Metagenome Family F028818

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences

Select file to download:
Download

Overview

Basic Information
Family ID	F028818
Family Type	Metagenome
Number of Sequences	190
Average Sequence Length	45 residues
Representative Sequence	VKERWGGLGHLPKIALLRGEGFGLKSFGGEVVEGKKMLFHTFFEVLMVG
Number of Associated Samples	91
Number of Associated Scaffolds	189

Quality Assessment
Transcriptomic Evidence	No
Most common taxonomic group	Unclassified
% of genes with valid RBS motifs	5.26 %
% of genes near scaffold ends (potentially truncated)	35.26 %
% of genes from short scaffolds (< 2000 bps)	99.47 %
Associated GOLD sequencing projects	88
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.34

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign

Most Common Taxonomy
Group	Unclassified (94.211 % of family members)
NCBI Taxonomy ID	N/A
Taxonomy	N/A

Most Common Ecosystem
GOLD Ecosystem	Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Miscanthus Phyllosphere (82.105 % of family members)
Environment Ontology (ENVO)	Unclassified (85.263 % of family members)
Earth Microbiome Project Ontology (EMPO)	Host-associated → Plant → Plant surface (84.211 % of family members)

Multiple Sequence Alignments

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Select alignment to view:

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification:	Globular	Signal Peptide:	No	Secondary Structure distribution:	α-helix: 31.17% β-sheet: 0.00% Coil/Unstructured: 68.83%
Feature Viewer

Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.34
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.34
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

Gene Neighborhood

Neighboring Pfam domains

Pfam ID	Name	% Frequency in 189 Family Scaffolds
PF13963	Transpos_assoc	3.17
PF13456	RVT_3	0.53

