M |
| 3300005602|Ga0070762_10294579 | Not Available | 1021 | Open in IMG/M |
| 3300005840|Ga0068870_10353593 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 943 | Open in IMG/M |
| 3300006102|Ga0075015_100866896 | Not Available | 546 | Open in IMG/M |
| 3300006175|Ga0070712_100731580 | Not Available | 845 | Open in IMG/M |
| 3300006176|Ga0070765_100407328 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Catenulisporales → Actinospicaceae → Actinospica → unclassified Actinospica → Actinospica sp. MGRD01-02 | 1270 | Open in IMG/M |
| 3300006176|Ga0070765_102246381 | Not Available | 508 | Open in IMG/M |
| 3300006358|Ga0068871_101200684 | All Organisms → cellular organisms → Bacteria | 711 | Open in IMG/M |
| 3300006755|Ga0079222_10077127 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → Streptomyces humicola | 1665 | Open in IMG/M |
| 3300006755|Ga0079222_11115996 | Not Available | 695 | Open in IMG/M |
| 3300006903|Ga0075426_11413591 | All Organisms → cellular organisms → Bacteria | 528 | Open in IMG/M |
| 3300006904|Ga0075424_101095412 | Not Available | 849 | Open in IMG/M |
| 3300006914|Ga0075436_100948728 | All Organisms → cellular organisms → Bacteria | 644 | Open in IMG/M |
| 3300007076|Ga0075435_101700962 | All Organisms → cellular organisms → Bacteria | 554 | Open in IMG/M |
| 3300007788|Ga0099795_10650270 | Not Available | 504 | Open in IMG/M |
| 3300009521|Ga0116222_1039940 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2057 | Open in IMG/M |
| 3300009553|Ga0105249_11755820 | All Organisms → cellular organisms → Bacteria | 693 | Open in IMG/M |
| 3300009698|Ga0116216_10318294 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → Streptomyces humicola | 947 | Open in IMG/M |
| 3300009700|Ga0116217_10289536 | Not Available | 1055 | Open in IMG/M |
| 3300010152|Ga0126318_11037539 | All Organisms → cellular organisms → Bacteria | 704 | Open in IMG/M |
| 3300010329|Ga0134111_10509454 | Not Available | 529 | Open in IMG/M |
| 3300010341|Ga0074045_10618440 | Not Available | 690 | Open in IMG/M |
| 3300010373|Ga0134128_10634969 | Not Available | 1187 | Open in IMG/M |
| 3300010373|Ga0134128_10846189 | Not Available | 1013 | Open in IMG/M |
| 3300010379|Ga0136449_100414599 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2382 | Open in IMG/M |
| 3300010396|Ga0134126_10910343 | Not Available | 989 | Open in IMG/M |
| 3300010397|Ga0134124_10306743 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1481 | Open in IMG/M |
| 3300010876|Ga0126361_10990656 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → Streptomyces humicola | 1092 | Open in IMG/M |
| 3300010880|Ga0126350_10077948 | Not Available | 914 | Open in IMG/M |
| 3300012176|Ga0153952_1113316 | Not Available | 595 | Open in IMG/M |
| 3300012207|Ga0137381_10554961 | Not Available | 1001 | Open in IMG/M |
| 3300012210|Ga0137378_11149891 | Not Available | 691 | Open in IMG/M |
| 3300012349|Ga0137387_11150938 | Not Available | 550 | Open in IMG/M |
| 3300012357|Ga0137384_10148276 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae | 1964 | Open in IMG/M |
| 3300012481|Ga0157320_1004628 | All Organisms → cellular organisms → Bacteria | 886 | Open in IMG/M |
| 3300012961|Ga0164302_11082573 | Not Available | 631 | Open in IMG/M |
| 3300013105|Ga0157369_11215220 | Not Available | 769 | Open in IMG/M |
| 3300014168|Ga0181534_10383712 | Not Available | 774 | Open in IMG/M |
| 3300014201|Ga0181537_10390522 | Not Available | 955 | Open in IMG/M |
| 3300014201|Ga0181537_11158459 | Not Available | 522 | Open in IMG/M |
| 3300016319|Ga0182033_11061818 | Not Available | 722 | Open in IMG/M |
| 3300016319|Ga0182033_12101217 | All Organisms → cellular organisms → Bacteria | 515 | Open in IMG/M |
| 3300016387|Ga0182040_10996760 | Not Available | 698 | Open in IMG/M |
| 3300016422|Ga0182039_10989818 | All Organisms → cellular organisms → Bacteria | 754 | Open in IMG/M |
| 3300017926|Ga0187807_1041074 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae | 1432 | Open in IMG/M |
| 3300017930|Ga0187825_10282759 | Not Available | 614 | Open in IMG/M |
| 3300017943|Ga0187819_10519111 | Not Available | 679 | Open in IMG/M |
| 3300017946|Ga0187879_10038078 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → Streptomyces humicola | 2878 | Open in IMG/M |
| 3300017946|Ga0187879_10080340 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → Streptomyces humicola | 1884 | Open in IMG/M |
| 3300017955|Ga0187817_10719391 | Not Available | 637 | Open in IMG/M |
| 3300017959|Ga0187779_10276136 | Not Available | 1069 | Open in IMG/M |
| 3300017970|Ga0187783_10922901 | Not Available | 629 | Open in IMG/M |
| 3300017972|Ga0187781_10460523 | Not Available | 911 | Open in IMG/M |
| 3300017972|Ga0187781_11498771 | Not Available | 500 | Open in IMG/M |
| 3300017975|Ga0187782_11662979 | Not Available | 505 | Open in IMG/M |
| 3300018034|Ga0187863_10222723 | Not Available | 1049 | Open in IMG/M |
| 3300018037|Ga0187883_10641637 | Not Available | 552 | Open in IMG/M |
| 3300018043|Ga0187887_10892451 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae | 526 | Open in IMG/M |
| 3300018046|Ga0187851_10816621 | Not Available | 524 | Open in IMG/M |
| 3300018060|Ga0187765_10879285 | Not Available | 605 | Open in IMG/M |
| 3300018085|Ga0187772_10172799 | Not Available | 1440 | Open in IMG/M |
| 3300018085|Ga0187772_10375404 | Not Available | 986 | Open in IMG/M |
| 3300018085|Ga0187772_10909625 | Not Available | 640 | Open in IMG/M |
| 3300020082|Ga0206353_10170175 | All Organisms → cellular organisms → Bacteria | 1009 | Open in IMG/M |
| 3300020582|Ga0210395_10489530 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 925 | Open in IMG/M |
| 3300021088|Ga0210404_10560651 | Not Available | 648 | Open in IMG/M |
| 3300021181|Ga0210388_10058141 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3237 | Open in IMG/M |
| 3300021388|Ga0213875_10165652 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1037 | Open in IMG/M |
| 3300021402|Ga0210385_10298475 | Not Available | 1194 | Open in IMG/M |
| 3300021403|Ga0210397_11015194 | All Organisms → cellular organisms → Bacteria | 644 | Open in IMG/M |
