| Basic Information | |
|---|---|
| Family ID | F028866 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 190 |
| Average Sequence Length | 44 residues |
| Representative Sequence | MTVSAELELQSFVLLRLGERRFAVSANQIAELVAPSRVFRFPHRT |
| Number of Associated Samples | 154 |
| Number of Associated Scaffolds | 190 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 84.49 % |
| % of genes near scaffold ends (potentially truncated) | 97.37 % |
| % of genes from short scaffolds (< 2000 bps) | 86.84 % |
| Associated GOLD sequencing projects | 145 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.40 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (98.421 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (22.105 % of family members) |
| Environment Ontology (ENVO) | Unclassified (27.368 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (53.684 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 8.22% β-sheet: 16.44% Coil/Unstructured: 75.34% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.40 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 190 Family Scaffolds |
|---|---|---|
| PF01584 | CheW | 46.84 |
| PF01339 | CheB_methylest | 22.11 |
| PF00072 | Response_reg | 4.21 |
| PF02895 | H-kinase_dim | 1.05 |
| PF00115 | COX1 | 0.53 |
| PF02518 | HATPase_c | 0.53 |
| PF02578 | Cu-oxidase_4 | 0.53 |
| COG ID | Name | Functional Category | % Frequency in 190 Family Scaffolds |
|---|---|---|---|
| COG2201 | Chemotaxis response regulator CheB, contains REC and protein-glutamate methylesterase domains | Signal transduction mechanisms [T] | 44.21 |
| COG0643 | Chemotaxis protein histidine kinase CheA | Signal transduction mechanisms [T] | 2.11 |
| COG1496 | Copper oxidase (laccase) domain | Inorganic ion transport and metabolism [P] | 0.53 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 98.42 % |
| Unclassified | root | N/A | 1.58 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000178|FW301_c1022854 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 741 | Open in IMG/M |
| 3300000364|INPhiseqgaiiFebDRAFT_101109488 | All Organisms → cellular organisms → Bacteria | 582 | Open in IMG/M |
| 3300000364|INPhiseqgaiiFebDRAFT_101369538 | All Organisms → cellular organisms → Bacteria | 795 | Open in IMG/M |
| 3300000580|AF_2010_repII_A01DRAFT_1068440 | All Organisms → cellular organisms → Bacteria | 540 | Open in IMG/M |
| 3300000793|AF_2010_repII_A001DRAFT_10107120 | All Organisms → cellular organisms → Bacteria | 588 | Open in IMG/M |
| 3300001593|JGI12635J15846_10121384 | All Organisms → cellular organisms → Bacteria | 1846 | Open in IMG/M |
| 3300001593|JGI12635J15846_10155163 | All Organisms → cellular organisms → Bacteria | 1565 | Open in IMG/M |
| 3300001593|JGI12635J15846_10749289 | All Organisms → cellular organisms → Bacteria | 561 | Open in IMG/M |
| 3300001593|JGI12635J15846_10807022 | All Organisms → cellular organisms → Bacteria | 538 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_100601318 | All Organisms → cellular organisms → Bacteria | 977 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_101775515 | All Organisms → cellular organisms → Bacteria | 517 | Open in IMG/M |
| 3300002557|JGI25381J37097_1015158 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1356 | Open in IMG/M |
| 3300002914|JGI25617J43924_10232108 | All Organisms → cellular organisms → Bacteria | 619 | Open in IMG/M |
| 3300004082|Ga0062384_100258843 | All Organisms → cellular organisms → Bacteria | 1059 | Open in IMG/M |
| 3300004082|Ga0062384_101316408 | All Organisms → cellular organisms → Bacteria | 529 | Open in IMG/M |
| 3300004091|Ga0062387_100676495 | All Organisms → cellular organisms → Bacteria | 752 | Open in IMG/M |
| 3300004092|Ga0062389_101011783 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1016 | Open in IMG/M |
| 3300004092|Ga0062389_101728438 | All Organisms → cellular organisms → Bacteria | 806 | Open in IMG/M |
| 3300004479|Ga0062595_101889372 | All Organisms → cellular organisms → Bacteria | 571 | Open in IMG/M |
| 3300005166|Ga0066674_10301596 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 753 | Open in IMG/M |
| 3300005186|Ga0066676_10481391 | All Organisms → cellular organisms → Bacteria | 842 | Open in IMG/M |
| 3300005187|Ga0066675_10731994 | All Organisms → cellular organisms → Bacteria | 744 | Open in IMG/M |
| 3300005435|Ga0070714_100284638 | All Organisms → cellular organisms → Bacteria | 1537 | Open in IMG/M |
| 3300005436|Ga0070713_101853055 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 585 | Open in IMG/M |
| 3300005468|Ga0070707_101753803 | All Organisms → cellular organisms → Bacteria | 588 | Open in IMG/M |
| 3300005471|Ga0070698_100458043 | All Organisms → cellular organisms → Bacteria | 1211 | Open in IMG/M |
| 3300005541|Ga0070733_11086628 | All Organisms → cellular organisms → Bacteria | 536 | Open in IMG/M |
| 3300005560|Ga0066670_10955954 | All Organisms → cellular organisms → Bacteria | 522 | Open in IMG/M |
| 3300005591|Ga0070761_10102504 | All Organisms → cellular organisms → Bacteria | 1650 | Open in IMG/M |
| 3300005610|Ga0070763_10197890 | All Organisms → cellular organisms → Bacteria | 1070 | Open in IMG/M |
| 3300005618|Ga0068864_102576674 | All Organisms → cellular organisms → Bacteria | 514 | Open in IMG/M |
| 3300005764|Ga0066903_103162150 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 891 | Open in IMG/M |
| 3300005944|Ga0066788_10147252 | All Organisms → cellular organisms → Bacteria | 598 | Open in IMG/M |
| 3300005994|Ga0066789_10110877 | All Organisms → cellular organisms → Bacteria | 1176 | Open in IMG/M |
| 3300006086|Ga0075019_10321065 | All Organisms → cellular organisms → Bacteria | 935 | Open in IMG/M |
| 3300006086|Ga0075019_10424616 | All Organisms → cellular organisms → Bacteria | 816 | Open in IMG/M |
| 3300006176|Ga0070765_100982595 | All Organisms → cellular organisms → Bacteria | 798 | Open in IMG/M |
| 3300006755|Ga0079222_10036203 | All Organisms → cellular organisms → Bacteria | 2165 | Open in IMG/M |
| 3300007076|Ga0075435_101036733 | All Organisms → cellular organisms → Bacteria | 716 | Open in IMG/M |
| 3300007265|Ga0099794_10507471 | All Organisms → cellular organisms → Bacteria | 635 | Open in IMG/M |
| 3300009090|Ga0099827_11507668 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 585 | Open in IMG/M |
| 3300010159|Ga0099796_10236558 | All Organisms → cellular organisms → Bacteria | 754 | Open in IMG/M |
| 3300010322|Ga0134084_10031929 | All Organisms → cellular organisms → Bacteria | 1478 | Open in IMG/M |