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	94.21 %
All Organisms	root	All Organisms	5.79 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	94.21 %
cellular organisms	root	All Organisms → cellular organisms	5.79 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	94.21 %
Eukaryota	superkingdom	All Organisms → cellular organisms → Eukaryota	5.79 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	94.21 %
Viridiplantae	kingdom	All Organisms → cellular organisms → Eukaryota → Viridiplantae	5.79 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	94.21 %
Streptophyta	phylum	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta	5.79 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	94.21 %
Streptophytina	subphylum	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina	5.79 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	94.21 %
Embryophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	5.79 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	94.21 %
Tracheophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta	4.74 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	94.21 %
Euphyllophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta	4.74 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	94.21 %
Spermatophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta	4.74 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	94.21 %
Magnoliopsida	class	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida	4.74 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	94.21 %
Mesangiospermae	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae	4.74 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	94.21 %
Liliopsida	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida	4.74 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	94.21 %
Petrosaviidae	subclass	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae	4.74 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	94.21 %
commelinids	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids	4.74 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	94.21 %
Poales	order	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales	4.74 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	94.21 %
Poaceae	family	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	4.74 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	94.21 %
PACMAD clade	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade	4.21 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	94.21 %
Panicoideae	subfamily	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae	4.21 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	94.21 %
Andropogonodae	no rank	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae	3.68 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	94.21 %
Andropogoneae	tribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae	3.68 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	94.21 %
Sorghinae	subtribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae	2.63 %
Saccharinae	subtribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae	1.05 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	94.21 %
Sorghum	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum	2.63 %
Miscanthus	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Miscanthus	1.05 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	94.21 %
Sorghum bicolor	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor	2.63 %
Miscanthus lutarioriparius	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Miscanthus → Miscanthus lutarioriparius	1.05 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
3300005334\|Ga0068869_100368020	Not Available	1175	Open in IMG/M
3300005356\|Ga0070674_101838279	Not Available	550	Open in IMG/M
3300005459\|Ga0068867_100570932	Not Available	982	Open in IMG/M
3300005616\|Ga0068852_102401851	Not Available	548	Open in IMG/M
3300005718\|Ga0068866_11361417	Not Available	517	Open in IMG/M
3300005718\|Ga0068866_11403233	Not Available	510	Open in IMG/M
3300006358\|Ga0068871_102250988	Not Available	519	Open in IMG/M
3300006881\|Ga0068865_101868017	Not Available	543	Open in IMG/M
3300009098\|Ga0105245_12130278	Not Available	614	Open in IMG/M
3300009148\|Ga0105243_13103512	Not Available	503	Open in IMG/M
3300009176\|Ga0105242_12301668	Not Available	585	Open in IMG/M
3300009176\|Ga0105242_13070656	Not Available	517	Open in IMG/M
3300013296\|Ga0157374_11589064	Not Available	678	Open in IMG/M
3300013297\|Ga0157378_10363971	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor	1416	Open in IMG/M
3300013297\|Ga0157378_11208393	Not Available	795	Open in IMG/M
3300013297\|Ga0157378_11677316	Not Available	682	Open in IMG/M
3300013297\|Ga0157378_12013309	Not Available	627	Open in IMG/M
3300013297\|Ga0157378_12299027	Not Available	591	Open in IMG/M
3300013297\|Ga0157378_12842767	Not Available	536	Open in IMG/M
3300013308\|Ga0157375_12045759	Not Available	681	Open in IMG/M
3300014486\|Ga0182004_10128129	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	1015	Open in IMG/M
3300014969\|Ga0157376_11443399	Not Available	720	Open in IMG/M
3300014969\|Ga0157376_11820709	Not Available	645	Open in IMG/M
3300015267\|Ga0182122_1016524	Not Available	751	Open in IMG/M
3300015267\|Ga0182122_1034730	Not Available	618	Open in IMG/M
3300015267\|Ga0182122_1057923	Not Available	536	Open in IMG/M
3300015268\|Ga0182154_1010067	Not Available	858	Open in IMG/M
3300015268\|Ga0182154_1034454	Not Available	623	Open in IMG/M
3300015268\|Ga0182154_1049849	Not Available	563	Open in IMG/M
3300015269\|Ga0182113_1023378	Not Available	765	Open in IMG/M
3300015269\|Ga0182113_1045912	Not Available	632	Open in IMG/M
3300015274\|Ga0182188_1026466	Not Available	629	Open in IMG/M
3300015275\|Ga0182172_1028726	Not Available	665	Open in IMG/M
3300015275\|Ga0182172_1029924	Not Available	659	Open in IMG/M
3300015275\|Ga0182172_1066023	Not Available	526	Open in IMG/M
3300015276\|Ga0182170_1031231	Not Available	653	Open in IMG/M
3300015276\|Ga0182170_1034724	Not Available	634	Open in IMG/M
3300015276\|Ga0182170_1074972	Not Available	507	Open in IMG/M
3300015277\|Ga0182128_1036708	Not Available	629	Open in IMG/M
3300015279\|Ga0182174_1017700	Not Available	786	Open in IMG/M
3300015279\|Ga0182174_1045838	Not Available	607	Open in IMG/M
3300015279\|Ga0182174_1047063	Not Available	602	Open in IMG/M
3300015281\|Ga0182160_1005331	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor	1074	Open in IMG/M
3300015281\|Ga0182160_1066615	Not Available	539	Open in IMG/M
3300015282\|Ga0182124_1039585	Not Available	622	Open in IMG/M
3300015283\|Ga0182156_1071110	Not Available	536	Open in IMG/M
3300015285\|Ga0182186_1003491	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Miscanthus → Miscanthus lutarioriparius	1243	Open in IMG/M
3300015285\|Ga0182186_1019993	Not Available	757	Open in IMG/M
3300015286\|Ga0182176_1036067	Not Available	660	Open in IMG/M
3300015286\|Ga0182176_1054906	Not Available	579	Open in IMG/M
3300015286\|Ga0182176_1059738	Not Available	564	Open in IMG/M
3300015287\|Ga0182171_1039469	Not Available	637	Open in IMG/M
3300015289\|Ga0182138_1019808	Not Available	771	Open in IMG/M
3300015289\|Ga0182138_1055257	Not Available	580	Open in IMG/M
3300015289\|Ga0182138_1064943	Not Available	553	Open in IMG/M
3300015291\|Ga0182125_1033288	Not Available	682	Open in IMG/M
3300015291\|Ga0182125_1051250	Not Available	604	Open in IMG/M
3300015292\|Ga0182141_1052428	Not Available	599	Open in IMG/M
3300015292\|Ga0182141_1063742	Not Available	566	Open in IMG/M
3300015292\|Ga0182141_1064535	Not Available	564	Open in IMG/M
3300015292\|Ga0182141_1068743	Not Available	553	Open in IMG/M
3300015292\|Ga0182141_1075791	Not Available	537	Open in IMG/M
3300015294\|Ga0182126_1028931	Not Available	714	Open in IMG/M
3300015294\|Ga0182126_1049765	Not Available	612	Open in IMG/M
3300015294\|Ga0182126_1094501	Not Available	505	Open in IMG/M
3300015295\|Ga0182175_1093273	Not Available	511	Open in IMG/M
3300015296\|Ga0182157_1032718	Not Available	706	Open in IMG/M
3300015296\|Ga0182157_1037000	Not Available	682	Open in IMG/M
3300015298\|Ga0182106_1056083	Not Available	606	Open in IMG/M
3300015299\|Ga0182107_1022964	Not Available	786	Open in IMG/M
3300015299\|Ga0182107_1079555	Not Available	548	Open in IMG/M
3300015300\|Ga0182108_1047957	Not Available	642	Open in IMG/M
3300015300\|Ga0182108_1053321	Not Available	623	Open in IMG/M
3300015300\|Ga0182108_1095409	Not Available	520	Open in IMG/M
3300015302\|Ga0182143_1025128	Not Available	764	Open in IMG/M
3300015302\|Ga0182143_1063262	Not Available	587	Open in IMG/M
3300015302\|Ga0182143_1076313	Not Available	555	Open in IMG/M
3300015303\|Ga0182123_1005767	Not Available	1098	Open in IMG/M
3300015303\|Ga0182123_1065050	Not Available	569	Open in IMG/M
3300015303\|Ga0182123_1088768	Not Available	519	Open in IMG/M
3300015303\|Ga0182123_1091577	Not Available	514	Open in IMG/M
3300015303\|Ga0182123_1093542	Not Available	511	Open in IMG/M
3300015304\|Ga0182112_1072447	Not Available	565	Open in IMG/M
3300015305\|Ga0182158_1104381	Not Available	503	Open in IMG/M
3300015307\|Ga0182144_1014865	Not Available	898	Open in IMG/M
3300015307\|Ga0182144_1020020	Not Available	827	Open in IMG/M
3300015308\|Ga0182142_1040319	Not Available	691	Open in IMG/M
3300015308\|Ga0182142_1082068	Not Available	559	Open in IMG/M
3300015313\|Ga0182164_1045025	Not Available	759	Open in IMG/M
3300015313\|Ga0182164_1051491	Not Available	725	Open in IMG/M
3300015313\|Ga0182164_1051491	Not Available	725	Open in IMG/M
3300015314\|Ga0182140_1024354	Not Available	798	Open in IMG/M
3300015314\|Ga0182140_1104368	Not Available	520	Open in IMG/M
3300015321\|Ga0182127_1036832	Not Available	732	Open in IMG/M
3300015321\|Ga0182127_1073098	Not Available	597	Open in IMG/M
3300015322\|Ga0182110_1029943	Not Available	775	Open in IMG/M
3300015322\|Ga0182110_1062425	Not Available	625	Open in IMG/M
3300015322\|Ga0182110_1104422	Not Available	532	Open in IMG/M
3300015322\|Ga0182110_1109037	Not Available	524	Open in IMG/M
3300015323\|Ga0182129_1022841	Not Available	813	Open in IMG/M
3300015323\|Ga0182129_1036606	Not Available	710	Open in IMG/M
3300015323\|Ga0182129_1077052	Not Available	570	Open in IMG/M
3300015341\|Ga0182187_1063914	Not Available	753	Open in IMG/M
3300015341\|Ga0182187_1132620	Not Available	585	Open in IMG/M
3300015342\|Ga0182109_1026316	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	1079	Open in IMG/M
3300015342\|Ga0182109_1157401	Not Available	575	Open in IMG/M
3300015342\|Ga0182109_1158200	Not Available	574	Open in IMG/M
3300015342\|Ga0182109_1175419	Not Available	552	Open in IMG/M
3300015342\|Ga0182109_1179274	Not Available	547	Open in IMG/M
3300015342\|Ga0182109_1203257	Not Available	521	Open in IMG/M
3300015342\|Ga0182109_1212238	Not Available	512	Open in IMG/M
3300015343\|Ga0182155_1014148	Not Available	1272	Open in IMG/M
3300015343\|Ga0182155_1076689	Not Available	741	Open in IMG/M
3300015343\|Ga0182155_1080110	Not Available	731	Open in IMG/M
3300015343\|Ga0182155_1183318	Not Available	543	Open in IMG/M
3300015344\|Ga0182189_1147404	Not Available	595	Open in IMG/M
3300015345\|Ga0182111_1056464	Not Available	871	Open in IMG/M
3300015345\|Ga0182111_1111180	Not Available	681	Open in IMG/M
3300015345\|Ga0182111_1192844	Not Available	552	Open in IMG/M
3300015345\|Ga0182111_1225105	Not Available	519	Open in IMG/M
3300015345\|Ga0182111_1227039	Not Available	518	Open in IMG/M
3300015346\|Ga0182139_1024511	Not Available	1156	Open in IMG/M
3300015346\|Ga0182139_1141485	Not Available	623	Open in IMG/M
3300015346\|Ga0182139_1177775	Not Available	571	Open in IMG/M
3300015346\|Ga0182139_1178900	Not Available	569	Open in IMG/M
3300015346\|Ga0182139_1184707	Not Available	562	Open in IMG/M
3300015347\|Ga0182177_1031920	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	1070	Open in IMG/M
3300015347\|Ga0182177_1233223	Not Available	515	Open in IMG/M
3300015347\|Ga0182177_1246665	Not Available	504	Open in IMG/M
3300015351\|Ga0182161_1078617	Not Available	812	Open in IMG/M
3300015351\|Ga0182161_1115961	Not Available	700	Open in IMG/M
3300015351\|Ga0182161_1162151	Not Available	615	Open in IMG/M
3300015351\|Ga0182161_1213241	Not Available	551	Open in IMG/M
3300015355\|Ga0182159_1010589	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Miscanthus → Miscanthus lutarioriparius	1895	Open in IMG/M
3300015355\|Ga0182159_1033945	Not Available	1295	Open in IMG/M
3300015355\|Ga0182159_1233570	Not Available	601	Open in IMG/M
3300015355\|Ga0182159_1274992	Not Available	560	Open in IMG/M
3300015355\|Ga0182159_1333778	Not Available	514	Open in IMG/M
3300015361\|Ga0182145_1143292	Not Available	557	Open in IMG/M
3300015361\|Ga0182145_1195788	Not Available	501	Open in IMG/M
3300017404\|Ga0182203_1108448	Not Available	577	Open in IMG/M
3300017404\|Ga0182203_1117464	Not Available	562	Open in IMG/M
3300017404\|Ga0182203_1135774	Not Available	535	Open in IMG/M
3300017404\|Ga0182203_1146144	Not Available	522	Open in IMG/M
3300017407\|Ga0182220_1087253	Not Available	535	Open in IMG/M
3300017407\|Ga0182220_1089715	Not Available	531	Open in IMG/M
3300017409\|Ga0182204_1027797	Not Available	777	Open in IMG/M
3300017409\|Ga0182204_1062258	Not Available	614	Open in IMG/M
3300017410\|Ga0182207_1073235	Not Available	675	Open in IMG/M
3300017410\|Ga0182207_1122111	Not Available	571	Open in IMG/M
3300017411\|Ga0182208_1005772	Not Available	1254	Open in IMG/M
3300017413\|Ga0182222_1082962	Not Available	539	Open in IMG/M
3300017415\|Ga0182202_1045240	Not Available	717	Open in IMG/M
3300017415\|Ga0182202_1102282	Not Available	556	Open in IMG/M
3300017417\|Ga0182230_1095928	Not Available	545	Open in IMG/M
3300017420\|Ga0182228_1060885	Not Available	662	Open in IMG/M
3300017420\|Ga0182228_1074007	Not Available	616	Open in IMG/M
3300017424\|Ga0182219_1051333	Not Available	687	Open in IMG/M
3300017425\|Ga0182224_1066656	Not Available	672	Open in IMG/M
3300017425\|Ga0182224_1084409	Not Available	625	Open in IMG/M
3300017425\|Ga0182224_1105280	Not Available	583	Open in IMG/M
3300017425\|Ga0182224_1134142	Not Available	539	Open in IMG/M
3300017425\|Ga0182224_1149739	Not Available	519	Open in IMG/M
3300017430\|Ga0182192_1091423	Not Available	628	Open in IMG/M
3300017433\|Ga0182206_1018568	Not Available	977	Open in IMG/M
3300017433\|Ga0182206_1087297	Not Available	610	Open in IMG/M
3300017433\|Ga0182206_1114915	Not Available	559	Open in IMG/M
3300017433\|Ga0182206_1132114	Not Available	534	Open in IMG/M
3300017436\|Ga0182209_1046953	Not Available	762	Open in IMG/M
3300017442\|Ga0182221_1070905	Not Available	660	Open in IMG/M
3300017443\|Ga0182193_1158502	Not Available	543	Open in IMG/M
3300017443\|Ga0182193_1191833	Not Available	507	Open in IMG/M
3300017680\|Ga0182233_1038555	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor	840	Open in IMG/M
3300017680\|Ga0182233_1047575	Not Available	756	Open in IMG/M
3300017681\|Ga0182226_1104152	Not Available	537	Open in IMG/M
3300017682\|Ga0182229_1034384	Not Available	873	Open in IMG/M
3300017683\|Ga0182218_1090230	Not Available	593	Open in IMG/M
3300017683\|Ga0182218_1099955	Not Available	575	Open in IMG/M
3300017684\|Ga0182225_1006780	Not Available	1364	Open in IMG/M
3300017685\|Ga0182227_1115036	Not Available	535	Open in IMG/M
3300017686\|Ga0182205_1065504	Not Available	694	Open in IMG/M
3300017689\|Ga0182231_1105449	Not Available	546	Open in IMG/M
3300021060\|Ga0182232_1018228	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor	1225	Open in IMG/M
3300025901\|Ga0207688_10788593	Not Available	602	Open in IMG/M
3300025926\|Ga0207659_11430798	Not Available	592	Open in IMG/M
3300025927\|Ga0207687_10321420	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor	1253	Open in IMG/M
3300025935\|Ga0207709_10958450	Not Available	698	Open in IMG/M
3300025942\|Ga0207689_10337283	Not Available	1252	Open in IMG/M
3300026078\|Ga0207702_11796359	Not Available	605	Open in IMG/M
3300026121\|Ga0207683_10102082	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae	2561	Open in IMG/M

