NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F028795

Metagenome / Metatranscriptome Family F028795

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F028795
Family Type Metagenome / Metatranscriptome
Number of Sequences 190
Average Sequence Length 42 residues
Representative Sequence YVPRDVAPELAGDEQAVSLWRVEGGLRVLIVPADAWVGRPR
Number of Associated Samples 161
Number of Associated Scaffolds 190

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 2.11 %
% of genes near scaffold ends (potentially truncated) 97.37 %
% of genes from short scaffolds (< 2000 bps) 94.74 %
Associated GOLD sequencing projects 158
AlphaFold2 3D model prediction Yes
3D model pTM-score0.56

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (99.474 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil
(19.474 % of family members)
Environment Ontology (ENVO) Unclassified
(24.211 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(48.421 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 0.00%    β-sheet: 20.29%    Coil/Unstructured: 79.71%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.56
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 190 Family Scaffolds
PF02817E3_binding 54.21
PF00364Biotin_lipoyl 12.63
PF13302Acetyltransf_3 10.00
PF06475Glycolipid_bind 8.42
PF00583Acetyltransf_1 2.11
PF03069FmdA_AmdA 1.05
PF02780Transketolase_C 1.05
PF00085Thioredoxin 1.05
PF07452CHRD 1.05
PF13374TPR_10 1.05
PF03572Peptidase_S41 0.53
PF12688TPR_5 0.53
PF13277YmdB 0.53
PF00196GerE 0.53
PF04973NMN_transporter 0.53
PF01663Phosphodiest 0.53
PF04138GtrA 0.53
PF02673BacA 0.53

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 190 Family Scaffolds
COG0508Pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide acyltransferase (E2) componentEnergy production and conversion [C] 54.21
COG3554Uncharacterized conserved proteinFunction unknown [S] 8.42
COG2421Acetamidase/formamidaseEnergy production and conversion [C] 1.05
COG0793C-terminal processing protease CtpA/Prc, contains a PDZ domainPosttranslational modification, protein turnover, chaperones [O] 0.53
COG1968Undecaprenyl pyrophosphate phosphataseLipid transport and metabolism [I] 0.53
COG3201Nicotinamide riboside transporter PnuCCoenzyme transport and metabolism [H] 0.53


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms99.47 %
UnclassifiedrootN/A0.53 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000550|F24TB_12917017All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia670Open in IMG/M
3300003987|Ga0055471_10091227All Organisms → cellular organisms → Bacteria883Open in IMG/M
3300004114|Ga0062593_102063159All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Frankiales → Frankiaceae635Open in IMG/M
3300004153|Ga0063455_101390963All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria541Open in IMG/M
3300005171|Ga0066677_10793617All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria524Open in IMG/M
3300005172|Ga0066683_10880163All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria514Open in IMG/M
3300005343|Ga0070687_101311233All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium538Open in IMG/M
3300005444|Ga0070694_100828827All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium760Open in IMG/M
3300005455|Ga0070663_100283665All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria1320Open in IMG/M
3300005554|Ga0066661_10939417All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria506Open in IMG/M
3300005556|Ga0066707_10714076All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria627Open in IMG/M
3300005558|Ga0066698_10852600All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia586Open in IMG/M
3300005577|Ga0068857_100532656All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1105Open in IMG/M
3300005578|Ga0068854_102075488All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium525Open in IMG/M
3300005587|Ga0066654_10207696All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1020Open in IMG/M
3300005614|Ga0068856_102367328All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria539Open in IMG/M
3300005713|Ga0066905_101216662All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium674Open in IMG/M
3300005764|Ga0066903_103578368All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria837Open in IMG/M
3300005764|Ga0066903_104941181All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria708Open in IMG/M
3300005834|Ga0068851_10489847All Organisms → cellular organisms → Bacteria736Open in IMG/M
3300005840|Ga0068870_10295380All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1021Open in IMG/M
3300005843|Ga0068860_102060801All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium592Open in IMG/M
3300005937|Ga0081455_10007552All Organisms → cellular organisms → Bacteria11433Open in IMG/M
3300005937|Ga0081455_10395316All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria961Open in IMG/M
3300005981|Ga0081538_10337879All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria547Open in IMG/M
3300005985|Ga0081539_10316093All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria666Open in IMG/M
3300006046|Ga0066652_100477700All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1153Open in IMG/M
3300006046|Ga0066652_100671931All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria984Open in IMG/M
3300006046|Ga0066652_100850423All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria872Open in IMG/M