| 3300010325|Ga0134064_10464445 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 518 | Open in IMG/M |
| 3300010337|Ga0134062_10398680 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 673 | Open in IMG/M |
| 3300010337|Ga0134062_10692490 | All Organisms → cellular organisms → Bacteria | 535 | Open in IMG/M |
| 3300010358|Ga0126370_10537524 | All Organisms → cellular organisms → Bacteria | 995 | Open in IMG/M |
| 3300010366|Ga0126379_13483404 | All Organisms → cellular organisms → Bacteria | 527 | Open in IMG/M |
| 3300010376|Ga0126381_100150705 | All Organisms → cellular organisms → Bacteria | 3053 | Open in IMG/M |
| 3300010398|Ga0126383_11027227 | All Organisms → cellular organisms → Bacteria | 913 | Open in IMG/M |
| 3300010401|Ga0134121_12147466 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 594 | Open in IMG/M |
| 3300010877|Ga0126356_10959545 | All Organisms → cellular organisms → Bacteria | 623 | Open in IMG/M |
| 3300011269|Ga0137392_10101096 | All Organisms → cellular organisms → Bacteria | 2273 | Open in IMG/M |
| 3300011270|Ga0137391_10213736 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1676 | Open in IMG/M |
| 3300011270|Ga0137391_10477634 | All Organisms → cellular organisms → Bacteria | 1058 | Open in IMG/M |
| 3300011270|Ga0137391_10610951 | All Organisms → cellular organisms → Bacteria | 913 | Open in IMG/M |
| 3300011271|Ga0137393_10423168 | All Organisms → cellular organisms → Bacteria | 1141 | Open in IMG/M |
| 3300012096|Ga0137389_10129837 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2041 | Open in IMG/M |
| 3300012096|Ga0137389_10745726 | All Organisms → cellular organisms → Bacteria | 841 | Open in IMG/M |
| 3300012096|Ga0137389_11169663 | All Organisms → cellular organisms → Bacteria | 659 | Open in IMG/M |
| 3300012201|Ga0137365_10508447 | All Organisms → cellular organisms → Bacteria | 885 | Open in IMG/M |
| 3300012202|Ga0137363_10027298 | All Organisms → cellular organisms → Bacteria | 3904 | Open in IMG/M |
| 3300012203|Ga0137399_10134660 | All Organisms → cellular organisms → Bacteria | 1957 | Open in IMG/M |
| 3300012203|Ga0137399_10631101 | All Organisms → cellular organisms → Bacteria | 901 | Open in IMG/M |
| 3300012203|Ga0137399_11641312 | All Organisms → cellular organisms → Bacteria | 531 | Open in IMG/M |
| 3300012206|Ga0137380_11285141 | All Organisms → cellular organisms → Bacteria | 617 | Open in IMG/M |
| 3300012208|Ga0137376_10961150 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 732 | Open in IMG/M |
| 3300012208|Ga0137376_11788012 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 505 | Open in IMG/M |
| 3300012210|Ga0137378_10346627 | All Organisms → cellular organisms → Bacteria | 1380 | Open in IMG/M |
| 3300012349|Ga0137387_10275924 | All Organisms → cellular organisms → Bacteria | 1214 | Open in IMG/M |
| 3300012349|Ga0137387_11047310 | All Organisms → cellular organisms → Bacteria | 583 | Open in IMG/M |
| 3300012361|Ga0137360_10011981 | All Organisms → cellular organisms → Bacteria | 5552 | Open in IMG/M |
| 3300012361|Ga0137360_11086896 | All Organisms → cellular organisms → Bacteria | 691 | Open in IMG/M |
| 3300012362|Ga0137361_10308650 | All Organisms → cellular organisms → Bacteria | 1448 | Open in IMG/M |
| 3300012362|Ga0137361_10376507 | All Organisms → cellular organisms → Bacteria | 1303 | Open in IMG/M |
| 3300012582|Ga0137358_10840387 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 607 | Open in IMG/M |
| 3300012683|Ga0137398_10132876 | All Organisms → cellular organisms → Bacteria | 1601 | Open in IMG/M |
| 3300012685|Ga0137397_10718438 | All Organisms → cellular organisms → Bacteria | 742 | Open in IMG/M |
| 3300012918|Ga0137396_10193082 | All Organisms → cellular organisms → Bacteria | 1495 | Open in IMG/M |
| 3300012918|Ga0137396_10855531 | All Organisms → cellular organisms → Bacteria | 668 | Open in IMG/M |
| 3300012927|Ga0137416_10498282 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1049 | Open in IMG/M |
| 3300012931|Ga0153915_11924282 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 692 | Open in IMG/M |
| 3300013307|Ga0157372_11919739 | All Organisms → cellular organisms → Bacteria | 681 | Open in IMG/M |
| 3300015168|Ga0167631_1062019 | All Organisms → cellular organisms → Bacteria | 614 | Open in IMG/M |
| 3300015245|Ga0137409_10918649 | All Organisms → cellular organisms → Bacteria | 711 | Open in IMG/M |
| 3300016422|Ga0182039_12203194 | All Organisms → cellular organisms → Bacteria | 508 | Open in IMG/M |
| 3300017654|Ga0134069_1265297 | All Organisms → cellular organisms → Bacteria | 600 | Open in IMG/M |
| 3300017924|Ga0187820_1001245 | All Organisms → cellular organisms → Bacteria | 5769 | Open in IMG/M |
| 3300017946|Ga0187879_10586703 | All Organisms → cellular organisms → Bacteria | 619 | Open in IMG/M |
| 3300017972|Ga0187781_11401518 | All Organisms → cellular organisms → Bacteria | 517 | Open in IMG/M |
| 3300018058|Ga0187766_10706375 | All Organisms → cellular organisms → Bacteria | 697 | Open in IMG/M |
| 3300018433|Ga0066667_11466345 | All Organisms → cellular organisms → Bacteria | 602 | Open in IMG/M |
| 3300018482|Ga0066669_11151748 | All Organisms → cellular organisms → Bacteria | 700 | Open in IMG/M |
| 3300020022|Ga0193733_1081384 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 908 | Open in IMG/M |
| 3300020170|Ga0179594_10031187 | All Organisms → cellular organisms → Bacteria | 1703 | Open in IMG/M |
| 3300020579|Ga0210407_11017510 | All Organisms → cellular organisms → Bacteria | 631 | Open in IMG/M |
| 3300020580|Ga0210403_10126422 | All Organisms → cellular organisms → Bacteria | 2083 | Open in IMG/M |
| 3300020580|Ga0210403_11106725 | All Organisms → cellular organisms → Bacteria | 615 | Open in IMG/M |
| 3300020583|Ga0210401_10159570 | All Organisms → cellular organisms → Bacteria | 2106 | Open in IMG/M |
| 3300021046|Ga0215015_10598624 | All Organisms → cellular organisms → Bacteria | 743 | Open in IMG/M |
| 3300021088|Ga0210404_10151918 | All Organisms → cellular organisms → Bacteria | 1214 | Open in IMG/M |
| 3300021168|Ga0210406_10097276 | All Organisms → cellular organisms → Bacteria | 2503 | Open in IMG/M |
| 3300021170|Ga0210400_10911840 | All Organisms → cellular organisms → Bacteria | 717 | Open in IMG/M |
| 3300021171|Ga0210405_10798443 | All Organisms → cellular organisms → Bacteria | 723 | Open in IMG/M |
| 3300021171|Ga0210405_11385690 | All Organisms → cellular organisms → Bacteria | 513 | Open in IMG/M |