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:

Habitat	Taxonomy	Distribution
Host-Associated	Host-Associated	100.00%

Habitat	Taxonomy	Distribution
Plants	Host-Associated → Plants	100.00%

Habitat	Taxonomy	Distribution
Phyllosphere	Host-Associated → Plants → Phyllosphere	84.21%
Rhizosphere	Host-Associated → Plants → Rhizosphere	9.47%
Rhizoplane	Host-Associated → Plants → Rhizoplane	5.26%
Roots	Host-Associated → Plants → Roots	1.05%

Habitat	Taxonomy	Distribution
Unclassified	Host-Associated → Plants → Phyllosphere → Unclassified	84.21%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified	8.42%
Epiphytes	Host-Associated → Plants → Rhizoplane → Epiphytes	4.74%
Soil	Host-Associated → Plants → Rhizosphere → Soil	1.05%
Soil	Host-Associated → Plants → Rhizoplane → Soil	0.53%
Rhizosphere	Host-Associated → Plants → Roots → Rhizosphere	0.53%
Unclassified	Host-Associated → Plants → Roots → Unclassified	0.53%

Habitat	Taxonomy	Distribution
Unclassified	Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified	84.21%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified	8.42%
Unclassified	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified	4.74%
Unclassified	Host-Associated → Plants → Rhizosphere → Soil → Unclassified	1.05%
Unclassified	Host-Associated → Plants → Rhizoplane → Soil → Unclassified	0.53%
Soil	Host-Associated → Plants → Roots → Rhizosphere → Soil	0.53%
Unclassified	Host-Associated → Plants → Roots → Unclassified → Unclassified	0.53%

Habitat	Taxonomy	Distribution
Miscanthus Phyllosphere	Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Miscanthus Phyllosphere	82.11%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	5.26%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere	3.16%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	3.16%
Switchgrass Phyllosphere	Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Switchgrass Phyllosphere	1.58%
Corn Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere	1.05%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere	1.05%
Corn, Switchgrass And Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere	0.53%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere	0.53%
Miscanthus Rhizosphere	Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere	0.53%
Root	Host-Associated → Plants → Roots → Unclassified → Unclassified → Root	0.53%
Phyllosphere	Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Phyllosphere	0.53%