| 3300021405|Ga0210387_11436078 | Not Available | 592 | Open in IMG/M |
| 3300021405|Ga0210387_11527005 | Not Available | 571 | Open in IMG/M |
| 3300021406|Ga0210386_11358009 | Not Available | 597 | Open in IMG/M |
| 3300021420|Ga0210394_10173099 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → Streptomyces humicola | 1879 | Open in IMG/M |
| 3300021474|Ga0210390_10637692 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Catenulisporales → Actinospicaceae | 891 | Open in IMG/M |
| 3300021477|Ga0210398_10652847 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Catenulisporales → Actinospicaceae → Actinospica → unclassified Actinospica → Actinospica sp. MGRD01-02 | 853 | Open in IMG/M |
| 3300021478|Ga0210402_10043543 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3909 | Open in IMG/M |
| 3300021559|Ga0210409_10211527 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → Streptomyces humicola | 1763 | Open in IMG/M |
| 3300021559|Ga0210409_11337528 | All Organisms → cellular organisms → Bacteria | 592 | Open in IMG/M |
| 3300021560|Ga0126371_11105467 | Not Available | 932 | Open in IMG/M |
| 3300021560|Ga0126371_12521271 | Not Available | 622 | Open in IMG/M |
| 3300024249|Ga0247676_1018316 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1100 | Open in IMG/M |
| 3300024283|Ga0247670_1044023 | All Organisms → cellular organisms → Bacteria | 804 | Open in IMG/M |
| 3300025898|Ga0207692_10545603 | Not Available | 740 | Open in IMG/M |
| 3300025900|Ga0207710_10367494 | Not Available | 735 | Open in IMG/M |
| 3300025906|Ga0207699_10683561 | Not Available | 751 | Open in IMG/M |
| 3300025912|Ga0207707_11156002 | Not Available | 628 | Open in IMG/M |
| 3300025916|Ga0207663_10622147 | Not Available | 850 | Open in IMG/M |
| 3300025918|Ga0207662_10671601 | Not Available | 725 | Open in IMG/M |
| 3300025929|Ga0207664_10841059 | Not Available | 825 | Open in IMG/M |
| 3300025932|Ga0207690_11147235 | All Organisms → cellular organisms → Bacteria | 648 | Open in IMG/M |
| 3300026023|Ga0207677_10585333 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 977 | Open in IMG/M |
| 3300026879|Ga0207763_1030418 | Not Available | 506 | Open in IMG/M |
| 3300026999|Ga0207949_1004462 | Not Available | 1253 | Open in IMG/M |
| 3300027080|Ga0208237_1041940 | Not Available | 687 | Open in IMG/M |
| 3300027545|Ga0209008_1044404 | Not Available | 1018 | Open in IMG/M |
| 3300027570|Ga0208043_1153647 | Not Available | 599 | Open in IMG/M |
| 3300027570|Ga0208043_1173901 | Not Available | 553 | Open in IMG/M |
| 3300027583|Ga0209527_1063888 | Not Available | 829 | Open in IMG/M |
| 3300027698|Ga0209446_1085955 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → Streptomyces humicola | 805 | Open in IMG/M |
| 3300027824|Ga0209040_10540691 | Not Available | 509 | Open in IMG/M |
| 3300027853|Ga0209274_10746207 | Not Available | 504 | Open in IMG/M |
| 3300027867|Ga0209167_10515658 | Not Available | 654 | Open in IMG/M |
| 3300027911|Ga0209698_10602410 | Not Available | 844 | Open in IMG/M |
| 3300028047|Ga0209526_10242448 | Not Available | 1236 | Open in IMG/M |
| 3300028742|Ga0302220_10187038 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 776 | Open in IMG/M |
| 3300028759|Ga0302224_10064068 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Catenulisporales → Actinospicaceae → Actinocrinis → Actinocrinis puniceicyclus | 1387 | Open in IMG/M |
| 3300028768|Ga0307280_10013449 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → Streptomyces humicola | 2263 | Open in IMG/M |
| 3300028773|Ga0302234_10153611 | Not Available | 1002 | Open in IMG/M |
| 3300028775|Ga0302231_10311213 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 660 | Open in IMG/M |
| 3300028808|Ga0302228_10008296 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 5919 | Open in IMG/M |
| 3300029999|Ga0311339_10636890 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Catenulisporales → Actinospicaceae | 1054 | Open in IMG/M |
| 3300030399|Ga0311353_10108994 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Catenulisporales → Actinospicaceae → Actinocrinis → Actinocrinis puniceicyclus | 2685 | Open in IMG/M |
| 3300030399|Ga0311353_10988758 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 705 | Open in IMG/M |
| 3300030509|Ga0302183_10307799 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 612 | Open in IMG/M |
| 3300030741|Ga0265459_11363448 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 795 | Open in IMG/M |
| 3300031027|Ga0302308_10098636 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Catenulisporales → Actinospicaceae | 1997 | Open in IMG/M |
| 3300031028|Ga0302180_10140233 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Catenulisporales → Actinospicaceae | 1349 | Open in IMG/M |
| 3300031525|Ga0302326_10845521 | Not Available | 1311 | Open in IMG/M |
| 3300031525|Ga0302326_13352267 | Not Available | 536 | Open in IMG/M |
| 3300031543|Ga0318516_10373054 | Not Available | 823 | Open in IMG/M |
| 3300031544|Ga0318534_10143626 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → Streptomyces humicola | 1376 | Open in IMG/M |
| 3300031544|Ga0318534_10161647 | Not Available | 1294 | Open in IMG/M |
| 3300031681|Ga0318572_10835164 | All Organisms → cellular organisms → Bacteria | 547 | Open in IMG/M |
| 3300031708|Ga0310686_100491696 | Not Available | 1038 | Open in IMG/M |
| 3300031708|Ga0310686_106245528 | All Organisms → cellular organisms → Bacteria | 519 | Open in IMG/M |
| 3300031708|Ga0310686_112450903 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 719 | Open in IMG/M |
| 3300031713|Ga0318496_10238570 | Not Available | 1002 | Open in IMG/M |
| 3300031713|Ga0318496_10410367 | Not Available | 749 | Open in IMG/M |
| 3300031724|Ga0318500_10203754 | Not Available | 949 | Open in IMG/M |
| 3300031747|Ga0318502_10052208 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → Streptomyces humicola | 2155 | Open in IMG/M |
| 3300031770|Ga0318521_10068470 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → Streptomyces humicola | 1884 | Open in IMG/M |
| 3300031770|Ga0318521_10223959 | Not Available | 1092 | Open in IMG/M |