| 3300021181|Ga0210388_11150532 | All Organisms → cellular organisms → Bacteria | 660 | Open in IMG/M |
| 3300021181|Ga0210388_11421898 | All Organisms → cellular organisms → Bacteria | 582 | Open in IMG/M |
| 3300021358|Ga0213873_10318868 | All Organisms → cellular organisms → Bacteria | 505 | Open in IMG/M |
| 3300021404|Ga0210389_10183331 | All Organisms → cellular organisms → Bacteria | 1630 | Open in IMG/M |
| 3300021405|Ga0210387_11566319 | All Organisms → cellular organisms → Bacteria | 562 | Open in IMG/M |
| 3300021474|Ga0210390_11217190 | All Organisms → cellular organisms → Bacteria | 607 | Open in IMG/M |
| 3300021478|Ga0210402_10239682 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1673 | Open in IMG/M |
| 3300021478|Ga0210402_11700862 | All Organisms → cellular organisms → Bacteria | 557 | Open in IMG/M |
| 3300022724|Ga0242665_10006564 | All Organisms → cellular organisms → Bacteria | 2168 | Open in IMG/M |
| 3300022840|Ga0224549_1031249 | All Organisms → cellular organisms → Bacteria | 723 | Open in IMG/M |
| 3300024330|Ga0137417_1266816 | All Organisms → cellular organisms → Bacteria | 2816 | Open in IMG/M |
| 3300025898|Ga0207692_10993211 | All Organisms → cellular organisms → Bacteria | 554 | Open in IMG/M |
| 3300026002|Ga0208907_109141 | All Organisms → cellular organisms → Bacteria | 515 | Open in IMG/M |
| 3300026295|Ga0209234_1081429 | All Organisms → cellular organisms → Bacteria | 1228 | Open in IMG/M |
| 3300026301|Ga0209238_1032673 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1928 | Open in IMG/M |
| 3300026310|Ga0209239_1178497 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 803 | Open in IMG/M |
| 3300026314|Ga0209268_1002440 | All Organisms → cellular organisms → Bacteria | 8834 | Open in IMG/M |
| 3300026322|Ga0209687_1082442 | All Organisms → cellular organisms → Bacteria | 1048 | Open in IMG/M |
| 3300026329|Ga0209375_1247502 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 601 | Open in IMG/M |
| 3300026499|Ga0257181_1073632 | All Organisms → cellular organisms → Bacteria | 587 | Open in IMG/M |
| 3300026515|Ga0257158_1080206 | All Organisms → cellular organisms → Bacteria | 631 | Open in IMG/M |
| 3300026524|Ga0209690_1264994 | All Organisms → cellular organisms → Bacteria | 541 | Open in IMG/M |
| 3300026527|Ga0209059_1017999 | All Organisms → cellular organisms → Bacteria | 3208 | Open in IMG/M |
| 3300026529|Ga0209806_1027718 | All Organisms → cellular organisms → Bacteria | 2839 | Open in IMG/M |
| 3300026551|Ga0209648_10748270 | All Organisms → cellular organisms → Bacteria | 534 | Open in IMG/M |
| 3300026551|Ga0209648_10832560 | All Organisms → cellular organisms → Bacteria | 505 | Open in IMG/M |
| 3300026555|Ga0179593_1073302 | All Organisms → cellular organisms → Bacteria | 1171 | Open in IMG/M |
| 3300027297|Ga0208241_1053584 | All Organisms → cellular organisms → Bacteria | 640 | Open in IMG/M |
| 3300027521|Ga0209524_1079981 | All Organisms → cellular organisms → Bacteria | 687 | Open in IMG/M |
| 3300027535|Ga0209734_1030990 | All Organisms → cellular organisms → Bacteria | 997 | Open in IMG/M |
| 3300027537|Ga0209419_1092358 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 601 | Open in IMG/M |
| 3300027587|Ga0209220_1201261 | All Organisms → cellular organisms → Bacteria | 505 | Open in IMG/M |
| 3300027603|Ga0209331_1049015 | All Organisms → cellular organisms → Bacteria | 1069 | Open in IMG/M |
| 3300027633|Ga0208988_1011512 | All Organisms → cellular organisms → Bacteria | 2220 | Open in IMG/M |
| 3300027643|Ga0209076_1092891 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 857 | Open in IMG/M |
| 3300027663|Ga0208990_1053508 | All Organisms → cellular organisms → Bacteria | 1204 | Open in IMG/M |
| 3300027671|Ga0209588_1119849 | All Organisms → cellular organisms → Bacteria | 842 | Open in IMG/M |
| 3300027678|Ga0209011_1110976 | All Organisms → cellular organisms → Bacteria | 791 | Open in IMG/M |
| 3300027701|Ga0209447_10052635 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1122 | Open in IMG/M |
| 3300027701|Ga0209447_10066397 | All Organisms → cellular organisms → Bacteria | 990 | Open in IMG/M |
| 3300027737|Ga0209038_10188718 | All Organisms → cellular organisms → Bacteria | 623 | Open in IMG/M |
| 3300027738|Ga0208989_10051468 | All Organisms → cellular organisms → Bacteria | 1424 | Open in IMG/M |
| 3300027826|Ga0209060_10168008 | All Organisms → cellular organisms → Bacteria | 1015 | Open in IMG/M |
| 3300027846|Ga0209180_10383756 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 798 | Open in IMG/M |
| 3300027846|Ga0209180_10460338 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 716 | Open in IMG/M |
| 3300027846|Ga0209180_10497989 | All Organisms → cellular organisms → Bacteria | 682 | Open in IMG/M |
| 3300027855|Ga0209693_10227306 | All Organisms → cellular organisms → Bacteria | 916 | Open in IMG/M |
| 3300027857|Ga0209166_10330218 | All Organisms → cellular organisms → Bacteria | 799 | Open in IMG/M |
| 3300027862|Ga0209701_10481702 | All Organisms → cellular organisms → Bacteria | 677 | Open in IMG/M |
| 3300027889|Ga0209380_10181461 | All Organisms → cellular organisms → Bacteria | 1234 | Open in IMG/M |
| 3300027889|Ga0209380_10738818 | All Organisms → cellular organisms → Bacteria | 562 | Open in IMG/M |
| 3300027898|Ga0209067_10522534 | All Organisms → cellular organisms → Bacteria | 676 | Open in IMG/M |
| 3300027908|Ga0209006_10080824 | All Organisms → cellular organisms → Bacteria | 2892 | Open in IMG/M |
| 3300028047|Ga0209526_10598822 | All Organisms → cellular organisms → Bacteria | 706 | Open in IMG/M |
| 3300028906|Ga0308309_10867907 | All Organisms → cellular organisms → Bacteria | 783 | Open in IMG/M |
| 3300031057|Ga0170834_106332420 | All Organisms → cellular organisms → Bacteria | 3206 | Open in IMG/M |
| 3300031057|Ga0170834_107571477 | All Organisms → cellular organisms → Bacteria | 593 | Open in IMG/M |
| 3300031231|Ga0170824_122788443 | All Organisms → cellular organisms → Bacteria | 3032 | Open in IMG/M |
| 3300031231|Ga0170824_128535184 | All Organisms → cellular organisms → Bacteria | 578 | Open in IMG/M |
| 3300031446|Ga0170820_12028510 | All Organisms → cellular organisms → Bacteria | 809 | Open in IMG/M |
| 3300031715|Ga0307476_11209195 | All Organisms → cellular organisms → Bacteria | 553 | Open in IMG/M |
| 3300031718|Ga0307474_10345881 | All Organisms → cellular organisms → Bacteria | 1151 | Open in IMG/M |
| 3300031720|Ga0307469_10903437 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 818 | Open in IMG/M |