Visualization

Powered by ApexCharts

Associated Samples

Taxon OID	Sample Name	Habitat Type	IMG/M Link
3300005334	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2	Host-Associated	Open in IMG/M
3300005356	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG	Host-Associated	Open in IMG/M
3300005459	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2	Host-Associated	Open in IMG/M
3300005616	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2	Host-Associated	Open in IMG/M
3300005718	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2	Host-Associated	Open in IMG/M
3300006358	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2	Host-Associated	Open in IMG/M
3300006881	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2	Host-Associated	Open in IMG/M
3300009098	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG	Host-Associated	Open in IMG/M
3300009148	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG	Host-Associated	Open in IMG/M
3300009176	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG	Host-Associated	Open in IMG/M
3300013296	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG	Host-Associated	Open in IMG/M
3300013297	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG	Host-Associated	Open in IMG/M
3300013308	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG	Host-Associated	Open in IMG/M
3300014486	Endophyte microbial communities from Sorghum bicolor roots, Mead, Nebraska, USA - 072115-40_1 MetaG	Host-Associated	Open in IMG/M
3300014969	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG	Host-Associated	Open in IMG/M
3300015267	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015268	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015269	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015274	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015275	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015276	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015277	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015279	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015281	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015282	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015283	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015285	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015286	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015287	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015289	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015291	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015292	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015294	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015295	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015296	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015298	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015299	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015300	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015302	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015303	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015304	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015305	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015307	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015308	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015313	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015314	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015321	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015322	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015323	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015341	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015342	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015343	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015344	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015345	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015346	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015347	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015351	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015355	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015361	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300017404	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017407	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300017409	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017410	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017411	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017413	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300017415	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017417	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_07NOV2016_LD1 MG	Host-Associated	Open in IMG/M
3300017420	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_07NOV2016_LD1 MG	Host-Associated	Open in IMG/M
3300017424	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300017425	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300017430	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300017433	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017436	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017442	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300017443	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300017680	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_07NOV2016_LD1 MG	Host-Associated	Open in IMG/M
3300017681	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_07NOV2016_LD1 MG	Host-Associated	Open in IMG/M
3300017682	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_07NOV2016_LD1 MG	Host-Associated	Open in IMG/M
3300017683	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300017684	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300017685	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_07NOV2016_LD1 MG	Host-Associated	Open in IMG/M
3300017686	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017689	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_07NOV2016_LD1 MG	Host-Associated	Open in IMG/M
3300021060	Phyllosphere microbial comminities from miscanthus, Michigan, USA - G6R3_NF_07NOV2016_LD2 MG	Host-Associated	Open in IMG/M
3300025901	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes)	Host-Associated	Open in IMG/M
3300025926	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025927	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025935	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025942	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes)	Host-Associated	Open in IMG/M
3300026078	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes)	Host-Associated	Open in IMG/M
3300026121	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes)	Host-Associated	Open in IMG/M