| 3300031778|Ga0318498_10154003 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1046 | Open in IMG/M |
| 3300031781|Ga0318547_10598993 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 683 | Open in IMG/M |
| 3300031819|Ga0318568_10045565 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 2513 | Open in IMG/M |
| 3300031833|Ga0310917_10611597 | All Organisms → cellular organisms → Bacteria | 740 | Open in IMG/M |
| 3300031858|Ga0310892_11221171 | All Organisms → cellular organisms → Bacteria | 536 | Open in IMG/M |
| 3300031859|Ga0318527_10374287 | Not Available | 607 | Open in IMG/M |
| 3300031879|Ga0306919_10123280 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1858 | Open in IMG/M |
| 3300031896|Ga0318551_10232296 | Not Available | 1027 | Open in IMG/M |
| 3300031897|Ga0318520_10941272 | Not Available | 545 | Open in IMG/M |
| 3300031912|Ga0306921_11867935 | Not Available | 644 | Open in IMG/M |
| 3300031959|Ga0318530_10176163 | Not Available | 874 | Open in IMG/M |
| 3300031959|Ga0318530_10262450 | Not Available | 712 | Open in IMG/M |
| 3300031962|Ga0307479_10039601 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 4523 | Open in IMG/M |
| 3300032008|Ga0318562_10813168 | Not Available | 535 | Open in IMG/M |
| 3300032009|Ga0318563_10267758 | Not Available | 924 | Open in IMG/M |
| 3300032009|Ga0318563_10651984 | Not Available | 566 | Open in IMG/M |
| 3300032063|Ga0318504_10432388 | Not Available | 629 | Open in IMG/M |
| 3300032063|Ga0318504_10598541 | All Organisms → cellular organisms → Bacteria | 529 | Open in IMG/M |
| 3300032066|Ga0318514_10201192 | Not Available | 1043 | Open in IMG/M |
| 3300032068|Ga0318553_10355708 | Not Available | 767 | Open in IMG/M |
| 3300032076|Ga0306924_10463508 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1447 | Open in IMG/M |
| 3300032076|Ga0306924_11032009 | Not Available | 901 | Open in IMG/M |
| 3300032089|Ga0318525_10618795 | Not Available | 552 | Open in IMG/M |
| 3300032091|Ga0318577_10064364 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → Streptomyces humicola | 1668 | Open in IMG/M |
| 3300032180|Ga0307471_100480196 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → Streptomyces humicola | 1388 | Open in IMG/M |
| 3300032261|Ga0306920_100300606 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → Streptomyces humicola | 2390 | Open in IMG/M |
| 3300032261|Ga0306920_100785615 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1398 | Open in IMG/M |
| 3300032261|Ga0306920_101851692 | Not Available | 850 | Open in IMG/M |
| 3300032782|Ga0335082_11050296 | Not Available | 680 | Open in IMG/M |
| 3300032783|Ga0335079_10414944 | Not Available | 1449 | Open in IMG/M |
| 3300032805|Ga0335078_11367839 | All Organisms → cellular organisms → Bacteria | 802 | Open in IMG/M |
| 3300032892|Ga0335081_10481947 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → Streptomyces humicola | 1567 | Open in IMG/M |
| 3300032895|Ga0335074_10205983 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → Streptomyces humicola | 2388 | Open in IMG/M |
| 3300032895|Ga0335074_10934909 | Not Available | 778 | Open in IMG/M |
| 3300033004|Ga0335084_11659941 | Not Available | 629 | Open in IMG/M |
| 3300033158|Ga0335077_11603254 | Not Available | 619 | Open in IMG/M |
| 3300034199|Ga0370514_040964 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Catenulisporales → Actinospicaceae | 1158 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 23.68% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 6.84% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 5.79% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 4.74% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 4.74% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 4.21% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 3.16% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 3.16% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 2.63% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.63% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 2.63% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 2.63% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 2.63% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 2.11% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 2.11% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 2.11% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 1.58% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.58% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 1.58% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 1.05% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 1.05% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.05% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 1.05% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.05% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 1.05% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 1.05% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 1.05% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.05% |
| Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 1.05% |
| Soil | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil | 0.53% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.53% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.53% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grass Soil | 0.53% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.53% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.53% |
| Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 0.53% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.53% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.53% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.53% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.53% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere | 0.53% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.53% |
| Plant Roots | Host-Associated → Plants → Roots → Unclassified → Unclassified → Plant Roots | 0.53% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.53% |
| Attine Ant Fungus Gardens | Host-Associated → Fungi → Mycelium → Unclassified → Unclassified → Attine Ant Fungus Gardens | 0.53% |