| 3300031754|Ga0307475_10469467 | All Organisms → cellular organisms → Bacteria | 1011 | Open in IMG/M |
| 3300031754|Ga0307475_10987420 | All Organisms → cellular organisms → Bacteria | 662 | Open in IMG/M |
| 3300031768|Ga0318509_10675342 | All Organisms → cellular organisms → Bacteria | 574 | Open in IMG/M |
| 3300031792|Ga0318529_10285310 | All Organisms → cellular organisms → Bacteria | 769 | Open in IMG/M |
| 3300031820|Ga0307473_10492613 | All Organisms → cellular organisms → Bacteria | 825 | Open in IMG/M |
| 3300031823|Ga0307478_11071731 | All Organisms → cellular organisms → Bacteria | 673 | Open in IMG/M |
| 3300031962|Ga0307479_10065670 | All Organisms → cellular organisms → Bacteria | 3500 | Open in IMG/M |
| 3300031962|Ga0307479_10315096 | All Organisms → cellular organisms → Bacteria | 1546 | Open in IMG/M |
| 3300031962|Ga0307479_10424361 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1314 | Open in IMG/M |
| 3300032059|Ga0318533_10058970 | All Organisms → cellular organisms → Bacteria | 2573 | Open in IMG/M |
| 3300032067|Ga0318524_10674671 | All Organisms → cellular organisms → Bacteria | 545 | Open in IMG/M |
| 3300032180|Ga0307471_100009245 | All Organisms → cellular organisms → Bacteria | 6513 | Open in IMG/M |
| 3300032180|Ga0307471_100332733 | All Organisms → cellular organisms → Bacteria | 1621 | Open in IMG/M |
| 3300032180|Ga0307471_102731895 | All Organisms → cellular organisms → Bacteria | 626 | Open in IMG/M |
| 3300032205|Ga0307472_101154401 | All Organisms → cellular organisms → Bacteria | 737 | Open in IMG/M |
| 3300032828|Ga0335080_10252461 | All Organisms → cellular organisms → Bacteria | 1927 | Open in IMG/M |
| 3300032955|Ga0335076_11007158 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 715 | Open in IMG/M |
| 3300033004|Ga0335084_12250995 | All Organisms → cellular organisms → Bacteria | 527 | Open in IMG/M |
| 3300033158|Ga0335077_11562528 | All Organisms → cellular organisms → Bacteria | 629 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 22.11% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 12.11% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 10.00% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 7.37% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 6.84% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 5.26% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 4.21% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 3.68% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 3.68% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 2.63% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 2.11% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 2.11% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.11% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 1.58% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.58% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.05% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 1.05% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 1.05% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 0.53% |
| Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 0.53% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.53% |
| Groundwater | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Groundwater | 0.53% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.53% |
| Glacier Forefield Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil | 0.53% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.53% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.53% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.53% |
| Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 0.53% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.53% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.53% |
| Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 0.53% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.53% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.53% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.53% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.53% |
| Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 0.53% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000178 | Pristine groundwater from Oak Ridge Integrated Field Research Center, Tennessee (resequenced) | Environmental | Open in IMG/M |
| 3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000580 | Forest soil microbial communities from Amazon forest - 2010 replicate II A01 | Environmental | Open in IMG/M |
| 3300000793 | Forest soil microbial communities from Amazon forest - 2010 replicate II A001 | Environmental | Open in IMG/M |
| 3300001593 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 | Environmental | Open in IMG/M |
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300002557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_20cm | Environmental | Open in IMG/M |
| 3300002560 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_20cm | Environmental | Open in IMG/M |
| 3300002914 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm | Environmental | Open in IMG/M |
| 3300004082 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3 | Environmental | Open in IMG/M |
| 3300004091 | Coassembly of ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
| 3300005166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123 | Environmental | Open in IMG/M |
| 3300005186 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 | Environmental | Open in IMG/M |
| 3300005187 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 | Environmental | Open in IMG/M |
| 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
| 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
| 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
| 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
| 3300005541 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 | Environmental | Open in IMG/M |
| 3300005560 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119 | Environmental | Open in IMG/M |
| 3300005591 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 | Environmental | Open in IMG/M |
| 3300005610 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 | Environmental | Open in IMG/M |
| 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Host-Associated | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005944 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 2 DNA2013-048 | Environmental | Open in IMG/M |
| 3300005994 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-049 | Environmental | Open in IMG/M |