Geographical Distribution

Zoom:	Powered by OpenStreetMap

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
Ga0068869_1003680202	3300005334	Miscanthus Rhizosphere	VKESWGGLGHLPKIALLRGEGFGLKSFGGEVVEGKKMLFHTFF*
Ga0070674_1018382791	3300005356	Miscanthus Rhizosphere	SSGHSLQPVKERWGGLGHLPKIALLRGEGFGLKSFGGEVVEGKKMLFHTFFEVLMVG*
Ga0068867_1005709321	3300005459	Miscanthus Rhizosphere	VKERWGGLGHLPKIALLRGEGFGLKSFGGEVVEGKKMLFHTFF*
Ga0068852_1024018511	3300005616	Corn Rhizosphere	SLQPMKESWGGLGHLPKIALLRGEGFGLKSFGGEVVEGKKMLFHTFFEVLMVG*
Ga0068866_113614171	3300005718	Miscanthus Rhizosphere	GLGHLPKIALLRGEGFGLKSFGGEVIEGKKMLFHTFF*
Ga0068866_114032332	3300005718	Miscanthus Rhizosphere	PMKERWGGLGHLPKIALLRGEGFGLKSFGGEVVEGKKMLFHTFFEVLMVG*
Ga0068871_1022509882	3300006358	Miscanthus Rhizosphere	WGGLGHLPKIALLRGEGFGLKSFGGEVIEGKKMLFHTFF*
Ga0068865_1018680171	3300006881	Miscanthus Rhizosphere	VKERWGGLGHLPKIALLRGEGFGLKSFGGEVVEGKKMLFHTFFEVLMVG*
Ga0105245_121302782	3300009098	Miscanthus Rhizosphere	VKERWGGLGHLPKIALLRGKGFNLKSFGGEVVEGKKMLFHTFFEVLMVG*
Ga0105243_131035121	3300009148	Miscanthus Rhizosphere	PKIALQRRKGFGLKSFGREVVEYKKMLFYIFLKF*
Ga0105242_123016682	3300009176	Miscanthus Rhizosphere	LGTSLGHLQKIALLRGEGFGLKSFGGEVVEGKKMIFHTFFVVLMVG*
Ga0105242_130706561	3300009176	Miscanthus Rhizosphere	VKERWGGLGHLPKIALLRGEGFGLKSFGGKVVEDKKMLFHTFFEVLLVG*
Ga0157374_115890641	3300013296	Miscanthus Rhizosphere	VKESWGGLGHLPKIALLRGEGFGLKSFGGEVVEGKKMLFHTFFEVLMVD*
Ga0157378_103639712	3300013297	Miscanthus Rhizosphere	LQPVKERWGGLGHLQKIALLRGKGFDLKYFGGEVVEGKKMLFQLFN*
Ga0157378_112083931	3300013297	Miscanthus Rhizosphere	VKERWGGLGHLQKIALLRGEGFGLKSFGGDVVEGKKMLFHTFLKVLMVG*
Ga0157378_116773161	3300013297	Miscanthus Rhizosphere	LGGLGHLPKIAPLREEGFGLKSFVGEVVEGKKMLFHTFLMF*
Ga0157378_120133091	3300013297	Miscanthus Rhizosphere	HLPKIALIRGEDFGLKSFVGDVVEGKKILFHIFFEVLMVG*
Ga0157378_122990272	3300013297	Miscanthus Rhizosphere	HLPKIALLRGEGFGLKSFGGEVVEGKKMLFHTFF*
Ga0157378_128427671	3300013297	Miscanthus Rhizosphere	VKEKWGGFGHLPKIALLIGEDFGLKSFGREVVEGKKKLFHTFFLKF*
Ga0157375_120457591	3300013308	Miscanthus Rhizosphere	VKERWGGLGHLSKIALLRGEGFGLKSFGGEVVEGKKILFHTFFEVLMVG*
Ga0182004_101281291	3300014486	Root	MLGGLGHLLKIALVRGGGFGLKNYHGELGKGKKILFQHFN*
Ga0157376_114433991	3300014969	Miscanthus Rhizosphere	VKERWGGFGHLPKIALLRGEGFGLKSFGGEVIEGKKILFHTFF*
Ga0157376_118207092	3300014969	Miscanthus Rhizosphere	VKERWGGLGHLPKIALLRGEGFGLKSFGGEVVEGKKMLFHTFFEVLMVD*
Ga0182122_10165241	3300015267	Miscanthus Phyllosphere	MGGLRYLPKIALLRGEGFGLKSFGGDVVNGKKMLFHTFCK
Ga0182122_10347301	3300015267	Miscanthus Phyllosphere	VKERWGGLGHLPKIAVLRGEGFGLKSFDGEVVEGKKMLFH
Ga0182122_10579231	3300015267	Miscanthus Phyllosphere	VKERWRGLGHISKIALLRGKGFDLKSFGREVVEGKKMLFHTF
Ga0182154_10100672	3300015268	Miscanthus Phyllosphere	VKKRWGGLRHLPKIVLLRGKGFGLKSFGGEVVEGKK
Ga0182154_10344541	3300015268	Miscanthus Phyllosphere	MKERWGGLGHLPKIALLKGEGFGLKSFGGEVVEGKKMLFHTFFKF*
Ga0182154_10498491	3300015268	Miscanthus Phyllosphere	VEKRWGGLGHLSKIALLRREGFGLKSFGVEVVECKKMLFHIFFEV
Ga0182113_10233782	3300015269	Miscanthus Phyllosphere	VKERWGGLGHIPKIALLRGEGFGLKSFGGEVVEGK
Ga0182113_10459121	3300015269	Miscanthus Phyllosphere	MKERRGDLGHLPKIALLRGEGFGLKSFGGEVVEGKKMLFYTFFKVLMVG*
Ga0182188_10264661	3300015274	Miscanthus Phyllosphere	VKERWGGLGHLPKIAQLRRKILVSNPLVEVVEGEKMLFHTFFEVLMVD*
Ga0182172_10287261	3300015275	Miscanthus Phyllosphere	MWGGLGHLPKIALLRSKGEGFGLKSFGGEVVNGKKILFHTLF*
Ga0182172_10299242	3300015275	Miscanthus Phyllosphere	VKESWGGLGHLPKIALLRGEGFGLKSFGGEVVEGKKILFHTFF*
Ga0182172_10660231	3300015275	Miscanthus Phyllosphere	MWGGLGHLPKIALLRGKGFGLKSFGGEVIDGKKMLFHTFFKF*
Ga0182170_10312311	3300015276	Miscanthus Phyllosphere	VKESWGGLGHLPKIALLRGKGFGLKSFGGEVVEGKKILFHTFFEVLMVD*
Ga0182170_10347241	3300015276	Miscanthus Phyllosphere	VKERWGDLGHLPKIALLRKKGFGLKSFGGEVVEDKKMLFHIFFEVLMVG*
Ga0182170_10749722	3300015276	Miscanthus Phyllosphere	VKKRLGGLGYLQKIAPLRGEGFGPKSFGGEVVEGKKILFHTFF*
Ga0182128_10367081	3300015277	Miscanthus Phyllosphere	MKERWGGLCHLPKIALLREKGFGLKSFGGEVVEGKKMLFHTFFE
Ga0182174_10177001	3300015279	Miscanthus Phyllosphere	GHLPKIALLRGKGFGLNSFGGEVVEGKKMLFHTFFL*
Ga0182174_10458381	3300015279	Miscanthus Phyllosphere	MKERWGGLGHLPKIALLRVGGFDLKSFGGEVVEGTKMLFHTFFEVLMVG*
Ga0182174_10470631	3300015279	Miscanthus Phyllosphere	VKERWGGLEHLPKIVLQRGEGFGLKSFGGEVVECKKMLFHTFLKVLMVG*
Ga0182160_10053312	3300015281	Miscanthus Phyllosphere	VKERWGGLGHLPKIALLRGEDFGLKSFGGEVVEGKKMLFHTFF*
Ga0182160_10666151	3300015281	Miscanthus Phyllosphere	RWGGLGHLPKIALLRGEGFGLKSFGGEVVEGKKMLFHTFF*
Ga0182124_10395852	3300015282	Miscanthus Phyllosphere	VKERWGGLGHLPKIALLRGKCFGLKSFGGEVVEGKKMLFHTFFEVLMVG*
Ga0182156_10711102	3300015283	Miscanthus Phyllosphere	GLGHLPKIALLRGEGFGLKSFGGEVVEGKKMLFHTFF*
Ga0182186_10034912	3300015285	Miscanthus Phyllosphere	VKESWGGLGHLPKIALLREEGFGLKSFGGEVVEGKKMLFHTFFLKF*
Ga0182186_10199931	3300015285	Miscanthus Phyllosphere	VKERWGGLGHLPKIARLRGEGFGLKSFGGEVVEGKKMLFQIFFEVLMID*