3300006058|Ga0075432_10201946All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria787Open in IMG/M
3300006578|Ga0074059_12102451All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria619Open in IMG/M
3300006581|Ga0074048_10011024All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1156Open in IMG/M
3300006581|Ga0074048_10011821All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria808Open in IMG/M
3300006605|Ga0074057_10039824All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria590Open in IMG/M
3300006844|Ga0075428_101809482All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria636Open in IMG/M
3300006852|Ga0075433_10006819All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria9053Open in IMG/M
3300006854|Ga0075425_100962103All Organisms → cellular organisms → Bacteria975Open in IMG/M
3300006854|Ga0075425_101610162All Organisms → cellular organisms → Bacteria732Open in IMG/M
3300006880|Ga0075429_101762395All Organisms → cellular organisms → Bacteria537Open in IMG/M
3300006953|Ga0074063_10059812All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium726Open in IMG/M
3300006954|Ga0079219_10340673All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria956Open in IMG/M
3300009011|Ga0105251_10658191All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria501Open in IMG/M
3300009012|Ga0066710_104903762All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria501Open in IMG/M
3300009038|Ga0099829_10916537All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria727Open in IMG/M
3300009098|Ga0105245_13039310All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria520Open in IMG/M
3300009137|Ga0066709_101923269All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria822Open in IMG/M
3300009137|Ga0066709_103307597All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria586Open in IMG/M
3300009137|Ga0066709_103542035All Organisms → cellular organisms → Bacteria → Elusimicrobia → Elusimicrobia566Open in IMG/M
3300009177|Ga0105248_12895796All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria547Open in IMG/M
3300009789|Ga0126307_11615045All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria527Open in IMG/M
3300009823|Ga0105078_1063203All Organisms → cellular organisms → Bacteria → Terrabacteria group512Open in IMG/M
3300009840|Ga0126313_10022600All Organisms → cellular organisms → Bacteria4206Open in IMG/M
3300009840|Ga0126313_10130082All Organisms → cellular organisms → Bacteria1883Open in IMG/M
3300009840|Ga0126313_10558373All Organisms → cellular organisms → Bacteria920Open in IMG/M
3300009840|Ga0126313_10630386Not Available865Open in IMG/M
3300009840|Ga0126313_11181718All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria630Open in IMG/M
3300010036|Ga0126305_10114074All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1640Open in IMG/M
3300010038|Ga0126315_10017388All Organisms → cellular organisms → Bacteria3547Open in IMG/M
3300010041|Ga0126312_10861647All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria659Open in IMG/M
3300010042|Ga0126314_10371400All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1028Open in IMG/M
3300010044|Ga0126310_11065932All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria641Open in IMG/M
3300010045|Ga0126311_11232442All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium620Open in IMG/M
3300010362|Ga0126377_12925806All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia551Open in IMG/M
3300010371|Ga0134125_11226166All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria819Open in IMG/M
3300010375|Ga0105239_10626538All Organisms → cellular organisms → Bacteria1228Open in IMG/M
3300010375|Ga0105239_12597404All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria591Open in IMG/M
3300010397|Ga0134124_12694108All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria540Open in IMG/M
3300011119|Ga0105246_10526976All Organisms → cellular organisms → Bacteria1008Open in IMG/M
3300012092|Ga0136621_1399002All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria530Open in IMG/M
3300012094|Ga0136638_10627435All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria517Open in IMG/M
3300012350|Ga0137372_10024031All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia5667Open in IMG/M
3300012350|Ga0137372_10126155All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium2116Open in IMG/M
3300012355|Ga0137369_11041785All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria539Open in IMG/M
3300012358|Ga0137368_10854006All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium559Open in IMG/M
3300012359|Ga0137385_11669913All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria501Open in IMG/M
3300012529|Ga0136630_1049883All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1577Open in IMG/M
3300012680|Ga0136612_10005569All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei6050Open in IMG/M
3300012680|Ga0136612_10325785All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium780Open in IMG/M
3300012682|Ga0136611_10925129All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria518Open in IMG/M
3300012899|Ga0157299_10213331All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria590Open in IMG/M
3300012908|Ga0157286_10316951All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria576Open in IMG/M