| 3300006086 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
| 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Environmental | Open in IMG/M |
| 3300010322 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010325 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_0_1 metaG | Environmental | Open in IMG/M |
| 3300010337 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09082015 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
| 3300010877 | Boreal forest soil eukaryotic communities from Alaska, USA - W3-2 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
| 3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
| 3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
| 3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012931 | Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 3 metaG | Environmental | Open in IMG/M |
| 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Host-Associated | Open in IMG/M |
| 3300015168 | Arctic soil microbial communities from a glacier forefield, Russell Glacier, Kangerlussuaq, Greenland (Sample G4A, Ice margin, adjacent to proglacial lake) | Environmental | Open in IMG/M |
| 3300015245 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
| 3300017654 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300017924 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_5 | Environmental | Open in IMG/M |
| 3300017946 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_10 | Environmental | Open in IMG/M |
| 3300017972 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300018058 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MG | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300020022 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1s2 | Environmental | Open in IMG/M |
| 3300020170 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021046 | Soil microbial communities from Shale Hills CZO, Pennsylvania, United States - 90cm depth | Environmental | Open in IMG/M |
| 3300021088 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M | Environmental | Open in IMG/M |
| 3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
| 3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
| 3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
| 3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
| 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Host-Associated | Open in IMG/M |
| 3300021404 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O | Environmental | Open in IMG/M |
| 3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
| 3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300022724 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-17-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022840 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 P3 1-5 | Environmental | Open in IMG/M |
| 3300024330 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026002 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_25C_0N_202 (SPAdes) | Environmental | Open in IMG/M |
| 3300026295 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026301 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026310 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_2_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026314 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_143 (SPAdes) | Environmental | Open in IMG/M |
| 3300026322 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136 (SPAdes) | Environmental | Open in IMG/M |
| 3300026329 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131 (SPAdes) | Environmental | Open in IMG/M |
| 3300026499 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NR-06-B | Environmental | Open in IMG/M |
| 3300026515 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NL-03-A | Environmental | Open in IMG/M |
| 3300026524 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 (SPAdes) | Environmental | Open in IMG/M |
| 3300026527 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 (SPAdes) | Environmental | Open in IMG/M |
| 3300026529 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 (SPAdes) | Environmental | Open in IMG/M |
| 3300026532 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 (SPAdes) | Environmental | Open in IMG/M |
| 3300026551 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026555 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300027297 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF047 (SPAdes) | Environmental | Open in IMG/M |
| 3300027521 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027535 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027537 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027587 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM3_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027590 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027603 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027633 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA Ref_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027643 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027663 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA Ref_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027678 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027701 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027737 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027738 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM3_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027826 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027855 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027857 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027862 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027889 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes) | Environmental | Open in IMG/M |
| 3300027898 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 (SPAdes) | Environmental | Open in IMG/M |
| 3300027908 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300028047 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300031057 | Oak Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031446 | Fir Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
| 3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031768 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f22 | Environmental | Open in IMG/M |
| 3300031792 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f23 | Environmental | Open in IMG/M |
| 3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