Ga0182176_10360671	3300015286	Miscanthus Phyllosphere	VKDRWGGLGHLPKIALLRGEGFGLKSFGGEVVEGKKMLFQTFFEVLMDG*
Ga0182176_10549061	3300015286	Miscanthus Phyllosphere	VKERWRGLGHLPKIALLRGKGFGLKSFGAEVVDGKKMLFHTFFEVLMV
Ga0182176_10597381	3300015286	Miscanthus Phyllosphere	VKERWGGLGHLPKIALLRGEGFGLKFFGGEVVEDKKMLFQTFF*
Ga0182171_10394691	3300015287	Miscanthus Phyllosphere	VLLYPYAHLPKIALLREEGFGLKSFGGEVVEGKKMLFHTFFEVLMVD*
Ga0182138_10198081	3300015289	Miscanthus Phyllosphere	VKESWGGLGHLPKIALLMGEGFGLKSFGGEVVEGKKMLFHTFFEVLMVGQ*
Ga0182138_10552571	3300015289	Miscanthus Phyllosphere	MKERWGGLGHLLKIALLRGEGFGLKSFGGEVVEGKKMLFHTFFEVLMVG*
Ga0182138_10649431	3300015289	Miscanthus Phyllosphere	MWGGLGHLPKIALLRDEGFGLKFFGGEVVQDKKMLFHTFFEVLMIG*
Ga0182125_10332881	3300015291	Miscanthus Phyllosphere	MKERWRGLGHLPKITLLRGKGFGLKSFGGEVVDGKKMVFHTFFEVLMVG*
Ga0182125_10512501	3300015291	Miscanthus Phyllosphere	VKERWGGHGHLPKIALLRREGFDLKSFGEEVVEGKKILFHIFLKF*
Ga0182141_10524281	3300015292	Miscanthus Phyllosphere	MKERWGGLGHLPKIALLRGEGFGLKSFGGEVVEGKKMLFHTFF*
Ga0182141_10637421	3300015292	Miscanthus Phyllosphere	VKERWEGLGHLPKIALLRGEGFDFKSFGGEVVEGKKMLFHTFLKF*
Ga0182141_10645351	3300015292	Miscanthus Phyllosphere	HSFQPEQKRLGGLGLLPKIAQLRVRGFDLKYSGGEVVQGKKMLFQAFI*
Ga0182141_10687431	3300015292	Miscanthus Phyllosphere	VKKRWGGLGHLPKIALLRGEGFGLKSFGGEVIEDKKILFHTFFEVLMVD*
Ga0182141_10757911	3300015292	Miscanthus Phyllosphere	VKQRWRDLRHLPKIALLRGEGFGLKSFGGEIVEGKKMLFHTFFEVLMVG*
Ga0182126_10289311	3300015294	Miscanthus Phyllosphere	MKERWGGLGHLPKIALLRGEGFGLISFGGDVVDGKKMLFHTFFEVLMVG*
Ga0182126_10497651	3300015294	Miscanthus Phyllosphere	MKERWGGLGHLPKIALLRGEDFGLKSFGGEVVEGKKMLFHTFFEVLMVG*
Ga0182126_10945011	3300015294	Miscanthus Phyllosphere	VKERWGGLGHLPKIALLRGKGFGLKSFGGEVVEGKKMLFHTFFEVLMVG*
Ga0182175_10932731	3300015295	Miscanthus Phyllosphere	VKERWGGLGHLSKIALLREKGFGLKSFGGEVVEGKKMLFHTFFEVLMVG*
Ga0182157_10327182	3300015296	Miscanthus Phyllosphere	VKERWRGLGHLPKIALLRREGFALKSFGGEVVEGKKILFHIFFEVLMVG*
Ga0182157_10370002	3300015296	Miscanthus Phyllosphere	VKERWGGLGHLPKITLLRGEGLKSFGGEVVEGKKMLFHTFFEVLMVDW*
Ga0182106_10560831	3300015298	Miscanthus Phyllosphere	VKERWEGLGHLPKIALLREKCFNLKSFGGEVVEGKKMLFHTFFEVLMVG*
Ga0182107_10229641	3300015299	Miscanthus Phyllosphere	VKERWEGLGHLPKIVLLRGKCFGLKSFSGEVVEDKKMLFHTF
Ga0182107_10795551	3300015299	Miscanthus Phyllosphere	VKESWRGLGHLPKIALLRGEGFGLKSFGGEVVEGKKMLFHT
Ga0182108_10479571	3300015300	Miscanthus Phyllosphere	VKERWGGLGHLLKIALLRGEGFGLKSFGGEVVEGKKMLFHTFFEVLMVG*
Ga0182108_10533211	3300015300	Miscanthus Phyllosphere	VKEMWGGLGHLLKIALLRGKCFGLKSFGGEVVEGKKIIFHTFFEFLMAG*
Ga0182108_10954091	3300015300	Miscanthus Phyllosphere	MKERWGGLGHLPKIALIRGEGFDLKSFGGEVVEGKKMLFHIFF*
Ga0182143_10251283	3300015302	Miscanthus Phyllosphere	GGLGHLPKIALLRGEGFGLKSFGGEVVEGKKMLFHTFF*
Ga0182143_10632621	3300015302	Miscanthus Phyllosphere	VKESWRGLGHLPKIALLRGEGFGLKSFGGEVVEGKKMLF
Ga0182143_10763131	3300015302	Miscanthus Phyllosphere	VLLYPYAHLPKIALLREEGFGLKSFGGEVVEGKKILFHTFFEVLMVG*
Ga0182123_10057671	3300015303	Miscanthus Phyllosphere	RLWDFPKIALLRGKGFGLKSFGGEVVEDKKMLFHIFLKVLMVGQ*
Ga0182123_10650501	3300015303	Miscanthus Phyllosphere	VKERWGGLGHLSKIALLRGKGFDLKSFGREVVEGKKMLFHTLFEVLMVG*
Ga0182123_10887681	3300015303	Miscanthus Phyllosphere	MKERWGGLEHLPKIALLRGKGFGLKSFSGEVVEGKKMIFHIFL
Ga0182123_10915771	3300015303	Miscanthus Phyllosphere	VKERWRGLEHLLKIALLRGKGFGLKSFGGEVVKGKKMLFHT
Ga0182123_10935421	3300015303	Miscanthus Phyllosphere	VGGLGHLPKIAILRGKGFGLKFFGGEVLECKKMIFHTFFEVLMVS*
Ga0182112_10724471	3300015304	Miscanthus Phyllosphere	LGGLGHPPKIALLRGEGFGLKSFSGEVVEVNKMLFHTFLKVLMVG*
Ga0182158_11043811	3300015305	Miscanthus Phyllosphere	VKERWGGLGHLPKIVLLRGKGFGLKSFGGEVVEGKKMLFHFFLKFS
Ga0182144_10148651	3300015307	Miscanthus Phyllosphere	VKERWGGLGHLPKIALLRGEDFGLKSFGGEVVEGKKMLFHIFFEVLMFG*
Ga0182144_10200201	3300015307	Miscanthus Phyllosphere	VKERCGDVGHIPKIALLRGEDFGLRSFGGEVVEGKKILFHTFFNF*
Ga0182142_10403191	3300015308	Miscanthus Phyllosphere	MKERWGGLGHLLKIVLLRGEGFGLKSFGGEVVEGKKMLFHTFFFEVLMVG*
Ga0182142_10820681	3300015308	Miscanthus Phyllosphere	VKERWGGLGHLPKIALLRGEGFVLKSFCGEVVEGKKMLFQIFFEVLMVG*
Ga0182164_10450252	3300015313	Switchgrass Phyllosphere	KERWGGLGHLPKIALLRGEGFGLKSFGGEVVEGKKMLFHTFF*
Ga0182164_10514911	3300015313	Switchgrass Phyllosphere	VKERWGGLGHLPKIALLRREGFGLKSFGGEVVEGKKMLF
Ga0182164_10514912	3300015313	Switchgrass Phyllosphere	MKERWGGLGHLPKIALLRGEGFGLKSFGGEVVEGKKMLLHTFF*
Ga0182140_10243542	3300015314	Miscanthus Phyllosphere	VKERWGGLGHLPKIALLRGKGFGLKSFGGEVVEGKKMLFHTFF*
Ga0182140_11043681	3300015314	Miscanthus Phyllosphere	VKERWGGLRHLPKIVLLRGKGFGLKSFGGEVVEGKKMLFYTFLKF*
Ga0182127_10368322	3300015321	Miscanthus Phyllosphere	LGGLGLLPKNCSTKRGGFDLNSFGGEVVEGKKMLFQLFN*
Ga0182127_10730982	3300015321	Miscanthus Phyllosphere	MKERWGGLEHLIKIALLREEGFNLKSFSGEVVEGK
Ga0182110_10299431	3300015322	Miscanthus Phyllosphere	VKKRWGCLKHLPKIALLREKGFGLKSFGGEVVEGKKMLFHTFFKVLMVG*
Ga0182110_10624252	3300015322	Miscanthus Phyllosphere	LGHLPKIALLRGKYFGLKFFGGEVVDGKKMLFHTFF*