| Tropical Rainforest Soil | Environmental → Terrestrial → Soil → Unclassified → Tropical Rainforest → Tropical Rainforest Soil | 0.53% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2209111022 | Grass soil microbial communities from Rothamsted Park, UK - Chitin enrichment | Environmental | Open in IMG/M |
| 3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300003219 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM3 | Environmental | Open in IMG/M |
| 3300004091 | Coassembly of ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300005103 | Soil and rhizosphere microbial communities from Laval, Canada - mgLAA | Environmental | Open in IMG/M |
| 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Environmental | Open in IMG/M |
| 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Host-Associated | Open in IMG/M |
| 3300005363 | Tropical rainforest soil microbial communities from the Amazon Forest, Brazil, analyzing deforestation - Metatranscriptome F II A100 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
| 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
| 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Environmental | Open in IMG/M |
| 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005537 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 | Environmental | Open in IMG/M |
| 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Environmental | Open in IMG/M |
| 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Host-Associated | Open in IMG/M |
| 3300005587 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103 | Environmental | Open in IMG/M |
| 3300005591 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 | Environmental | Open in IMG/M |
| 3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
| 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Host-Associated | Open in IMG/M |
| 3300006102 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2013 | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Host-Associated | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
| 3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
| 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Environmental | Open in IMG/M |
| 3300009521 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_9_AC metaG | Environmental | Open in IMG/M |
| 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
| 3300009698 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG | Environmental | Open in IMG/M |
| 3300009700 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG | Environmental | Open in IMG/M |
| 3300010152 | Soil microbial communities from Oklahoma, USA to study soil gas exchange rates - GP-OK-ARM metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010329 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_11112015 | Environmental | Open in IMG/M |
| 3300010341 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM2 | Environmental | Open in IMG/M |
| 3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
| 3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
| 3300010876 | Boreal forest soil eukaryotic communities from Alaska, USA - W5-5 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010880 | Boreal forest soil eukaryotic communities from Alaska, USA - C5-1 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012176 | Attine ant fungus gardens microbial communities from New Jersey, USA - TSNJ036 MetaG | Host-Associated | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
| 3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012481 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.1.yng.040610 | Host-Associated | Open in IMG/M |
| 3300012961 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG | Environmental | Open in IMG/M |
| 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Host-Associated | Open in IMG/M |
| 3300014168 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_10_metaG | Environmental | Open in IMG/M |
| 3300014201 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_10_metaG | Environmental | Open in IMG/M |
| 3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
| 3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
| 3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
| 3300017926 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_2 | Environmental | Open in IMG/M |
| 3300017930 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_5 | Environmental | Open in IMG/M |
| 3300017943 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4 | Environmental | Open in IMG/M |
| 3300017946 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_10 | Environmental | Open in IMG/M |
| 3300017955 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2 | Environmental | Open in IMG/M |
| 3300017959 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MG | Environmental | Open in IMG/M |
| 3300017970 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300017972 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300017975 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018034 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_10 | Environmental | Open in IMG/M |
| 3300018037 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_10 | Environmental | Open in IMG/M |
| 3300018043 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_10 | Environmental | Open in IMG/M |
| 3300018046 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_10 | Environmental | Open in IMG/M |
| 3300018060 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MG | Environmental | Open in IMG/M |
| 3300018085 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
| 3300021088 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M | Environmental | Open in IMG/M |
| 3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
| 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Host-Associated | Open in IMG/M |
| 3300021402 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-O | Environmental | Open in IMG/M |
| 3300021403 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O | Environmental | Open in IMG/M |
| 3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
| 3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