| 3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032059 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27 | Environmental | Open in IMG/M |
| 3300032067 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f22 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
| 3300032955 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5 | Environmental | Open in IMG/M |
| 3300033004 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4 | Environmental | Open in IMG/M |
| 3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| FW301_10228542 | 3300000178 | Groundwater | MTAATELASQSFVLLRLGERRFAISARQIAELVPLSRIFRFPHRT |
| INPhiseqgaiiFebDRAFT_1011094882 | 3300000364 | Soil | MTSCPETVFQSFVLLRLGERRFALPASQIAELVAPSRIFRFPH |
| INPhiseqgaiiFebDRAFT_1013695383 | 3300000364 | Soil | MNPSAETGPQSFVLLRLGERRFALPASQVAELVAP |
| AF_2010_repII_A01DRAFT_10684402 | 3300000580 | Forest Soil | MNVSTELELKSFVLLRLGERRFAVAADDTAELVSPSRIFSFPHRTPRIEG |
| AF_2010_repII_A001DRAFT_101071201 | 3300000793 | Forest Soil | MNVSTELELKSFVLLRLGERRFAVAADDTAELVSPSRIFSFPHRTPRIEGVILRR |
| JGI12635J15846_101213841 | 3300001593 | Forest Soil | MIQPVESTSQSFVLLRLGERRFAVAAVQISELVAPSRI |
| JGI12635J15846_101551633 | 3300001593 | Forest Soil | MTVSTELELQSFVLLRLGERRFAISANQIAELVAPSRVFRF |
| JGI12635J15846_107492892 | 3300001593 | Forest Soil | MTVMTETDLQSFVLLRLGERRFAVAATQIAELVAP |
| JGI12635J15846_108070222 | 3300001593 | Forest Soil | MTPRNDLGSQSFVLLRLGDRRFAMVASQIAELVAPSRVFRFPHRTERVEGVIL |
| JGIcombinedJ26739_1006013183 | 3300002245 | Forest Soil | MIQPIESTSQSFVLLRLGERRFAVAATQISELVAP |
| JGIcombinedJ26739_1017755152 | 3300002245 | Forest Soil | MTFIAEAELQSFVLLRLGDRRFALAASQIAELVAPSRIFHFPNRTPEI |
| JGI25381J37097_10151583 | 3300002557 | Grasslands Soil | MTVSTELELQSFVLLRLGERRFAVSSNQIAELVAPSRVFRFP |
| JGI25383J37093_100531713 | 3300002560 | Grasslands Soil | MSLTAELGSEQFVLLRVGDRRFALCAERVGELAAPSRVFRFPHQTPEVEGVILRR |
| JGI25617J43924_102321081 | 3300002914 | Grasslands Soil | MTLIAETELQSFVLLRLGDRRFAVTANQIAELVAPSRIFRFPHHTS |
| Ga0062384_1002588431 | 3300004082 | Bog Forest Soil | MTQPVESTLQSFVLLRIGERRFAVAAVQISELVAPSRIFRFPHRT |
| Ga0062384_1013164081 | 3300004082 | Bog Forest Soil | MTVLAELELQSVVLLRLGDRRFAVAATEIAELVAPSRMFKF |
| Ga0062387_1006764952 | 3300004091 | Bog Forest Soil | MTAVAELELQSVVLLRLGDRRFAIAATEVSELVAPSRMFKFPHLTQQVEGV |
| Ga0062389_1010117831 | 3300004092 | Bog Forest Soil | MSPQTQADSESFVLLRLAERRFAVAAGDIAELVAPSRIFRFPHHTKEIEGVILRR |
| Ga0062389_1017284382 | 3300004092 | Bog Forest Soil | MIAPIESTSQSFVLLRLGERRFAVAAVQISELVAPSRIFRFPHRTPKL |
| Ga0062595_1018893722 | 3300004479 | Soil | MTIVAEIALESFVLLRLGERRFAVRASQIVELIAPSRVFRFPH |
| Ga0066674_103015962 | 3300005166 | Soil | MTVSTELELQSFVLLRLGERRFAVSANQIAELVAPSRVFRFPHRTPKLE |
| Ga0066676_104813913 | 3300005186 | Soil | MTIVAEIALESFVLLRLGERRFAVRARQIVELIAPSRVFR |
| Ga0066675_107319942 | 3300005187 | Soil | MTIVAEIALESFVLLRLGERRFAVRARQIVELIAPSRVFRFPHN |
| Ga0070714_1002846381 | 3300005435 | Agricultural Soil | MTLIAETELQPFVLLRLGDRRFAVSATQIAELVAPSRVFRFPHN |
| Ga0070713_1018530551 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | MTVAAELELQSFVLLRLGERRFAVSAKQIAELVAPSRVFRFPHRTPRLDGVI |
| Ga0070707_1017538032 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | MTLLNETDLQSFVLLRLGDRRFAVTATQIAELVAPSRIFRFPHHTSEV |
| Ga0070698_1004580433 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | MTVSTDLELKSFVLLRLGERRFAVAADGTAELVAPSRLFRFPHNTAKIE |
| Ga0070733_110866282 | 3300005541 | Surface Soil | MTAAPETNLQSFVLLRLGERRFALPASQVAELVAPS |
| Ga0066670_109559541 | 3300005560 | Soil | MNSAAESALPSFVLLRLGERRFALPASQVAELVAPGRIFRFPHKSA |
| Ga0070761_101025041 | 3300005591 | Soil | MNQPVESTSQSFVLLRLGERRFAVAAVQISELVAPSRIFRFPH |
| Ga0070763_101978903 | 3300005610 | Soil | MTVATELELQSFVLLRLGERRFAVAANQIAELVAPSRVFQF |
| Ga0068864_1025766743 | 3300005618 | Switchgrass Rhizosphere | MSPTTDTNDSFVLLRLGERRFAVAAGVISELVAPSRIFRFPHQTREVEG |
| Ga0066903_1031621503 | 3300005764 | Tropical Forest Soil | MNVSTELELKSFVLLRLGERRFAVAADDTAELVSPSRIFSFPHRTPGIEG |
| Ga0066788_101472521 | 3300005944 | Soil | MSPQTDSESFVLLRLAERRFAVAACDIAELVAPSRIFRFPHHTKEIEGVILRRGRI |
| Ga0066789_101108771 | 3300005994 | Soil | MSPQAESESFVLLRLAERRFAVSAGDIAELVAPSRIFRFPHHTKE |
| Ga0075019_103210653 | 3300006086 | Watersheds | MTVSLELELQSYVLLQLGEHRFAIAANQVAELVAPSRVFCFPHRTPNIEGVI |
| Ga0075019_104246161 | 3300006086 | Watersheds | MSLPVESESQSFVLMRLGERKFALAAEQIAELVAPSRVFRFPHQ |
| Ga0070765_1009825953 | 3300006176 | Soil | MTQPIESVSQSFVLLRLGERRFAVAAVQISELVAPSRIFRFPHRTPK |
| Ga0079222_100362031 | 3300006755 | Agricultural Soil | MTVSTDLELKSFVLLRLGERRFAVAADGTAELVAPSRVFRFPHKTEKIEGVI |
| Ga0075435_1010367331 | 3300007076 | Populus Rhizosphere | MTISTDLELKSFVLLRLGERRFAVAAEGTAELVAPSRLFRFPHNTAKIEGVILRRG |
| Ga0099794_105074712 | 3300007265 | Vadose Zone Soil | MTVSAELELQSFVLLRLGERRFAVPANQIAELVAPSRVFKFPHRTSQ |
| Ga0099827_115076681 | 3300009090 | Vadose Zone Soil | MTVATELDLQSFVLLRLGERRFAVAAKQIAELVAPSRVFRFPHRTPKL |
| Ga0099796_102365583 | 3300010159 | Vadose Zone Soil | MSPLNETDLQSFVLLRLGDRRFAVTATQIAELVAP |
| Ga0134084_100319291 | 3300010322 | Grasslands Soil | MTVSTELELQSFVLLRLGERRFAVSATQIAELVAPSRVFRFAHRTPKL |
| Ga0134064_104644452 | 3300010325 | Grasslands Soil | MTVSTELELQSFVLLRLGERRFAVSSNQIAELVAPSRVFRFPH |
| Ga0134062_103986801 | 3300010337 | Grasslands Soil | MTVSTELELQSFVLLRLGERRFAVSATQIAELVAPSRVF |
| Ga0134062_106924901 | 3300010337 | Grasslands Soil | MTIVAEIALESFVLLRLGERRFAVRARQIVELIAPSRVFRFPHNTTAVEGAI |
| Ga0126370_105375241 | 3300010358 | Tropical Forest Soil | MSLVAELALETFVLLRLGERRFALQADQIVELIAPSRVF |
| Ga0126379_134834042 | 3300010366 | Tropical Forest Soil | MSMVAEIALESFVLLRLGERRFALRASQIVELIAPSRVFRFPH |
| Ga0126381_1001507054 | 3300010376 | Tropical Forest Soil | MNVSTELELKSFVLLRLGERRFAVAADDTAELVSPS |
| Ga0126383_110272273 | 3300010398 | Tropical Forest Soil | MTVSTDLELKSFVLLRLGERRFAVAADGTAELVAP |
| Ga0134121_121474661 | 3300010401 | Terrestrial Soil | MTLAADSQLQSFVLLRLGERRFALAATDISGLVAPSRLFRFAHRTPEIEGVILRRGRI |
| Ga0126356_109595452 | 3300010877 | Boreal Forest Soil | MSPQPQSDSQSFVLLRLAERRFAVAATDIAELVAPSRIFRFPHHTKEIE |
| Ga0137392_101010964 | 3300011269 | Vadose Zone Soil | MTKSLELELQSFVLLRLGERRFAMSARQIAELVAPSR |
| Ga0137391_102137361 | 3300011270 | Vadose Zone Soil | MTVSAEIELQSFVLLRLGERRFAVSARQIAELVAPSRV |
| Ga0137391_104776341 | 3300011270 | Vadose Zone Soil | MTVAPETALQSFVLLRLGERRFALPASQVAELVAPSRIFRFPHKSP |
| Ga0137391_106109511 | 3300011270 | Vadose Zone Soil | MTLIADTELQSFVLLRLGDRRFALAAAQIAELVPPSRIFHFPNRTPEI |