3300012955|Ga0164298_10170987All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium 70-91242Open in IMG/M
3300012957|Ga0164303_10264932All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria993Open in IMG/M
3300012958|Ga0164299_10064552All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1771Open in IMG/M
3300012961|Ga0164302_10555407All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium823Open in IMG/M
3300012976|Ga0134076_10345714All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria653Open in IMG/M
3300012984|Ga0164309_11903473All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria510Open in IMG/M
3300012985|Ga0164308_10210761All Organisms → cellular organisms → Bacteria1488Open in IMG/M
3300012985|Ga0164308_11130409All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria703Open in IMG/M
3300012988|Ga0164306_10074423All Organisms → cellular organisms → Bacteria2140Open in IMG/M
3300012988|Ga0164306_12029400All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria500Open in IMG/M
3300013306|Ga0163162_12679633All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria574Open in IMG/M
3300014150|Ga0134081_10393937All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria518Open in IMG/M
3300014497|Ga0182008_10404934All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria734Open in IMG/M
3300014497|Ga0182008_10918726All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium516Open in IMG/M
3300014497|Ga0182008_10929452All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium514Open in IMG/M
3300015077|Ga0173483_10723167All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria565Open in IMG/M
3300015358|Ga0134089_10264192All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria707Open in IMG/M
3300015373|Ga0132257_104381706All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria514Open in IMG/M
3300017959|Ga0187779_10200722All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1248Open in IMG/M
3300017965|Ga0190266_10116531All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1133Open in IMG/M
3300017997|Ga0184610_1081945All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1001Open in IMG/M
3300018027|Ga0184605_10053912All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1716Open in IMG/M
3300018052|Ga0184638_1185343All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium737Open in IMG/M
3300018053|Ga0184626_10114167All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales → Bacillaceae → Geobacillus → unclassified Geobacillus → Geobacillus sp. WSUCF11146Open in IMG/M
3300018071|Ga0184618_10130781All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1011Open in IMG/M
3300018073|Ga0184624_10096342All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales → Bacillaceae → Geobacillus → unclassified Geobacillus → Geobacillus sp. WSUCF11261Open in IMG/M
3300018073|Ga0184624_10238149All Organisms → cellular organisms → Bacteria815Open in IMG/M
3300018073|Ga0184624_10239616All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria813Open in IMG/M
3300018074|Ga0184640_10436095All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria585Open in IMG/M
3300018422|Ga0190265_11993750All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria686Open in IMG/M
3300019867|Ga0193704_1017118All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1472Open in IMG/M
3300019884|Ga0193741_1096090All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria758Open in IMG/M
3300020020|Ga0193738_1156372All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria605Open in IMG/M
3300020081|Ga0206354_10524147All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium543Open in IMG/M
3300021078|Ga0210381_10200381All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria696Open in IMG/M
3300021080|Ga0210382_10337491All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria665Open in IMG/M
3300024178|Ga0247694_1003210All Organisms → cellular organisms → Bacteria2452Open in IMG/M
3300025898|Ga0207692_10399937All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria856Open in IMG/M
3300025901|Ga0207688_10424076All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium827Open in IMG/M
3300025907|Ga0207645_10394401All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria930Open in IMG/M
3300025908|Ga0207643_10244717All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1103Open in IMG/M
3300025915|Ga0207693_10300457All Organisms → cellular organisms → Bacteria1258Open in IMG/M
3300025922|Ga0207646_10589284All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria998Open in IMG/M
3300025927|Ga0207687_10582297All Organisms → cellular organisms → Bacteria942Open in IMG/M
3300025928|Ga0207700_11531768All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria591Open in IMG/M
3300025929|Ga0207664_10365945All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1278Open in IMG/M
3300025929|Ga0207664_11401330All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium620Open in IMG/M
3300025931|Ga0207644_10465493All Organisms → cellular organisms → Bacteria1040Open in IMG/M
3300025939|Ga0207665_10385992All Organisms → cellular organisms → Bacteria1064Open in IMG/M
3300025939|Ga0207665_10670026All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria814Open in IMG/M
3300025944|Ga0207661_11192406All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium701Open in IMG/M