Ga0182110_11044221	3300015322	Miscanthus Phyllosphere	VKERWGGLRHLLKIALLSGEGFGLKSFGGEVVEGKKMLFHTFFEVLMVG*
Ga0182110_11090371	3300015322	Miscanthus Phyllosphere	VKERWRGLGHLPKIVLLREKGFGLKSFGGEVVDGKKMLFHTFFKVLMVG*
Ga0182129_10228411	3300015323	Miscanthus Phyllosphere	VKESWGGLGHLPKIALLRGEGFGLKSFGGEVIEGKKMLFHTFF*
Ga0182129_10366061	3300015323	Miscanthus Phyllosphere	VKERWGGLEHLPKIAILRGEDFGLKSFGGEVVEGKKMLFHIFFEVLMFG*
Ga0182129_10770521	3300015323	Miscanthus Phyllosphere	VKERWGGLGHLPKIALLRGEGFGLKSFGGEVVEGKKMLFHTFFKF*
Ga0182187_10639141	3300015341	Miscanthus Phyllosphere	MWGGLGHLPKIALLREEGFDLKSFGGEVVEGKKILFHIFLKF*
Ga0182187_11326201	3300015341	Miscanthus Phyllosphere	VKERWGGLEHLLKIALLRGNGFGLKCFGGEVVEGKKMIFHTFFEVLMVCQ*
Ga0182109_10263161	3300015342	Miscanthus Phyllosphere	VKERWGGLGHLPKIALLRGEGFGLKSFGGEVVEGKKML
Ga0182109_11574011	3300015342	Miscanthus Phyllosphere	VKARWRGLGHLPKIALLWGEGFGLKSFGGEVVEGKAMIFHTFFEVLMVG*
Ga0182109_11582001	3300015342	Miscanthus Phyllosphere	VKERWGGLEHLLKIALLRGEGFGLKIFGGEVVEGKKMLFHIFLSFNGWLVSN*
Ga0182109_11754191	3300015342	Miscanthus Phyllosphere	VHLPKIALLRGEGFGLKYFGGEVVEGKKMLFPIFFEVLMVG*
Ga0182109_11792741	3300015342	Miscanthus Phyllosphere	KKGLEGLGHLLKITLLRGEDFDLKSFGGEVVEDKKMLFHTFL*
Ga0182109_12032571	3300015342	Miscanthus Phyllosphere	VKERWGGLGHLLKIALLREIGFGLKSFGGEVVEGKKMIFHTFFEVLMVG*
Ga0182109_12122381	3300015342	Miscanthus Phyllosphere	VKERWGGPGHLPKFALLRGEGFGLKSFGGEVVNGKKMIFHTFFKVLMVD*
Ga0182155_10141482	3300015343	Miscanthus Phyllosphere	VKERWGGLGHLLKIALLRREGFGLKFFGEEVVEGKKMLFHTFFEVLMVG*
Ga0182155_10766891	3300015343	Miscanthus Phyllosphere	GGLGHIPKIALLRVGGFALKSFGEEVVEGKKILFHISF*
Ga0182155_10801101	3300015343	Miscanthus Phyllosphere	VKERWGGLGHLPKIALLRGEGFGLKSFGEEVVEGKKMLFHIFLK
Ga0182155_11833181	3300015343	Miscanthus Phyllosphere	VKERWGGLGHLPKIALLRGKGFDLKSFGGEVVEGKKMLFHIFLKF*
Ga0182189_11474041	3300015344	Miscanthus Phyllosphere	GLGHLLKIALLREECFGLKSFGGEVVEGKKMLFHTFFEVLMVC*
Ga0182111_10564641	3300015345	Miscanthus Phyllosphere	MKERSRGLGHLLKIALLRGKDFGLKFFGGEVVEGKKMLFHFFLKF*
Ga0182111_11111801	3300015345	Miscanthus Phyllosphere	LGGLGHLRGEGFGVKSFGGEVVEGKKMLFHTFFKVLMVG*
Ga0182111_11928442	3300015345	Miscanthus Phyllosphere	VKERWGGLGHLSKIALLRGEGFGFKSFDGEVVEGKK
Ga0182111_12251051	3300015345	Miscanthus Phyllosphere	VKERWGGLGHLPKIALLRGGGFGIKSFGGEVVDGKKILFHTFFEVLIVG*
Ga0182111_12270391	3300015345	Miscanthus Phyllosphere	MKERWGGLRHLPKIALLREEDFGLKSFGGEVVEGKKMLFHTFFLKF*
Ga0182139_10245111	3300015346	Miscanthus Phyllosphere	VKERWGGLEHLLKIALLRGKDFGLKSFGGEVVEGKKILFHTFF
Ga0182139_11414851	3300015346	Miscanthus Phyllosphere	LGGLGHLPKIALLRGEGFGLKSFSGEVVEVNKMLFHTFLKVLMVG*
Ga0182139_11777751	3300015346	Miscanthus Phyllosphere	VKEMWGGLGHLSKIGLLGEEDFSLKSFGGEIIKGKKCYSTFFEALMVG*
Ga0182139_11789001	3300015346	Miscanthus Phyllosphere	MHLSKIALLREEYFGLKSFGGEVVEGKKNAIPHFFEVLMVG
Ga0182139_11847071	3300015346	Miscanthus Phyllosphere	MKERLGGLGHLLKIALLRGKGLGLKSFGEEVVEGKKMIFHIFFEVLMVG*
Ga0182177_10319202	3300015347	Miscanthus Phyllosphere	VKERWGYLEHLSKISLLRGEGFGLKSFGGEVVEGKKMLFH
Ga0182177_12332232	3300015347	Miscanthus Phyllosphere	VKKRWGSLEHLPKIALLRAEGFGRKSFGGEVVKDKKMLFYTFFEVLMVG*
Ga0182177_12466651	3300015347	Miscanthus Phyllosphere	VKERWGGLGHLPKFALLRGEGFGLKSFGGEVVDGK
Ga0182161_10786171	3300015351	Miscanthus Phyllosphere	VKERWGGFGHLLKIALLRGKGFGLKSFGREVVEGKKMLIPHFFEVLMVG*
Ga0182161_11159611	3300015351	Miscanthus Phyllosphere	VKERWEGLGHLLKIALLRGKGFGLKSFGGEVVESKKMLFRTFFEVLMVG*
Ga0182161_11621511	3300015351	Miscanthus Phyllosphere	LGGLGHLPKIALLRGEGFGLKSFSGEVVEGKKMLFHILFEVLMVG*
Ga0182161_12132411	3300015351	Miscanthus Phyllosphere	VKERWEGLGRLSKIDLLRREGFGLKSFGGEVVEGKKMLFHTFFDVLMVG*
Ga0182159_10105891	3300015355	Miscanthus Phyllosphere	VKERWRGLGHLPKIALLRGEGFGLKSFGGEVVEGKKMLFHTFFEVLMVG*
Ga0182159_10339451	3300015355	Miscanthus Phyllosphere	VKERCGDIGHIPKIALLRGEDFGLRSFGGEVVEGKKILFH
Ga0182159_12335701	3300015355	Miscanthus Phyllosphere	SLQPVKERWGGLGHLPKIALLMGEGFGLKSFGGEVVEGKKMLFHTFLKF*
Ga0182159_12749921	3300015355	Miscanthus Phyllosphere	MKERWGGLGHLPKIALLTGKGFGLKSYGGEVVEGKKMLFHTFLKF*
Ga0182159_13337781	3300015355	Miscanthus Phyllosphere	LGHSLQPIKERRGGLGHLPKIALLREKGFGLKSFGREVVEGKKMLVSE*
Ga0182145_11432922	3300015361	Miscanthus Phyllosphere	VKERWGGLGHLSKIALLRGEGFGFKSFDGEVVEGKKMLFHTFFEVLMVG*
Ga0182145_11957881	3300015361	Miscanthus Phyllosphere	LGGLRHLPKIALLRVGGFGLKFFGGEVVEGKKMLFYIFFEVLMVG*
Ga0182203_11084481	3300017404	Miscanthus Phyllosphere	VKERWGGLGHLLKIALLRGEGFGLKSFGGEIVEGKKMLFHTFF
Ga0182203_11174641	3300017404	Miscanthus Phyllosphere	VKERWRGLGHLPKIALLRREGFALKSFGGEVVEGKKMLFHTFFELLMIG
Ga0182203_11357741	3300017404	Miscanthus Phyllosphere	VKERWGGLGHLPKIALLREEGFGLKSFGEEVVEGKKMLFHTFF
Ga0182203_11461441	3300017404	Miscanthus Phyllosphere	VKERWGGLGHLLKIALLRGEGFGLKSFGGEVVEGKKMIFHTFFEVLMVG
Ga0182220_10872531	3300017407	Miscanthus Phyllosphere	VKERWGGLGHFPKIALLRGKGFGLKSFGGEVREGKKMLFHTFFEVLMVD