| 3300021477 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300024249 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK17 | Environmental | Open in IMG/M |
| 3300024283 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK11 | Environmental | Open in IMG/M |
| 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026879 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 50 (SPAdes) | Environmental | Open in IMG/M |
| 3300026999 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF044 (SPAdes) | Environmental | Open in IMG/M |
| 3300027080 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF009 (SPAdes) | Environmental | Open in IMG/M |
| 3300027545 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027570 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_9_AC metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027583 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027698 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027824 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027853 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027867 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027911 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300028047 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028742 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E1_3 | Environmental | Open in IMG/M |
| 3300028759 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E3_1 | Environmental | Open in IMG/M |
| 3300028768 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_119 | Environmental | Open in IMG/M |
| 3300028773 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N3_2 | Environmental | Open in IMG/M |
| 3300028775 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N2_2 | Environmental | Open in IMG/M |
| 3300028808 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N1_2 | Environmental | Open in IMG/M |
| 3300029999 | I_Palsa_E3 coassembly | Environmental | Open in IMG/M |
| 3300030399 | II_Palsa_E2 coassembly | Environmental | Open in IMG/M |
| 3300030509 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_N3_2 | Environmental | Open in IMG/M |
| 3300030741 | Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada ANR Co-assembly | Environmental | Open in IMG/M |
| 3300031027 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E3_3 | Environmental | Open in IMG/M |
| 3300031028 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E3_2 | Environmental | Open in IMG/M |
| 3300031525 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_3 | Environmental | Open in IMG/M |
| 3300031543 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20 | Environmental | Open in IMG/M |
| 3300031544 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26 | Environmental | Open in IMG/M |
| 3300031681 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20 | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031713 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f22 | Environmental | Open in IMG/M |
| 3300031724 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f20 | Environmental | Open in IMG/M |
| 3300031747 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22 | Environmental | Open in IMG/M |
| 3300031770 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17 | Environmental | Open in IMG/M |
| 3300031778 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f24 | Environmental | Open in IMG/M |
| 3300031781 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20 | Environmental | Open in IMG/M |
| 3300031819 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f21 | Environmental | Open in IMG/M |
| 3300031833 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178 | Environmental | Open in IMG/M |
| 3300031858 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D2 | Environmental | Open in IMG/M |
| 3300031859 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f25 | Environmental | Open in IMG/M |
| 3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
| 3300031896 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f19 | Environmental | Open in IMG/M |
| 3300031897 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16 | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031959 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f24 | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032008 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f18 | Environmental | Open in IMG/M |
| 3300032009 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f19 | Environmental | Open in IMG/M |
| 3300032063 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f17 | Environmental | Open in IMG/M |
| 3300032066 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f18 | Environmental | Open in IMG/M |
| 3300032068 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f21 | Environmental | Open in IMG/M |
| 3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
| 3300032089 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f23 | Environmental | Open in IMG/M |
| 3300032091 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f25 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300032782 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1 | Environmental | Open in IMG/M |
| 3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
| 3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
| 3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
| 3300032895 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.3 | Environmental | Open in IMG/M |
| 3300033004 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4 | Environmental | Open in IMG/M |
| 3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
| 3300034199 | Peat soil microbial communities from wetlands in Alaska, United States - Goldstream_01D_14 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| 2222014159 | 2209111022 | Grass Soil | MALVLLVSTPRSSLSWRYLGTIAACVLPALAVVARRRILYM |
| INPhiseqgaiiFebDRAFT_1008599772 | 3300000364 | Soil | LIEPYLMALVLMVSTPRSSLSWRYLGMIAACVLPALAVVARRRILYM* |
| JGI26341J46601_100714411 | 3300003219 | Bog Forest Soil | LIEPYLMALVLLVATPRRYLNWPYLGLIAACVLPALLVVARRRILYM* |
| Ga0062387_1003734751 | 3300004091 | Bog Forest Soil | RSLIEPYLMALILLLATPRQYLNWRYFALIVASAAPALAVVARRRILYM* |