3300025945|Ga0207679_11489998All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium621Open in IMG/M
3300025949|Ga0207667_11951755All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Propionibacteriaceae548Open in IMG/M
3300025961|Ga0207712_10139424All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1859Open in IMG/M
3300025981|Ga0207640_10939664All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria757Open in IMG/M
3300026023|Ga0207677_11375509All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria650Open in IMG/M
3300026095|Ga0207676_12180017All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium552Open in IMG/M
3300026285|Ga0209438_1167440All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria578Open in IMG/M
3300026301|Ga0209238_1282550All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria500Open in IMG/M
3300026306|Ga0209468_1061439All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1265Open in IMG/M
3300026326|Ga0209801_1103437All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1231Open in IMG/M
3300028589|Ga0247818_10805943All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria656Open in IMG/M
3300028589|Ga0247818_11210787All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium540Open in IMG/M
3300028597|Ga0247820_10901565All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria627Open in IMG/M
3300028704|Ga0307321_1085679All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria628Open in IMG/M
3300028708|Ga0307295_10123444All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria708Open in IMG/M
3300028717|Ga0307298_10261228All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria515Open in IMG/M
3300028721|Ga0307315_10147422All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria713Open in IMG/M
3300028755|Ga0307316_10367520All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria530Open in IMG/M
3300028768|Ga0307280_10317666All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria570Open in IMG/M
3300028778|Ga0307288_10489369All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria508Open in IMG/M
3300028787|Ga0307323_10314252All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria562Open in IMG/M
3300028791|Ga0307290_10101071All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1051Open in IMG/M
3300028796|Ga0307287_10015919All Organisms → cellular organisms → Bacteria2577Open in IMG/M
3300028800|Ga0265338_10801822All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria645Open in IMG/M
3300028811|Ga0307292_10343612All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria629Open in IMG/M
3300028812|Ga0247825_10654550All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria754Open in IMG/M
3300028812|Ga0247825_10974354All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria616Open in IMG/M
3300028814|Ga0307302_10456326All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria633Open in IMG/M
3300028875|Ga0307289_10367112All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium592Open in IMG/M
3300028876|Ga0307286_10134261All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria881Open in IMG/M
3300028876|Ga0307286_10186951All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria749Open in IMG/M
3300028876|Ga0307286_10318281All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium577Open in IMG/M
3300028878|Ga0307278_10341870All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria660Open in IMG/M
3300028884|Ga0307308_10212782All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria926Open in IMG/M
3300030336|Ga0247826_11675374All Organisms → cellular organisms → Bacteria519Open in IMG/M
3300030336|Ga0247826_11721333All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium512Open in IMG/M
3300030619|Ga0268386_10467271All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium871Open in IMG/M
3300031152|Ga0307501_10056563All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria893Open in IMG/M
3300031229|Ga0299913_10234150All Organisms → cellular organisms → Bacteria1819Open in IMG/M
3300031736|Ga0318501_10813775All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium518Open in IMG/M
3300031769|Ga0318526_10281296All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium681Open in IMG/M
3300031821|Ga0318567_10314885All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria883Open in IMG/M
3300031824|Ga0307413_10544011All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria941Open in IMG/M
3300031846|Ga0318512_10512161All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium609Open in IMG/M
3300031892|Ga0310893_10550901All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria523Open in IMG/M
3300031903|Ga0307407_10639604All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria796Open in IMG/M
3300031939|Ga0308174_10815224All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria785Open in IMG/M
3300031939|Ga0308174_11053264All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium691Open in IMG/M
3300032010|Ga0318569_10560053All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium532Open in IMG/M
3300032039|Ga0318559_10401332All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium639Open in IMG/M
3300032054|Ga0318570_10379618All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium644Open in IMG/M
3300032089|Ga0318525_10133470All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1272Open in IMG/M