Ga0182220_10897151	3300017407	Miscanthus Phyllosphere	VKERWGGLGHLPKIALLRGEGFGLKSFGGEVVEGKKMLFHTFFEV
Ga0182204_10277971	3300017409	Miscanthus Phyllosphere	LGGIGHLPKIALLRGEGFGLKSFGGEVVEGKKMLFYTFFEVLMVG
Ga0182204_10622581	3300017409	Miscanthus Phyllosphere	VKERWRGFGHLSKIALLRGEGFDLKSFGGEVVEGKKILFHTFFEVLMVG
Ga0182207_10732351	3300017410	Miscanthus Phyllosphere	VKERWGGLGHLPKIVLLRGEGFGVKSFGGEVVEGKKILFHTFF
Ga0182207_11221111	3300017410	Miscanthus Phyllosphere	GLGHLPKIALLRGEGFGLKSFGGEVVEGKKMLFHIFFEVLMVG
Ga0182208_10057722	3300017411	Miscanthus Phyllosphere	VKERWGGLGHLPKIALLRGKDFYLKSFGEEVVEGKKMLFHTFFKVLMVG
Ga0182222_10829621	3300017413	Miscanthus Phyllosphere	VKERWGGLRHLPKIALLGGEGFGLKSFGGEVVQGKKMLFHIFFKVLMVG
Ga0182202_10452401	3300017415	Miscanthus Phyllosphere	VKKRWGGLGHLSKIALLRGEGFGLKSFGGEVVEGKKMLFQTFFEVLM
Ga0182202_11022821	3300017415	Miscanthus Phyllosphere	VKERWGCLGHLPKIALLRREDFGLKSFGGEIVKGKK
Ga0182230_10959281	3300017417	Miscanthus Phyllosphere	LQPVKERWGGLGHLPKIALLRGKDFYLKSFGEEVVEGKKMLFHTFFKVLMVG
Ga0182228_10608851	3300017420	Miscanthus Phyllosphere	HLPKIALLRGEGFGLKSFGGEVVEGKKMLFHTFFEVLMVG
Ga0182228_10740071	3300017420	Miscanthus Phyllosphere	MKESWGGLGHLPKIALLRGEGFGLKSFGGEVVEGKKMLFH
Ga0182219_10513331	3300017424	Miscanthus Phyllosphere	MKERWGGLGHLPKIALLREEGFGLKFFGGEVVEGKKMLFHTFF
Ga0182224_10666561	3300017425	Miscanthus Phyllosphere	VKERWGGLGHLPKIALLRGEGFGLKSFGGDVVEGK
Ga0182224_10844091	3300017425	Miscanthus Phyllosphere	VKEKWGGLGHLPKIALLRGEGFGLKSFGGEVVDGKKMLFHIF
Ga0182224_11052801	3300017425	Miscanthus Phyllosphere	VKQRWGGLGHLPKIALLRGEDFGLKSFGGEVVEGKKMLFHTFLKF
Ga0182224_11341421	3300017425	Miscanthus Phyllosphere	MKERWGGLGHLPKIALLRGKGFGLKSFGGEVVEGKKMLFHFFLKF
Ga0182224_11497391	3300017425	Miscanthus Phyllosphere	VKERWGDLGHLPKIVLLRGEDFGLKSFGGEVVEGKKNAIPYFFEVLMVG
Ga0182192_10914231	3300017430	Miscanthus Phyllosphere	MKERLRGLRHLPKIALLRGEGFGLKSFGGEVVEGKKMLFQTFFEVLMVG
Ga0182206_10185682	3300017433	Miscanthus Phyllosphere	VKESWGGLGHLPKIALLRGEGFGLKSFGGEVVEGKKILFHTFF
Ga0182206_10872971	3300017433	Miscanthus Phyllosphere	MWGGLGHLPKIALLRRKGFGFKSFGGEVVEGKKMLLHIFFKVLMVG
Ga0182206_11149151	3300017433	Miscanthus Phyllosphere	MKERYGGLRHLSKIALLRGEGFGLKSFGGEVVEGKKM
Ga0182206_11321141	3300017433	Miscanthus Phyllosphere	VKERCGGLGHLPKIALLKGEGFGLKSFGGEVVEGKKMLFHTFFKF
Ga0182209_10469531	3300017436	Miscanthus Phyllosphere	VKERWGGIGHLPKIALLREEGFGLKSFDGEVVEGKKMPCHTFFKVLMVV
Ga0182221_10709051	3300017442	Miscanthus Phyllosphere	VKERWGGLGYLPKIALIRREGFGLKSFSGEVVKDKKMLFHTFFKVLMVG
Ga0182193_11585021	3300017443	Miscanthus Phyllosphere	MKERCGGLGHLPKIALLRREGFGLKSFGGEVVEGKKMLFHTFFKVLMVG
Ga0182193_11918331	3300017443	Miscanthus Phyllosphere	VKERWGGLGHLSKIALLREEGFGLKSFGGEVVEGKKMIFHTFFEVLMID
Ga0182233_10385551	3300017680	Miscanthus Phyllosphere	VKERWGGLGHLPKIALLRGEGFGLKSFGGDVVEGKKMVFHTFFLKF
Ga0182233_10475752	3300017680	Miscanthus Phyllosphere	VKERWGGLEHLPKIALLRGEGFGLKSFGGEVVEGKQNAIPHFFFE
Ga0182226_11041522	3300017681	Miscanthus Phyllosphere	VKERWGGLGHLSKIALLREEDFGLKSFGGEVVEDKKI
Ga0182229_10343841	3300017682	Miscanthus Phyllosphere	VKESWGGLGHLPKIALLRGEGFGLKFFGGEVVEGKKMLFHTFFLKF
Ga0182218_10902301	3300017683	Miscanthus Phyllosphere	MKERWGGLGHLPKIALLRGEGFGLKFFGGEVVEGKKMLCHIFFKVLMVG
Ga0182218_10999551	3300017683	Miscanthus Phyllosphere	MKERWGGLEHLSKIALLRGERFGLKSFGGEVVEGKKMLFHNFF
Ga0182225_10067801	3300017684	Miscanthus Phyllosphere	VKERWGGLGHLPKIALLRGEGFGLKSFGGEVVEGKKMLFHTFFEVLMVG
Ga0182227_11150361	3300017685	Miscanthus Phyllosphere	VKERWGGFGHLPKIALLKVRGFDLKSFDGEVVEGRKWLFYFFFEVLMVG
Ga0182205_10655042	3300017686	Miscanthus Phyllosphere	MKERWGGFGHLPKITLLRREGFGLKSFGGEVVEGKKMIFHTFFEVLMVG
Ga0182231_11054491	3300017689	Miscanthus Phyllosphere	RWGGLGHLPKIALLRGEGFGLKSFGGEVVEGKKMLFQTFFEVLMVG
Ga0182232_10182281	3300021060	Phyllosphere	GHLPKIALLRGEGFGLKSFGGEVVEGKKMLFHTFF
Ga0207688_107885932	3300025901	Corn, Switchgrass And Miscanthus Rhizosphere	VTERWGGLGHLPKIALLRGEGFCLKSFGGEVVEGKKMLFQAFFEVLMVG
Ga0207659_114307981	3300025926	Miscanthus Rhizosphere	VKERWGGLGHLPKIALLRGEGFGLKSFDGEVVEDKKMLFHTFFEVLIVG
Ga0207687_103214201	3300025927	Miscanthus Rhizosphere	VKERWGGLGHLPKIALLRGEGFGLKSFGGEVVEGKKMLFHTFFLKF
Ga0207709_109584501	3300025935	Miscanthus Rhizosphere	RKLGRLTHLPKIVLLRGEGFGLKSFGGEVVEGKKMLFHTFF
Ga0207689_103372831	3300025942	Miscanthus Rhizosphere	VKESWGGLGHLPKIALLRGEGFGLKSFGGEVVEGKKMLFHTFF
Ga0207702_117963591	3300026078	Corn Rhizosphere	VKERWGGLGHLPKIALLRGEGFGLKSFGGEVVEGKKMLFHTFLKVLMVG
Ga0207683_101020824	3300026121	Miscanthus Rhizosphere	VKQRWGGLGHIPKIALLRGEGFDLKSFGGEVVEGKKMLFHTFFEVLMVG

Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

Metagenome Family F028818

Overview

Multiple Sequence Alignments

Structure & Topology

Predicted Secondary Structure and Topology

Predicted 3D Structure

Low Quality Model:

Gene Neighborhood

Neighboring Pfam domains

Phylogeny

NCBI Taxonomy

Associated Scaffolds

Environmental Properties

Associated Habitat Types

Associated Samples

Family Sequences