| Ga0062387_1017684311 | 3300004091 | Bog Forest Soil | TSTFGEGRSLIEPYLMALVLLVATPRHYLNWRYLGMIAACVLPALAVVARRRILYM* |
| Ga0066813_10153432 | 3300005103 | Soil | IEPYLMALVLLVSTPRRALSWPYLGMIAACVLPALAVVARRRILYM* |
| Ga0070680_1000240542 | 3300005336 | Corn Rhizosphere | MALVLMVSTPRSSLSWRYLGTFAACVLPALAVVARRRILYM* |
| Ga0070661_1002101351 | 3300005344 | Corn Rhizosphere | MALVLMVSTPRSSLSWRYLGTIAACVLPALAVVARRRILYM* |
| Ga0008090_149088301 | 3300005363 | Tropical Rainforest Soil | EPYLMALILLLATPRQYLSWRYLGLITACVLPALLVVARRRILYM* |
| Ga0070714_1005294282 | 3300005435 | Agricultural Soil | DGRSLIEPYLMALVLMVSTPRRSLSWAYLGTIAACVLPALAVVARRRTLYM* |
| Ga0070713_1009289962 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | PYLMALVLMVSTPRSSLSWRYLGTIAACVLPALAVVARRRILYM* |
| Ga0070710_113895863 | 3300005437 | Corn, Switchgrass And Miscanthus Rhizosphere | IEPYLMALIMLLATPRRYINWAYLGVIVACVLPALAVVARRRTLYM* |
| Ga0070711_1000696883 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | SLIEPYLMALIMLLATPRRYINWAYLGVIVACVLPALAVVARRRTLYM* |
| Ga0070708_1015177781 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MALVLMVSTPRRSLSWAYLGTVAACVLPALAVVARRRTLYM* |
| Ga0070730_108032601 | 3300005537 | Surface Soil | EPYLMALVLLLATPRRYLSWPYLGMICACVLPALAVVARRRTLYM* |
| Ga0070730_109641942 | 3300005537 | Surface Soil | VLLLATPRRSINWAYLGMITACVLPALAVVARRRTLYM* |
| Ga0070704_1003670372 | 3300005549 | Corn, Switchgrass And Miscanthus Rhizosphere | RSLIEPYLMALVLMVSTPRSSLSWRYLGTIAACVLPALAVVARRRILYM* |
| Ga0070664_1004304913 | 3300005564 | Corn Rhizosphere | MALVLMVSTPRSSLSWRYLGTIAACVLPALAVVARRRIL |
| Ga0068857_1003507411 | 3300005577 | Corn Rhizosphere | STPRSSLSWRYLGTIAACVLPALAVVARRRILYM* |
| Ga0066654_108415591 | 3300005587 | Soil | SLIEPYLMALVLLLATPRRYINWAYLGVIVACVLPALAVVARRRTLYM* |
| Ga0070761_106258711 | 3300005591 | Soil | FGDGRSLIEPYLLALILLLATPRQYLSWRYLGLITACVAPALLVVARRRILYM* |
| Ga0070762_102945791 | 3300005602 | Soil | EPYLMALILLLATPRHYLSWRYLGLIVACVAPALAVVARRRILYM* |
| Ga0068870_103535931 | 3300005840 | Miscanthus Rhizosphere | VLMVSTPRSSLSWRYLGTIAACVLPALAVVARRRILYM* |
| Ga0075015_1008668961 | 3300006102 | Watersheds | MALVLLVATPRRYLNWPYLGLIVACVVPALLVVARRRILYM* |
| Ga0070712_1007315801 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | GDGRSLIEPYLMALVLMVSTPRRSLSWAYLGTIAAFVLPALAVVARRRTLYM* |
| Ga0070765_1004073282 | 3300006176 | Soil | SLIEPYLMALILLLATPRRYLSGRYLSLIAAWAIPALVVVARRRILYM* |
| Ga0070765_1022463811 | 3300006176 | Soil | FGEGRSLIEPYLMALILLLATPRHYLSWRYLGLIVACVAPALAVVARRRILYM* |
| Ga0068871_1012006842 | 3300006358 | Miscanthus Rhizosphere | VSTPRSSLSWRYLGTIAACVLPALAVVARRRILYM* |
| Ga0079222_100771272 | 3300006755 | Agricultural Soil | MLLATPRRYINWAYLGVIVACVLPALAVVARRRTLYM* |
| Ga0079222_111159962 | 3300006755 | Agricultural Soil | MALILLVSTPKRFLSWPYLAMIATCVLPALAVEARRRILYM* |
| Ga0075426_114135912 | 3300006903 | Populus Rhizosphere | LVLMVSTPRSSLSWRYLGTIAACVLPALAVVARRRILYM* |
| Ga0075424_1010954122 | 3300006904 | Populus Rhizosphere | YLLALIMLLATPRRYINWAYLGVIVACVLPALAVVARRRTLYM* |
| Ga0075436_1009487282 | 3300006914 | Populus Rhizosphere | LMVSTPRSSLSWRYLGTIAACVLPALAVVARRRILYM* |
| Ga0075435_1017009621 | 3300007076 | Populus Rhizosphere | YLMALVLMVSTPRNSLSWRYLGTIAACVLPALAVVARRRILYM* |
| Ga0099795_106502702 | 3300007788 | Vadose Zone Soil | LIEPYLMALILLLATPRQYLSWRYLSLIAACAGPALLVVARRRILYM* |
| Ga0116222_10399402 | 3300009521 | Peatlands Soil | MALILLLATPRKYLSWRYLGPITACVIPALLVVARRRILYM* |
| Ga0105249_117558201 | 3300009553 | Switchgrass Rhizosphere | GRSLIEPYLMALVLMVSTPRSSLSWRYLGTIAACVLPALAVVARRRILYM* |
| Ga0116216_103182942 | 3300009698 | Peatlands Soil | MALVLLVATPRRYLNWPYLGLIAACVMPALLVVARRRILYM* |
| Ga0116217_102895362 | 3300009700 | Peatlands Soil | LATPRRYLSSLNLTLILAWVLPALLVVARRRALYM* |
| Ga0126318_110375391 | 3300010152 | Soil | STPRHSLSWRYLGTIAACVLPALAVVARRRILYM* |
| Ga0134111_105094542 | 3300010329 | Grasslands Soil | TSTFGEGRSLIEPYLMALVVLVSTPRRSLPWPYLAMIAACVLPALAVVARRRTLYM* |
| Ga0074045_106184402 | 3300010341 | Bog Forest Soil | GRSLIEPYLMALVLLVATPRRYLNWPYLGLIAACVMPALLVVARRRILYM* |
| Ga0134128_106349692 | 3300010373 | Terrestrial Soil | FGEGRSLIEPYLMALVLLVSTPRSSLSWRYLGMIAACVLPALAVVARRRILYM* |
| Ga0134128_108461892 | 3300010373 | Terrestrial Soil | FGEGRSLIEPYLMALVLMVSTPRSSLSWRYLGTIAACVLPALAVVARRRILYM* |
| Ga0136449_1004145993 | 3300010379 | Peatlands Soil | LMALILLLATPRQYLSWRYLGPITACVIPALLVVARRRILYM* |
| Ga0134126_109103432 | 3300010396 | Terrestrial Soil | LLATPRRYINWAYLGVIVACVLPALAVVARRRTLYM* |
| Ga0134124_103067432 | 3300010397 | Terrestrial Soil | LMALVLMVSTPRSSLSWRYLGTIAACVLPALAVVARRRILYM* |
| Ga0126361_109906561 | 3300010876 | Boreal Forest Soil | MALVLLMATPRRYLSWRYLSLIAAFAVPALLVVARRRALFM* |
| Ga0126350_100779482 | 3300010880 | Boreal Forest Soil | ALILLLATPRHYLSWRYLGLIVACAAPALAIVARRRILYM* |
| Ga0153952_11133161 | 3300012176 | Attine Ant Fungus Gardens | ILLLATPRHYLSWRYLGLIVACAAPALAIVARRRILYM* |
| Ga0137381_105549611 | 3300012207 | Vadose Zone Soil | IEPYLMALVLLVSTPRRSLSRRYLGMIAACVLPALAVVARRRILYM* |
| Ga0137378_111498911 | 3300012210 | Vadose Zone Soil | LLALVLLVATPRRYLSWPYLGMIAACAIPALLVAARRRILYM* |
| Ga0137387_111509381 | 3300012349 | Vadose Zone Soil | EPYLMALVLLVATPRRYLSWPYLGMIAACVLPALLVVARRRTLYM* |
| Ga0137384_101482761 | 3300012357 | Vadose Zone Soil | LVLLVSTPRRSLPWPYIATIAACVLPALAVVARRRILYM* |
| Ga0157320_10046281 | 3300012481 | Arabidopsis Rhizosphere | EIWTSTFGEGRSLIEPYLMALVLMVSTPRSSLSWRYLGMIAACVLPALAVVARRRILYM* |
| Ga0164302_110825731 | 3300012961 | Soil | MVSTPRRSLSWAYLGTIAACVLPALAVVARRRTLYM* |
| Ga0157369_112152202 | 3300013105 | Corn Rhizosphere | MALVLMVSTPRSSLSWRYLGTIAACVLPALAVVARRRILY |
| Ga0181534_103837121 | 3300014168 | Bog | IEPYLMALVLMLATPRRYLSWRYLGPIVAVAVPALVVVARRRILYM* |
| Ga0181537_103905222 | 3300014201 | Bog | MALVLLLATPQRYMSRRYLGLVVACIVPALVVVARRRILYM* |
| Ga0181537_111584592 | 3300014201 | Bog | LFATPRRYLSWPYLGMIVACAVPALLVVARRRSLYM* |
| Ga0182033_110618181 | 3300016319 | Soil | LILLLATPRQYLSWRYLGPIAACVLPALAVVARRRILYM |
| Ga0182033_121012172 | 3300016319 | Soil | QIWTSTFGEGRSLIEPYLMALVLLVSTPKRVLSWRYLVMIAACVLPALAVVARRRILYM |
| Ga0182040_109967601 | 3300016387 | Soil | TFGEGRSLIEPYLMALILLLATPRQYLSWRYLGLITACVLPVLVVVARRRIMYM |