3300032126|Ga0307415_101698229All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Frankiales → Frankiaceae609Open in IMG/M
3300032897|Ga0335071_10191383All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1999Open in IMG/M
3300033004|Ga0335084_11089200All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria802Open in IMG/M
3300033551|Ga0247830_11240019All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria596Open in IMG/M
3300034176|Ga0364931_0249941All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria583Open in IMG/M
3300034384|Ga0372946_0103094All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium 70-91338Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil19.47%
Serpentine SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil6.32%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil5.79%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil5.26%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil5.26%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment4.74%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere3.68%
Polar Desert SandEnvironmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand3.16%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil3.16%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil3.16%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere3.16%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere3.16%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil2.63%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil1.58%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil1.58%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil1.58%
Tabebuia Heterophylla RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere1.58%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere1.58%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere1.58%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere1.58%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere1.58%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere1.58%
Groundwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment1.05%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil1.05%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil1.05%
Agricultural SoilEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil1.05%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere1.05%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere1.05%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere1.05%
Natural And Restored WetlandsEnvironmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands0.53%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil0.53%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere0.53%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil0.53%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil0.53%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil0.53%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland0.53%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere0.53%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere0.53%
Groundwater SandEnvironmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand0.53%
SedimentEnvironmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment0.53%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere0.53%
Corn, Switchgrass And Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere0.53%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.53%
Tabebuia Heterophylla RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Unclassified → Tabebuia Heterophylla Rhizosphere0.53%
RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere0.53%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere0.53%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere0.53%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000550Amended soil microbial communities from Kansas Great Prairies, USA - BrdU amended with acetate total DNA F2.4 TB clc assemlyEnvironmentalOpen in IMG/M
3300003987Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleB_D2EnvironmentalOpen in IMG/M
3300004114Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5EnvironmentalOpen in IMG/M
3300004153Grasslands soil microbial communities from Hopland, California, USA (version 2)EnvironmentalOpen in IMG/M
3300005171Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126EnvironmentalOpen in IMG/M
3300005172Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132EnvironmentalOpen in IMG/M
3300005343Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaGEnvironmentalOpen in IMG/M
3300005444Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaGEnvironmentalOpen in IMG/M
3300005455Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaGHost-AssociatedOpen in IMG/M
3300005554Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110EnvironmentalOpen in IMG/M
3300005556Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156EnvironmentalOpen in IMG/M
3300005558Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147EnvironmentalOpen in IMG/M
3300005577Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2Host-AssociatedOpen in IMG/M
3300005578Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2Host-AssociatedOpen in IMG/M
3300005587Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103EnvironmentalOpen in IMG/M
3300005614Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2Host-AssociatedOpen in IMG/M