| Ga0137393_104231683 | 3300011271 | Vadose Zone Soil | MTVSTELEVQSFVLLRLGERRFAVSASQIAELVAPSRVFRFPHRTPKLEG |
| Ga0137389_101298371 | 3300012096 | Vadose Zone Soil | MTVSAEIELQSFVLLRLGERRFAVSAKQIAELVAPSRVFRFPHH |
| Ga0137389_107457261 | 3300012096 | Vadose Zone Soil | MTVSAELELKSFVLLRLGERRFAVAADQTAELVAPSRVFR |
| Ga0137389_111696632 | 3300012096 | Vadose Zone Soil | MTLIAETELQSFVLLRLGDRRFALAANQIAELVPPS |
| Ga0137365_105084473 | 3300012201 | Vadose Zone Soil | MTPSPETVLQSFVLLRLGGRRFVLPASQVAELVAPSRIFRFPH |
| Ga0137363_100272981 | 3300012202 | Vadose Zone Soil | MTTAPETAQQSFVLLRLGERRFALPASQLAELVAPSRIFRFP |
| Ga0137399_101346604 | 3300012203 | Vadose Zone Soil | MTVSAELELQAFVLLRLGERRFAVPANQIAELVAPSRVF |
| Ga0137399_106311013 | 3300012203 | Vadose Zone Soil | MTSSPETVLQSFVLLRLGERRFALPASQVAELVAPSRIFRFPH |
| Ga0137399_116413122 | 3300012203 | Vadose Zone Soil | MTLVAEIALESFVLLRLGERRFAVRARQIVELIAPSRVFRF |
| Ga0137380_112851411 | 3300012206 | Vadose Zone Soil | MTASLELELQSFVLLRLGERRFAVSARQIAELVAPSRVFRFPHHTPKIEG |
| Ga0137376_109611502 | 3300012208 | Vadose Zone Soil | MTVSTELELQPFVLLRLGERRFAVSSNQIAELVAPSRVFRFPHRTPKLEGV |
| Ga0137376_117880122 | 3300012208 | Vadose Zone Soil | MTVSTELELQSFVLLRLGERRFAVSSNQIAELVAPSRVFRFPHRTP |
| Ga0137378_103466271 | 3300012210 | Vadose Zone Soil | MTVSTDLELKSFVLLRLGERRFAVAADGTAELVAPSRLFRFPHNTAKIEGVI |
| Ga0137387_102759241 | 3300012349 | Vadose Zone Soil | MSTMTVSSELELKSFVLLRLGERRFAVAADQTAELVAPSRVFRFPHKTPKIEGV |
| Ga0137387_110473101 | 3300012349 | Vadose Zone Soil | MTIVAEIALESFVLLRLGERRFAVRARQIVELIAPSRVFRFPHNTTGVEG |
| Ga0137360_100119811 | 3300012361 | Vadose Zone Soil | MTVSAELELQSFVLLRLGERRFAVSANQIAELVAPSRVFRFPHRT |
| Ga0137360_110868962 | 3300012361 | Vadose Zone Soil | MTLLNETDLQSFVLLRLGDRRFAVTATQIAELVAPSRVFRFPHHT |
| Ga0137361_103086501 | 3300012362 | Vadose Zone Soil | MTLFAETELQSFVLLRLGDRRFALAANQIAELVPPSRVFRFPHHTGE |
| Ga0137361_103765073 | 3300012362 | Vadose Zone Soil | MTVSTELELQSFVLLRLGERRFAISAKEIAELVAPS |
| Ga0137358_108403871 | 3300012582 | Vadose Zone Soil | MTVSAELELQSFVLLRLGERRFAISANQIAELVAPSRVF |
| Ga0137398_101328763 | 3300012683 | Vadose Zone Soil | MTLVAEIALESFVLLRLGERRFAVRARQIVELIAPT |
| Ga0137397_107184381 | 3300012685 | Vadose Zone Soil | MTLLNETDLQSFVLLRLGDRRFAVTATQIAELVAPSRVFRFPHHTSE |
| Ga0137396_101930823 | 3300012918 | Vadose Zone Soil | MTVATELDLQSFVLLRLGERRFAVAAKQIAELVAPSRVFRFP |
| Ga0137396_108555311 | 3300012918 | Vadose Zone Soil | MTLIDQTDLQSFVLLRLGDRRFAVTATQIAELVAPSR |
| Ga0137416_104982823 | 3300012927 | Vadose Zone Soil | MTVSTELELQSFVLLRLGERRFAVSANQIAELVAPSRVFRF |
| Ga0153915_119242822 | 3300012931 | Freshwater Wetlands | MNATLETGAQSFVLLRLGDRQFALPAERIGELVPASRV |
| Ga0157372_119197393 | 3300013307 | Corn Rhizosphere | MSPTTDTNDSFVLLRLGERRFAVAAGVISELVAPSRIFRFPHQTRE |
| Ga0167631_10620191 | 3300015168 | Glacier Forefield Soil | MTSRNDDGKQAFVLLRLGDRRFAMVSSQIAELVAPSRVFRFPHRTEN |
| Ga0137409_109186491 | 3300015245 | Vadose Zone Soil | MTVSAELELQSFVLLRLGERRFAVPAGQIAELVAPCRVFKFPHRT |
| Ga0182039_122031941 | 3300016422 | Soil | MITALESTQSFVLLRLGERRFALAASQVAELVAPSRIFRFPHKSPALEG |
| Ga0134069_12652971 | 3300017654 | Grasslands Soil | MTKSLELELQSFVLLRLGERRFAVSARQIAELVAPSRVFRF |
| Ga0187820_10012451 | 3300017924 | Freshwater Sediment | MTPAAELASQTFVLLRLGERRFAVLATQISELVAPSRIFRFPHRTAKLE |
| Ga0187879_105867032 | 3300017946 | Peatland | MSPQTDSESFVLLRLAERRFAVAAGDIAELVAPSRVFRFPHHTKEIEGVILRRG |
| Ga0187781_114015181 | 3300017972 | Tropical Peatland | MTVAAELELKSFVLLRLGERRFAVAAGQIAELVAPSRVFRFPH |
| Ga0187766_107063751 | 3300018058 | Tropical Peatland | MTHTSELGSQTFVLLRLGERRFAVAATQVAELAAPSR |
| Ga0066667_114663452 | 3300018433 | Grasslands Soil | MTVSVETGLQSFVLLRLGERRFALAAERIAELVPPSRVFRFPHR |
| Ga0066669_111517481 | 3300018482 | Grasslands Soil | MTLSTDLELKSFVLLRLGERRFAVAAVGTAELVAPSRVFRFPHKTPKI |
| Ga0193733_10813841 | 3300020022 | Soil | MTVSTELELQSFVLLRLGERRFAISAKEIAELVAP |
| Ga0179594_100311871 | 3300020170 | Vadose Zone Soil | MTVSAELELQSFVLLRLGERRFAVRAGQIAELVAPSR |
| Ga0210407_110175101 | 3300020579 | Soil | MTPLVESTLQSFVLLRLGERRFAVAAVQISELVSPSRIFRFPHR |
| Ga0210403_101264221 | 3300020580 | Soil | MIQPVESTSQSFVLLRLGERRFAVAAAQISELVAPS |
| Ga0210403_111067251 | 3300020580 | Soil | MTQPIESTSQSFVLLRLGERRFAVVAVQISELVAPSRIFRFPHRTPKL |
| Ga0210401_101595701 | 3300020583 | Soil | MNPRNEQGSQSFVLLRLGDRRFAMIASQIAELVAPSRVFRFPHRTENVE |
| Ga0215015_105986241 | 3300021046 | Soil | MSQPAESEAQSFVLLRLGERRFALAANQIAELVAP |
| Ga0210404_101519183 | 3300021088 | Soil | MTVATELELQSFVLLRLSERRFAVSANQIAELVAPSR |
| Ga0210406_100972764 | 3300021168 | Soil | MTVTVELELQSFVLLRLGERRFAVCANQIAELVAPSRVFQFPHRTSRI |
| Ga0210400_109118402 | 3300021170 | Soil | MNPRNEQGSQSFVLLRLGDRRFAMIASQIAELVAPSRVFRFPHRTEN |
| Ga0210405_107984432 | 3300021171 | Soil | MTQPVESTLQSFVLLRLGERRFAVAAVQISELVSPSRIFRFPHR |
| Ga0210405_113856901 | 3300021171 | Soil | MTLIAETDQQSFVLLRLGDRRFAVTATQIAELVAPS |
| Ga0210388_111505321 | 3300021181 | Soil | MSPQTQTDSESFVLLRLAERRFAVAAGDIAELVAPSRIFRFPHHTKEIE |
| Ga0210388_114218981 | 3300021181 | Soil | MSTQTDSESFVLLRLAERRFAVAAVDIAELVAPSRVFRFPHQTKEI |
| Ga0213873_103188681 | 3300021358 | Rhizosphere | MTSLPDSESFVLLRLSERRFAVAAGDIAELVAPSRVFRFPHQTKEVEG |
| Ga0210389_101833311 | 3300021404 | Soil | MTQPIESTSQSFVLLRLGERRFAVTAVQISELVAPSRIFR |
| Ga0210387_115663191 | 3300021405 | Soil | MTPIPETDVQSFVLLRLGDRRFAIMATQIAELVAP |
| Ga0210390_112171902 | 3300021474 | Soil | MNQPVESTSQSFVLLRLGERRFAVAAVQISELVAPSRIFRFPHRTPKLEGV |
| Ga0210402_102396823 | 3300021478 | Soil | MTVTVELELQSFVLLRLGERRFAVCANQIAELVAPSRVF |
| Ga0210402_117008621 | 3300021478 | Soil | MTLTTELELQPFVLLRLGDRRFALAASHIAELVAPSRIFRFPHRTLK |
| Ga0242665_100065644 | 3300022724 | Soil | MTVSAELELESFVLLRLGERRFAVAAAQIAELVAPSRVFRFPHRTP |
| Ga0224549_10312491 | 3300022840 | Soil | MTPPAESNAFVLLRLGERRFAVSASLIAELVPPGRIFRFPHRTKEIEGVILRR |
| Ga0137417_12668164 | 3300024330 | Vadose Zone Soil | MTLFAETELQSFVLLRLGDRRFAVTANQIAELVAPSRIFRFPHHT |
| Ga0207692_109932111 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | MTLIAETELQPFVLLRLGDRRFAVSANQIAELVAPSRVFRF |
| Ga0208907_1091411 | 3300026002 | Rice Paddy Soil | MNATLETGAQSFVLLRLGDRQFALPAERIGELVPAS |
| Ga0209234_10814293 | 3300026295 | Grasslands Soil | MTVSTELELQSFVLLRLGERRFAVSATQIAELVAPSRVFRFAHRTPKLE |
| Ga0209238_10326731 | 3300026301 | Grasslands Soil | MTVSTELELQSFVLLRLGERRFAISAKEIAELVAPSRVFRFPHRT |
| Ga0209239_11784973 | 3300026310 | Grasslands Soil | MTVSTELELQSFVLLRLGERRFAISAKEIAELVAPSRV |
| Ga0209268_10024409 | 3300026314 | Soil | MTVSTELELQSFVLLRLGERRFAVSATQIAELVAPSQVFRFPHRTS |
| Ga0209687_10824424 | 3300026322 | Soil | MTISSELELRPFVLLRLGERRFAVAADDTAELVSPSRVFSFPHRTPGIE |