| Ga0182039_109898182 | 3300016422 | Soil | GEGRSLIEPYLMALVLLVSTPKRYLSWPYLGVIAACVLPALAVVARRRILYM |
| Ga0187807_10410741 | 3300017926 | Freshwater Sediment | FGDGRSLIEPYLLALILLLATPKRYLSWPYLGLIVACALPALLVVARRRILYM |
| Ga0187825_102827593 | 3300017930 | Freshwater Sediment | YLMALILLLATPRQYLSWRYLGLITACALPVLAVVARRRILYM |
| Ga0187819_105191112 | 3300017943 | Freshwater Sediment | TFGDGRSLIEPYLLALILLLATPKRYLSWPYLGLIMACVMPALLVVARRRILHM |
| Ga0187879_100380783 | 3300017946 | Peatland | IEPYLMALILLFATPQRYLSWRYLSLMAAWAVPALVVVARRRILYM |
| Ga0187879_100803402 | 3300017946 | Peatland | SLIEPYLMALVLLLATPRRYLNWPYLGMIVACAMPALLVVARRRALYM |
| Ga0187817_107193911 | 3300017955 | Freshwater Sediment | LVLLLATPRQYLSWRYLGLITACVVPALLVVARRRILYM |
| Ga0187779_102761361 | 3300017959 | Tropical Peatland | FGEGRSLIEPYLMALVLLLATPRQYLSWRYLGLITACVLAALAVVARRRILYM |
| Ga0187783_109229011 | 3300017970 | Tropical Peatland | MALILLLATPRRYLSSRYLGLIAACVIPALLVVARRRILYM |
| Ga0187781_104605232 | 3300017972 | Tropical Peatland | LILLLATPRQYLNWRYLGFIMACMAPALALVARRRILNM |
| Ga0187781_114987712 | 3300017972 | Tropical Peatland | SLIEPYLMALILLLATPRQYLNWRYLGLIAACVLPALAVVARRRILYM |
| Ga0187782_116629792 | 3300017975 | Tropical Peatland | TFGDGRSLIEPYLMALILLLATPRQYLSWRYLGPVIACVLPALAVVARRRILYM |
| Ga0187863_102227232 | 3300018034 | Peatland | YLMALILLFATPQRYLSWRYLSLMAAWAVPALVVVARRRILYM |
| Ga0187883_106416371 | 3300018037 | Peatland | PYLMALVLLLATPRRYMSWTYLAMIVACVLPALAIVIRRRTLYM |
| Ga0187887_108924512 | 3300018043 | Peatland | SLIEPYLMALILLFATPRRYLSWRYLSLIAACAAPALLVVARRRTLYM |
| Ga0187851_108166212 | 3300018046 | Peatland | DGRSLIEPYLMALILLFATPRRYLSWRYLSLIAACAAPALLVVARRRTLYM |
| Ga0187765_108792852 | 3300018060 | Tropical Peatland | MALILLLATPRQYLSWRYLGLITAFVLPALAVVARRRILYM |
| Ga0187772_101727992 | 3300018085 | Tropical Peatland | EGRSLIEPYLMALVLLVSTPRRYVNWPYIGMIVACVLPALAVVARRRILYM |
| Ga0187772_103754042 | 3300018085 | Tropical Peatland | PYLMALILLLATPRRYLSWRYLGLITAFAFPVLAVVARRRILYM |
| Ga0187772_109096252 | 3300018085 | Tropical Peatland | GRSLIEPYLMALILLLATPRQYLSWRYLGLITACILPALAVVARRRILYM |
| Ga0206353_101701752 | 3300020082 | Corn, Switchgrass And Miscanthus Rhizosphere | MALVLMVSTPRSSVSWRYLGTIAACVLPALAVVARRRILYM |
| Ga0210395_104895301 | 3300020582 | Soil | EPFLMALVLLLATPRHYLSGRYLGLLMACTVPALLVIARLRILNM |
| Ga0210404_105606511 | 3300021088 | Soil | WTSTFGEGRSLIEPYLMALVLLVATPRHYLNWRYLGMIAACVLPALAVVARRRILYM |
| Ga0210388_100581411 | 3300021181 | Soil | LVLLLATPRRYLSGRYLGLLVACTVPALLVIARLRILNM |
| Ga0213875_101656523 | 3300021388 | Plant Roots | PYLLALVLLLATPRRYINWAYLGMITACVLPALAVVARRRTLYM |
| Ga0210385_102984752 | 3300021402 | Soil | RSLIEPYLMALVLLIATPRRYLDWRYLGLIAACAGPALLVVARRRALYM |
| Ga0210397_110151941 | 3300021403 | Soil | LMALVVLVSTPRRSLPWPYLAMIAACVLPALAVVARRRILYM |
| Ga0210387_114360782 | 3300021405 | Soil | GRSLIEPYLMALILLLATPRHYLSWRYLGLIMACAAPALAIVARRRILYM |
| Ga0210387_115270051 | 3300021405 | Soil | RSLIEPYLLALVLLVSTPRRSLSWAYLGTIAACVLPALAVVARRRTLYM |
| Ga0210386_113580091 | 3300021406 | Soil | TSTFGDGRSLIEPYLMALVLMVSTPRRSLSWAYLGTIAACVLPALAVVARRRTLYM |
| Ga0210394_101730991 | 3300021420 | Soil | VLMVSTPRRSLSWAYLGTIAAFALPALAVVARRRTLYM |
| Ga0210390_106376922 | 3300021474 | Soil | MALILLLATPRRYLSGRYLSLIAAWAIPALVVVARRRILYM |
| Ga0210398_106528472 | 3300021477 | Soil | VLLLATPRRYLSWRYLSLIAACAAPALLVVARRRTLYM |
| Ga0210402_100435431 | 3300021478 | Soil | LIEPYLMALVLMVSTPRRSLSWAYLGTIAACVLPALAVVARRRTLYM |
| Ga0210409_102115271 | 3300021559 | Soil | IWTSTFGDGRSLIEPYLMALVLMVSTPRRSLSWAYLGTIAACVLPALAVVARRRTLYM |
| Ga0210409_113375281 | 3300021559 | Soil | SLIEPYLMALVVLVSTPRRSLPWPYLAMIAACVLPALAVVARRRILYM |
| Ga0126371_111054672 | 3300021560 | Tropical Forest Soil | SLIEPYLMALVLLFATPRRYFSWLYLGPILACGVPALLVVARRRTLYM |
| Ga0126371_125212712 | 3300021560 | Tropical Forest Soil | GEGRSLIEPYLMALVLLVSTPKRLLSWPYLAMIAACVLPALAVVARRRILYM |
| Ga0247676_10183161 | 3300024249 | Soil | MVSTPRSSLSWRYLGTIAACVLPALAVVARRRILYM |
| Ga0247670_10440232 | 3300024283 | Soil | RSLIEPYLMALVLMVSTPRSSLSWRYLGTIAACVLPALAVVARRRILYM |
| Ga0207692_105456032 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | VLMVSTPRSSLSWRYLGTIAACVLPALAVVARRRILYM |
| Ga0207710_103674941 | 3300025900 | Switchgrass Rhizosphere | MALVLMVSTPRSSLSWRYLGTFAACVLPALAVVARRRILYM |
| Ga0207699_106835611 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | YLMALVLMVSTPRSSLSWRYLGTIAACVLPALAVVARRRILYM |
| Ga0207707_111560021 | 3300025912 | Corn Rhizosphere | TFGEGRSLIEPYLMALVLLVSTPRRLLSWPYLGMIAACVLPALAVVARRRILYM |
| Ga0207663_106221472 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | YLMALVLMVSTPRRSLSWAYLGTIAACVLPALAVVARRRTLYM |
| Ga0207662_106716012 | 3300025918 | Switchgrass Rhizosphere | MVSTPRSSVSWRYLGTIAACVLPALAVVARRRILYM |
| Ga0207664_108410591 | 3300025929 | Agricultural Soil | MALVLMVSTPRSSLSWRYLGTIAACVLPALAVVAR |
| Ga0207690_111472352 | 3300025932 | Corn Rhizosphere | LVLMVSTPRSSLSWRYLGTFAACVLPALAVVARRRILYM |
| Ga0207677_105853331 | 3300026023 | Miscanthus Rhizosphere | VSTPRSSLSWRYLGTIAACVLPALAVVARRRILYM |
| Ga0207763_10304182 | 3300026879 | Tropical Forest Soil | LLLATPKRYLSWPYLSLIAACALPALLVVARRRILHM |
| Ga0207949_10044622 | 3300026999 | Forest Soil | LATPRHYLSWRYLGLIVACVAPALAVVARRRILYM |
| Ga0208237_10419401 | 3300027080 | Forest Soil | LMALVLLVATPRHYLNWRYLGMIAVCVLPALAVVARRRILYM |
| Ga0209008_10444042 | 3300027545 | Forest Soil | EPYLMALILLLATPRHYLSWRYLSLIVACVAPALAVVARRRILYM |
| Ga0208043_11536471 | 3300027570 | Peatlands Soil | YLMALILLLATPRKYLSWRYLGPITACVIPALLVVARRRILYM |
| Ga0208043_11739012 | 3300027570 | Peatlands Soil | MALILLLATPRRYLSSLNLTLILAWVLPALLVVARRRALYM |
| Ga0209527_10638882 | 3300027583 | Forest Soil | STFGEGRSLIEPYLLALILLLATPRHYLSWRYLGLIVACVAPALAIVARRRILYM |
| Ga0209446_10859551 | 3300027698 | Bog Forest Soil | MALVLLLATPRRYLNWPYLGMIVACAMPALLVVARRRILYM |
| Ga0209040_105406912 | 3300027824 | Bog Forest Soil | TFGEGRSLIEPYLMALVLLVATPRRYLNWPYLGLIAACVLPALLVVARRRILYM |
| Ga0209274_107462071 | 3300027853 | Soil | IEPYLMALVLLLATPQRYLSRRNLGLVVACVVPALLVVARRRILYM |
| Ga0209167_105156581 | 3300027867 | Surface Soil | LLLATPRQYLSWRYLSLITACALPALLIVARRRILYM |
| Ga0209698_106024101 | 3300027911 | Watersheds | YLMAVVLLVATPRRYLNWPYLGMIAACVMPALLVVARRRALYM |