3300005713Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2)EnvironmentalOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300005834Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2Host-AssociatedOpen in IMG/M
3300005840Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2Host-AssociatedOpen in IMG/M
3300005843Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2Host-AssociatedOpen in IMG/M
3300005937Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1Host-AssociatedOpen in IMG/M
3300005981Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1Host-AssociatedOpen in IMG/M
3300005985Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2Host-AssociatedOpen in IMG/M
3300006046Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101EnvironmentalOpen in IMG/M
3300006058Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1Host-AssociatedOpen in IMG/M
3300006578Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLMA (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006581Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLPB (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006605Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHAB (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006844Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2Host-AssociatedOpen in IMG/M
3300006852Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2Host-AssociatedOpen in IMG/M
3300006854Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4Host-AssociatedOpen in IMG/M
3300006880Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3Host-AssociatedOpen in IMG/M
3300006953Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHMB (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006954Agricultural soil microbial communities from Georgia to study Nitrogen management - GA ControlEnvironmentalOpen in IMG/M
3300009011Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaGHost-AssociatedOpen in IMG/M
3300009012Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159EnvironmentalOpen in IMG/M
3300009038Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaGEnvironmentalOpen in IMG/M
3300009098Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaGHost-AssociatedOpen in IMG/M
3300009137Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158EnvironmentalOpen in IMG/M
3300009177Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaGHost-AssociatedOpen in IMG/M
3300009789Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot28EnvironmentalOpen in IMG/M
3300009823Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_40_50EnvironmentalOpen in IMG/M
3300009840Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105AEnvironmentalOpen in IMG/M
3300010036Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot26EnvironmentalOpen in IMG/M
3300010038Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot106EnvironmentalOpen in IMG/M
3300010041Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot104AEnvironmentalOpen in IMG/M
3300010042Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105BEnvironmentalOpen in IMG/M
3300010044Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot60EnvironmentalOpen in IMG/M
3300010045Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot61EnvironmentalOpen in IMG/M
3300010362Tropical forest soil microbial communities from Panama - MetaG Plot_22EnvironmentalOpen in IMG/M
3300010371Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1EnvironmentalOpen in IMG/M
3300010375Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaGHost-AssociatedOpen in IMG/M
3300010397Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4EnvironmentalOpen in IMG/M
3300011119Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaGHost-AssociatedOpen in IMG/M
3300012092Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ445A (23.06)EnvironmentalOpen in IMG/M
3300012094Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ858 (22.06)EnvironmentalOpen in IMG/M
3300012350Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaGEnvironmentalOpen in IMG/M
3300012355Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaGEnvironmentalOpen in IMG/M
3300012358Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_100_16 metaGEnvironmentalOpen in IMG/M
3300012359Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaGEnvironmentalOpen in IMG/M
3300012529Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ568 (21.06)EnvironmentalOpen in IMG/M
3300012680Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ224A (23.06)EnvironmentalOpen in IMG/M
3300012682Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ223 (23.06)EnvironmentalOpen in IMG/M
3300012899Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S058-202B-2EnvironmentalOpen in IMG/M
3300012908Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S089-202R-1EnvironmentalOpen in IMG/M
3300012955Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MGEnvironmentalOpen in IMG/M
3300012957Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MGEnvironmentalOpen in IMG/M
3300012958Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MGEnvironmentalOpen in IMG/M
3300012961Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MGEnvironmentalOpen in IMG/M
3300012976Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_0_1 metaGEnvironmentalOpen in IMG/M
3300012984Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MGEnvironmentalOpen in IMG/M