| Ga0209375_12475022 | 3300026329 | Soil | MTVSTELELQSFVLLRLGERRFAVSANQIAELVAPS |
| Ga0257181_10736322 | 3300026499 | Soil | MTLIAESELQSFVLLRLGDRRFAVAAGQIAELVAPSRVFRFPHHTSEIEGVIL |
| Ga0257158_10802061 | 3300026515 | Soil | MTLLNETDLQSFVLLRLGDRRFAVTATQIAELVAPSRVFRFPHHTSEVEG |
| Ga0209690_12649941 | 3300026524 | Soil | MTVSAELELKPFVLLRLGERRFAVAADGIVELVPPSRVFRFPH |
| Ga0209059_10179994 | 3300026527 | Soil | MTVSTELELKSFVLLRLGERRFAVAADETAELVAPSRVFRF |
| Ga0209806_10277181 | 3300026529 | Soil | MTVSTELELKSFVLLRLGERRFAVAADETAELVAPSRVFRFPHRTPKIE |
| Ga0209160_10514561 | 3300026532 | Soil | MSLTAELGSEQFVLLRVGDRRFALCAERVGELAAPSRVFRFPHQTPEVEGVIL |
| Ga0209648_107482701 | 3300026551 | Grasslands Soil | MTAALETALQSFVLLRLGERRFALPALQVAELVAPSRVFRFPH |
| Ga0209648_108325602 | 3300026551 | Grasslands Soil | MTVSSASDLQSFVLLRLGERRFAISASQIAELVAP |
| Ga0179593_10733021 | 3300026555 | Vadose Zone Soil | MTHIDQTDLQSFVLLRLGDRRFAVTATQIAELVAPSRVFRFPHH |
| Ga0208241_10535842 | 3300027297 | Forest Soil | MTVSAELELQSFVLLRLGERRFAVSAGQIVELVAPSRVFRFPHHTPKIEG |
| Ga0209524_10799812 | 3300027521 | Forest Soil | MNPRNDLGSQSFVLLRLGDRRFAMIASQIAELVAPSRVFRFPHRTE |
| Ga0209734_10309903 | 3300027535 | Forest Soil | MTFIAEAELQSFVLLRLGDRRFALAASQIAELVAPSRIFH |
| Ga0209419_10923582 | 3300027537 | Forest Soil | MTVSTEPELQSFVLLRLGERRFAVSANQIAELVAPSRVFRFP |
| Ga0209220_12012612 | 3300027587 | Forest Soil | MNPRNDLGSQSFVLLRLGDRRFAMIASQIAELVAPSRVFRFPHRTERVEGV |
| Ga0209116_10325563 | 3300027590 | Forest Soil | MTPLPESESFVLLRLSERRFALAAGDIAELVAPSRIFRFPHQTKEVEGVVVRRG |
| Ga0209331_10490153 | 3300027603 | Forest Soil | MTLPLHPEGQALVLLRIGDRRFALFAWQIAELVAPSRIFRFPHRTAETEGVILRR |
| Ga0208988_10115124 | 3300027633 | Forest Soil | MNPRNDLGSQSFVLLRLGDRRFAMIASQIAELVAPSRVFRFPH |
| Ga0209076_10928913 | 3300027643 | Vadose Zone Soil | MTVSTELELQSFVLLRLGERRFAVSAKQIAELVAPSRV |
| Ga0208990_10535083 | 3300027663 | Forest Soil | MNPRNDLGSQSFVLLRLGDRRFAMIASQIAELVAP |
| Ga0209588_11198493 | 3300027671 | Vadose Zone Soil | MTLIAETELQSFVLLRLGDRRFAVTANQIAELVAPSRI |
| Ga0209011_11109762 | 3300027678 | Forest Soil | MTVMTETDLQSFVLLRLGERRFAVAATQIAELVAPSRVFRFPHRTTDIEGV |
| Ga0209447_100526353 | 3300027701 | Bog Forest Soil | MIQPAESTSQSFVLLRLGERRFAVAAVQISELVAPS |
| Ga0209447_100663973 | 3300027701 | Bog Forest Soil | MTAVAELELQSVVLLRLGDRRFAIAATEVSELVAPSRMFKFPHLTPQVE |
| Ga0209038_101887182 | 3300027737 | Bog Forest Soil | MTAVAELELQSVVLLRLGDRRFAIAATEVSELVAPSRMFKFP |
| Ga0208989_100514681 | 3300027738 | Forest Soil | MTRRDELGLQSFVLLRLGDRRFAMVSSHIAELVAPSRVFRFPH |
| Ga0209060_101680081 | 3300027826 | Surface Soil | MTLRAELEPQSFVLLRLGERRFAIAAGQVAELVAP |
| Ga0209180_103837563 | 3300027846 | Vadose Zone Soil | MTVSAELELLSFVLLRLGDRRFAVAAGQIAELVAPTRVFRFPHRTPKIE |
| Ga0209180_104603383 | 3300027846 | Vadose Zone Soil | MTISTVLELQSFVLLRLGERRFAVSANQIAELVAP |
| Ga0209180_104979892 | 3300027846 | Vadose Zone Soil | MSFSVETELQSFVLLRLGERRFAFAARQIAELVAPTRV |
| Ga0209693_102273061 | 3300027855 | Soil | MTVSAELELQSFVLLRLGERRFAVSASQIVELVAPSRVFRFPHH |
| Ga0209166_103302183 | 3300027857 | Surface Soil | VSVVAEIALESFVLLRLGERRFALNANQIVELIAPS |
| Ga0209701_104817021 | 3300027862 | Vadose Zone Soil | MTLIADTGLQSFVLLRLGDRRFALAAAQIAELVPPSRIFH |
| Ga0209380_101814613 | 3300027889 | Soil | MTQPVESTSQSFVLLRLGERRFAVAAVQISELVAPSRIFRFP |
| Ga0209380_107388181 | 3300027889 | Soil | MTQPVESTSQSFVLLRLGERRFAVAAVQISELVAPSRIFRFPHRTPKL |
| Ga0209067_105225342 | 3300027898 | Watersheds | MSLPVESESQSFVLMRLGERKFALAAEQIAELVAPSRVFRFPHQTPE |
| Ga0209006_100808241 | 3300027908 | Forest Soil | MNLRNEQGSQSFVLLRLGDRRFAMIASQIAELVAPSRVFRFPHRTENVE |
| Ga0209526_105988222 | 3300028047 | Forest Soil | MNPRNDLGSQSFVLLRLGDRRFAMLASQIAELVAPSRVFRFPHRTE |
| Ga0308309_108679073 | 3300028906 | Soil | MTQPVESTLQSFVLLRLGERRFAVAAVQISELVSPSRIFRFPHRTPKLEG |
| Ga0170834_1063324203 | 3300031057 | Forest Soil | MTAATETTQQSFVLLRLGERRFALQASQVAELVAPSRVFVFRTSLPRSKA |
| Ga0170834_1075714771 | 3300031057 | Forest Soil | MTVAAELDLQAFVLLRLGDRRFALAANQIAELVAPSRIFRFPHRT |
| Ga0170824_1227884433 | 3300031231 | Forest Soil | MTAATETTQQSFVLLRLGERRFALPASQVAELVAPSRVFVFRTSLPRSKA |
| Ga0170824_1285351841 | 3300031231 | Forest Soil | MTVAAELDLQAFVLLRLGDRRFALAANQIAELVAPSRIFR |
| Ga0170820_120285101 | 3300031446 | Forest Soil | MNPRNDLGSQSFVLLRLGDRRFAMIASQIAELVAPSRV |
| Ga0307476_112091952 | 3300031715 | Hardwood Forest Soil | MTVSAELELESFVLLRLGERRFAVAASQIAELVAPSRVFRFPHRT |
| Ga0307474_103458813 | 3300031718 | Hardwood Forest Soil | MSPQTDSESFVLLRLAERRFAVAAGDIAELVAPSRVFCFPHQTKE |
| Ga0307469_109034371 | 3300031720 | Hardwood Forest Soil | MTVSTELELQSFVLLRLGERRFAVSAKQIAELVAPSRVFR |
| Ga0307475_104694673 | 3300031754 | Hardwood Forest Soil | MSPHTDSESFVLLRLAERRFAVAASDIAELVAPSRIFRFPHHTKEIEGVI |
| Ga0307475_109874201 | 3300031754 | Hardwood Forest Soil | MTLIAETDLQSFVLLRLGDRRFAVAANQIAELVPPSRIFRFPHHTSEV |
| Ga0318509_106753422 | 3300031768 | Soil | MTAAPEIMQSFVLLRLGERRFAVAAAQVAELVAPSR |
| Ga0318529_102853103 | 3300031792 | Soil | MITALESTQSFVLLRLGERRFALAASQVAELVAPSRIFRFPHRSPALE |
| Ga0307473_104926131 | 3300031820 | Hardwood Forest Soil | MTLIADTELQSFVLLRLGDRRFALAAAQIAELVAPSRIFHFP |
| Ga0307478_110717312 | 3300031823 | Hardwood Forest Soil | MNPRNEQGSQSFVLLRLGDRRFAMIASQIAELVAPSRVFRFPHRTENVEGV |
| Ga0307479_100656704 | 3300031962 | Hardwood Forest Soil | MTLIAESELQSFVLLRLGDRRFAVAATQIAELVPPSRIFRFPHHTG |
| Ga0307479_103150963 | 3300031962 | Hardwood Forest Soil | MTLIAESELQSFVLLRLGDRRFAVAATQIAELVPP |
| Ga0307479_104243611 | 3300031962 | Hardwood Forest Soil | MTVSAEIELQSFVLLRLGERRFAVSAKQIAELVAPSRVFRFPHR |
| Ga0318533_100589701 | 3300032059 | Soil | MTVSTELELKSFVLLRLGERRFAVAADDTAELVSPSRVFSFPHRTLGIEGVIL |
| Ga0318524_106746712 | 3300032067 | Soil | MTAAPEIMQSFVLLRIGERRFAVAAAQVAELVAPSRIF |
| Ga0307471_1000092456 | 3300032180 | Hardwood Forest Soil | MTVSTELELQSFVLLRLGERRFAISAKEIAELVAPSRVFRFPHRTP |
| Ga0307471_1003327333 | 3300032180 | Hardwood Forest Soil | MTVSAELELQTFVLLRLGERRFAVSSGQIVELVAPSRVFRFP |
| Ga0307471_1027318951 | 3300032180 | Hardwood Forest Soil | MTAATETAQQSFVLLRLGERRFALPASQVAELVAPS |
| Ga0307472_1011544011 | 3300032205 | Hardwood Forest Soil | MTAATETAQQSFVLLRLGERRFALPASQVAELVAPSRVF |
| Ga0335080_102524611 | 3300032828 | Soil | MTVPAELDLQSFVLLRLGDRRFALAANHIAELVAPSRIFRFPHRTPKV |
| Ga0335076_110071581 | 3300032955 | Soil | VTQAADFTLQSFVLLRLGERRFAVAATQVSELAAPSRIFRFP |
| Ga0335084_122509952 | 3300033004 | Soil | MTTTATLTTELELQSFVLLRLGERRFALAARDIAELVAPSRVFR |
| Ga0335077_115625281 | 3300033158 | Soil | MNNSAEFGSQSFVLLRLGERRFAVAATQISELVAPSR |
| ⦗Top⦘ |