| Ga0209526_102424482 | 3300028047 | Forest Soil | YLLALVLLVATPRRYLSWPYLGMIAACVLPALLVVARRRALYM |
| Ga0302220_101870382 | 3300028742 | Palsa | FGDGRSLIEPYLMALILLFATPRRYLSWRYLSLIAACAVPALLVVTRRRTLYM |
| Ga0302224_100640681 | 3300028759 | Palsa | GRSLIEPYLMALVLLLATPRRYLCWRYLSLIAACAVPALLVVTRRRTLYM |
| Ga0307280_100134491 | 3300028768 | Soil | STFGEGRSLIEPYLMALVLMVSTPRSSLSWRYLGTIAACVLPALAVVARRRILYM |
| Ga0302234_101536112 | 3300028773 | Palsa | PYLLALILLLATPRQYLSWRYLGLITACVAPALLVVARRRILYM |
| Ga0302231_103112131 | 3300028775 | Palsa | FATPRRYLSWRYLSLIAACAVPALLVVTRRRTLYM |
| Ga0302228_100082966 | 3300028808 | Palsa | LFATPRRYLSWRYLSLIAACAVPALLVVTRRRTLYM |
| Ga0311339_106368901 | 3300029999 | Palsa | LILLFATPRRYLSWRYLSLIAACAAPALLVVARRRILYM |
| Ga0311353_101089943 | 3300030399 | Palsa | LVLLLATPRRYLCWRYLSLIAACAVPALLVVARRRTLYM |
| Ga0311353_109887582 | 3300030399 | Palsa | MALILLFATPRRYLSWRYLSLIAACAAPALLVVARRRTLYM |
| Ga0302183_103077991 | 3300030509 | Palsa | EPYLMALVLLLATPRRYLSWRYLSLIAACAVPALLVVARRRTLYM |
| Ga0265459_113634482 | 3300030741 | Soil | EPYLMALVLLFATPRRYLSWHYLSLIAACAAPALLVVARRRTLYM |
| Ga0302308_100986363 | 3300031027 | Palsa | FATPRRYLSWRYLSLIAACAAPALLVVARRRILYM |
| Ga0302180_101402331 | 3300031028 | Palsa | PYLMALILLFATPRRYLSWRYLSLIAACAAPALLVVARRRTLYM |
| Ga0302326_108455212 | 3300031525 | Palsa | ALILLLATPKRYLNTYRLAAITAVALPALAVVVRRRILYM |
| Ga0302326_133522672 | 3300031525 | Palsa | TFGDGRSLIEPFLMALILLFATPRRYLSWPYLGMIVACAVPALLVVARRRSLYM |
| Ga0318516_103730542 | 3300031543 | Soil | LIEPYLMALVLLVSTPKRYLSWPYLAMIAACVLPALAVVARRRILYM |
| Ga0318534_101436262 | 3300031544 | Soil | RSLIEPYLMALVLLVSTPRRSLPWAYLGMIAACVLPALAVVARRRILYM |
| Ga0318534_101616471 | 3300031544 | Soil | PYLMALVLLVATPRRYLSGPYLGMIAAYVLPALLVVARRRALYM |
| Ga0318572_108351642 | 3300031681 | Soil | IWTSTFGEGRSLIEPYLMALVLLVSTPKRYLSWPYLGVIAACVLPALAVVARRRILYM |
| Ga0310686_1004916962 | 3300031708 | Soil | GDGRSLIEVYLMALILLLATPRRYLSSRNLTVIAACVLPALLVVARRRALYM |
| Ga0310686_1062455281 | 3300031708 | Soil | FLMALVLLLATPRQYLSGRYLGLLVACTVPALLVIARLRILNM |
| Ga0310686_1124509032 | 3300031708 | Soil | DGRSLIEPYLMALVLLFATPRRYLSWRYLSLIAACAVPALLVVARRRTLYM |
| Ga0318496_102385701 | 3300031713 | Soil | AGRSLIEPYLMALILLLATPRQYLSWRYLGPIAACVLPALAVVARRRILYM |
| Ga0318496_104103672 | 3300031713 | Soil | LIEPYLMALIMLLATPRRYINWAYLGVIVACVLPALAVVARRRTLYM |
| Ga0318500_102037542 | 3300031724 | Soil | FGDGRSLIEPYLMALILLLATPRLYLSWRYLGLITACVLPALVVVARRRIMYM |
| Ga0318502_100522081 | 3300031747 | Soil | ASTFGDGRSLIEPYMLALILLLATPRRYLSWPYLGLIAACAVPALLVVARRRILYM |
| Ga0318521_100684702 | 3300031770 | Soil | LVLLVSTPRRYLSWPYLGMIAACVLPALAVVARRRILYM |
| Ga0318521_102239592 | 3300031770 | Soil | MALVLLVSTPKRYLSWPYLAMIAACVLPALAVVARRRILYM |
| Ga0318498_101540031 | 3300031778 | Soil | LVSTPKRYLSWPYLGVIAACVLPALAVVARRRILYM |
| Ga0318547_105989932 | 3300031781 | Soil | LILLLATPRRYLSSRYLGLIAACVVPALLVVARRRILYM |
| Ga0318568_100455651 | 3300031819 | Soil | PYLMALIMLLATPRQYLSWRYLGLITACALPVLAVVARRRILYM |
| Ga0310917_106115971 | 3300031833 | Soil | VSTPKRYLSWPYLGMIVACVLPALAVVARRRILYM |
| Ga0310892_112211711 | 3300031858 | Soil | LIEPYLMALVLMVSTPRSSLSWRYLGTIAACVLPALAVVARRRILYM |
| Ga0318527_103742871 | 3300031859 | Soil | LVATPRRYLNWPYLAMIVACVLPALAVVARRRILYM |
| Ga0306919_101232801 | 3300031879 | Soil | YLMALIMLLATPRQFLSWRYLGLITACVLPALAVVARRRILYM |
| Ga0318551_102322961 | 3300031896 | Soil | RSLIEPYLMALVLLVSTPRRYLSWPYLGMIVACVMPALLVVARRRALYM |
| Ga0318520_109412722 | 3300031897 | Soil | IWTSTFGEGRSLIEPYLMALVLLVSTPKRYLSWPYLAMIAACVLPALAVVARRRILYM |
| Ga0306921_118679351 | 3300031912 | Soil | IWTSTFGEGRSLIEPYLMALVLLVSTPRRSLPWAYLGMIAACVLPALAVVARRRILYM |
| Ga0318530_101761631 | 3300031959 | Soil | SLIEPYLMALILLLATPRLYLSWRYLGLITACVLPALVVVARRRIMYM |
| Ga0318530_102624502 | 3300031959 | Soil | LLVSTPRRYLSWPYLGMIAACVLPALAVVARRRILYM |
| Ga0307479_100396015 | 3300031962 | Hardwood Forest Soil | VFGDGRSMIEVYLLALILLIATPKRYLNVYWLGAITACCGPALYVVARRRILYM |
| Ga0318562_108131682 | 3300032008 | Soil | YLMALVLLVSTPKRYLSWPYLAMIAACVLPALAVVARRRILYM |
| Ga0318563_102677581 | 3300032009 | Soil | ALILLLATPRQYLSWRYLGLITACVLPVLAVVARRRILYM |
| Ga0318563_106519841 | 3300032009 | Soil | GRSLIEPYLMALVLLVSTPKRYLSWPYLAMIAACVLPALAVVARRRILYM |
| Ga0318504_104323882 | 3300032063 | Soil | STFGDGRSLIEPYLMALVLLVATPRRYLSWPYLGMIVACVLPALLVVARRRALYM |
| Ga0318504_105985411 | 3300032063 | Soil | VLLVSTPKRYLSWPYLGVIAACVLPALAVVARRRILYM |
| Ga0318514_102011921 | 3300032066 | Soil | PYVMALVLLVSTPRRYLSWPYLGMIAACVLPALAVVARRRILYM |
| Ga0318553_103557081 | 3300032068 | Soil | RSLIEPYLMALVLLVATPRRYLSGPYLGMIAACVLPALLVVARRRALYM |
| Ga0306924_104635083 | 3300032076 | Soil | LIEPYLMALIMLLATPRQFLSWRYLGLITACVLPALAVVARRRILYM |
| Ga0306924_110320092 | 3300032076 | Soil | LLATPRQYLSWRYLGLIMACVLPALAVVARRRILYM |
| Ga0318525_106187951 | 3300032089 | Soil | SLIEPYLMALILLLATPRQYLSWRYLGLIMACVLPALAVVARRRILYM |
| Ga0318577_100643641 | 3300032091 | Soil | LLATPKRYLSWPYLSLMAACALPALLVVARRRILHM |
| Ga0307471_1004801962 | 3300032180 | Hardwood Forest Soil | EPYLMALVLMVSTPRSSLSWRYLGTIAACVLPALAVVARRRILYM |
| Ga0306920_1003006061 | 3300032261 | Soil | GDARSLIEPYLLALILLLATPKRYLSWPYLSLMAACALPALLVVARRRILHM |
| Ga0306920_1007856153 | 3300032261 | Soil | RSLIEPYLMALIMLLATPRQFLSWRYLGLITACVLPALAVVARRRILYM |
| Ga0306920_1018516922 | 3300032261 | Soil | LLLATPRQYLSWRYLGLITACVLPVLAVVARRRILYM |
| Ga0335082_110502962 | 3300032782 | Soil | LIMLLATPRRYINWAYLGVIVACVLPALAVVARRRTLYM |
| Ga0335079_104149441 | 3300032783 | Soil | IEPYLMALVLLVATPRRYLSGPYLGMIAAWVLPALLVVARRRALYM |
| Ga0335078_113678392 | 3300032805 | Soil | GEGRSLIEPYLMALVLLVSTPKRLLSWPYLVMIAACVLPALAVVARRRILYM |
| Ga0335081_104819471 | 3300032892 | Soil | ALVLLVATPRRYLSWPYLGMIAACVLPALAVVARRRTLYM |
| Ga0335074_102059831 | 3300032895 | Soil | LMALILLLATPRQYLNWRYLGLIVACAAPVLAVVARRRILYM |
| Ga0335074_109349092 | 3300032895 | Soil | LLLATPQRYLSRRYLGLVVACVVPALLVVARRRILYM |
| Ga0335084_116599411 | 3300033004 | Soil | EGRSLIEPYLMSLVLLVSTPKRYLSWPYLGMIAAWVLPALAVVARRRILYM |
| Ga0335077_116032541 | 3300033158 | Soil | LLVATPRRYLSGPYLGMIAACVLPALLVVARRRALYM |
| Ga0370514_040964_1038_1157 | 3300034199 | Untreated Peat Soil | LVLLCATPRRYLSWRYLSLIAACAVPALLVVARRRTLYM |
| ⦗Top⦘ |