3300012985Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MGEnvironmentalOpen in IMG/M
3300012988Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MGEnvironmentalOpen in IMG/M
3300013306Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaGHost-AssociatedOpen in IMG/M
3300014150Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_5_24_1 metaGEnvironmentalOpen in IMG/M
3300014497Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaGHost-AssociatedOpen in IMG/M
3300015077Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S178-409R-2 (version 2)EnvironmentalOpen in IMG/M
3300015358Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_5_24_1 metaGEnvironmentalOpen in IMG/M
3300015373Combined assembly of cpr5 rhizosphereHost-AssociatedOpen in IMG/M
3300017959Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MGEnvironmentalOpen in IMG/M
3300017965Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 220 TEnvironmentalOpen in IMG/M
3300017997Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_coexEnvironmentalOpen in IMG/M
3300018027Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_coexEnvironmentalOpen in IMG/M
3300018052Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b2EnvironmentalOpen in IMG/M
3300018053Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_b1EnvironmentalOpen in IMG/M
3300018071Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_b1EnvironmentalOpen in IMG/M
3300018073Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_5_b1EnvironmentalOpen in IMG/M
3300018074Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b2EnvironmentalOpen in IMG/M
3300018422Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 TEnvironmentalOpen in IMG/M
3300019867Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3m1EnvironmentalOpen in IMG/M
3300019884Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L2s2EnvironmentalOpen in IMG/M
3300020020Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L2a1EnvironmentalOpen in IMG/M
3300020081Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300021078Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5_coex redoEnvironmentalOpen in IMG/M
3300021080Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_coex redoEnvironmentalOpen in IMG/M
3300024178Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK35EnvironmentalOpen in IMG/M
3300025898Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025901Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes)Host-AssociatedOpen in IMG/M
3300025907Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025908Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025915Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025922Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025927Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025928Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025929Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025931Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025939Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025944Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025945Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025949Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025961Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025981Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026023Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026095Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026285Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_20cm (SPAdes)EnvironmentalOpen in IMG/M
3300026301Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_20cm (SPAdes)EnvironmentalOpen in IMG/M
3300026306Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102 (SPAdes)EnvironmentalOpen in IMG/M
3300026326Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 (SPAdes)EnvironmentalOpen in IMG/M
3300028589Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Glucose_Day1EnvironmentalOpen in IMG/M
3300028597Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Glucose_Day14EnvironmentalOpen in IMG/M
3300028704Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_379EnvironmentalOpen in IMG/M
3300028708Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_152EnvironmentalOpen in IMG/M
3300028717Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_158EnvironmentalOpen in IMG/M
3300028721Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_355EnvironmentalOpen in IMG/M
3300028755Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_356EnvironmentalOpen in IMG/M
3300028768Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_119EnvironmentalOpen in IMG/M
3300028778Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_142EnvironmentalOpen in IMG/M
3300028787Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_381EnvironmentalOpen in IMG/M
3300028791Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_144EnvironmentalOpen in IMG/M
3300028796Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_141EnvironmentalOpen in IMG/M
3300028800Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaGHost-AssociatedOpen in IMG/M
3300028811Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_149EnvironmentalOpen in IMG/M
3300028812Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Vanillin_Day48EnvironmentalOpen in IMG/M
3300028814Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_183EnvironmentalOpen in IMG/M
3300028875Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_143EnvironmentalOpen in IMG/M
3300028876Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_140EnvironmentalOpen in IMG/M
3300028878Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_117EnvironmentalOpen in IMG/M
3300028884Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_195EnvironmentalOpen in IMG/M
3300030336Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day1EnvironmentalOpen in IMG/M
3300030619Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT150D86 (Novaseq)EnvironmentalOpen in IMG/M
3300031152Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 15_SEnvironmentalOpen in IMG/M
3300031229Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT155D38EnvironmentalOpen in IMG/M
3300031736Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f21EnvironmentalOpen in IMG/M
3300031769Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f24EnvironmentalOpen in IMG/M
3300031821Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f20EnvironmentalOpen in IMG/M
3300031824Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2Host-AssociatedOpen in IMG/M
3300031846Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f19EnvironmentalOpen in IMG/M
3300031892Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D2EnvironmentalOpen in IMG/M
3300031903Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1Host-AssociatedOpen in IMG/M
3300031939Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R2EnvironmentalOpen in IMG/M
3300032010Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f22EnvironmentalOpen in IMG/M
3300032039Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f21EnvironmentalOpen in IMG/M
3300032054Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f23EnvironmentalOpen in IMG/M
3300032089Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f23EnvironmentalOpen in IMG/M
3300032126Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2Host-AssociatedOpen in IMG/M
3300032897Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.5EnvironmentalOpen in IMG/M
3300033004Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4EnvironmentalOpen in IMG/M
3300033551Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day5EnvironmentalOpen in IMG/M
3300034176Sediment microbial communities from East River floodplain, Colorado, United States - 21_j17EnvironmentalOpen in IMG/M
3300034384Forest soil microbial communities from Eldorado National Forest, California, USA - SNFC_MG_KNG_2.2EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
F24TB_1291701723300000550SoilERTLQLGYVPRDVAPSLEGDEQAVSLWRVEGGLRVLIVPASAWIGQPR*
Ga0055471_1009122713300003987Natural And Restored WetlandsERTLQVGYVPRDVAPDLRGDEQALSLWRVEGGLRVLIAPADAWIATPRS*
Ga0062593_10206315923300004114SoilGYVPREVAPELTGDEQAVSLWRVEGGLRVLIAPADAWIGQPRS*
Ga0063455_10139096313300004153SoilYVPREVAAELQGDEQAVSLWRVEAGLRVLIVPHDAWVGRPR*
Ga0066677_1079361713300005171SoilPRETAAELAGDEQAVSLWRVEGGLRVLIVPSNAWVGTPR*
Ga0066683_1088016323300005172SoilRETAAELAGDEQAVSLWRVEGGLRVLIVPADAWVGTPRP*
Ga0070687_10131123313300005343Switchgrass RhizosphereVPREVAPELAGDEQAYSLWRVEGGLRVLIVPAGSWVGTPR*
Ga0070694_10082882713300005444Corn, Switchgrass And Miscanthus RhizosphereERTLQAGYVPREVAPELAGDEQAYSLWRVEGGLRVLIVPAGSWVGTPR*
Ga0070663_10028366533300005455Corn RhizospherePRDAAPELVGDELAVSLWRAGAEGLRVLLVPAGSWVGRPRR*
Ga0066661_1093941723300005554SoilYVPADTAPQLRGDEQAIALWRVEGGLRVLLAPADAWIGRPR*
Ga0066707_1071407613300005556SoilLQAGYVPRETAAELAGDEQAVSLWRVEGGLRVLIVPADAWVGRPRP*
Ga0066698_1085260013300005558SoilGYVPRDVAPELRGDEQAVSLWRVDDGLRVLIAPVDAWIGTPR*
Ga0068857_10053265613300005577Corn RhizospherePELTGDEQAVSLWRVEGGLRVLIAPADAWIGQPRS*
Ga0068854_10207548823300005578Corn RhizosphereRTLQAGYVPREVAPELGGDEQAYSLWRVEGGLRVLIVPAGSWVGTPR*
Ga0066654_1020769623300005587SoilAGYVPRETAAELGGDEQAVSLWRVEGGLRVLIVPADAWVGTPR*
Ga0068856_10236732813300005614Corn RhizosphereAPELAGDELVVSLWRRGEGLRVLVAPAGSWVGRPRR*
Ga0066905_10121666213300005713Tropical Forest SoilRTLQAGYVPATVAPELAGDEQAVSLWRPEGGLRVLIAPAGAWIGRPR*
Ga0066903_10357836813300005764Tropical Forest SoilQAGYVPREVAPELQGDEQAVSLWRVEGGLRVLIVPADAWVGTPR*
Ga0066903_10494118113300005764Tropical Forest SoilDAPGLAGDEQAVSIWRTDGGLRVLIAPADAWIGRPRP*
Ga0068851_1048984733300005834Corn RhizosphereVPREVAPELTGDEQAVSLWRVEGGLRVLIAPADAWIGQPRS*
Ga0068870_1029538013300005840Miscanthus RhizosphereVAPELSGNEQAVSLWRVDGGLRVLIVPADAWVGRPR*
Ga0068860_10206080113300005843Switchgrass RhizosphereVAPELAGDEQAYSLWRVEGGLRVLIVPAGSWVGTPR*
Ga0081455_10007552153300005937Tabebuia Heterophylla RhizosphereVGYVPRDATERLTGDEQAVSLWRVEGGLRVLIVPPEAWVGQPR*
Ga0081455_1039531613300005937Tabebuia Heterophylla RhizosphereVAPELSGDEQAVSLWRVEGGLRVLIVPSDAWVGTPR*
Ga0081538_1033787913300005981Tabebuia Heterophylla RhizosphereTAAELRGDEQAVSLWRVEGGLRVLIAPADAWVGRPR*
Ga0081539_1031609313300005985Tabebuia Heterophylla RhizosphereASELDGSEQAMSLWRVDGGLRILIVPKGAWIGRPRR*
Ga0066652_10047770013300006046SoilGDRTLQVGYVPRDIAAELDGSEQAVSLWRVDGGLRVLIAPAGAWIGRPRR*
Ga0066652_10067193123300006046SoilVPRETAAELAGDEQAVSLWRVEGGLRVLIVPSNAWVGTPR*
Ga0066652_10085042313300006046SoilTLQAGYVPAETAPTLRGDEQAVSLWRVEGGLRVLLAPPDTWIGRPR*
Ga0075432_1020194613300006058Populus RhizosphereGYVPRETAAELAGDEQAVSLWRVEGGLRVLIVPADAWVGRPRL*
Ga0074059_1210245113300006578SoilERTLQLGYVPRDDAPRLAGDEQAVSIWRTDGGLRVLIARADTWIGQPR*
Ga0074048_1001102423300006581SoilAPELAGDEQAVSLWRTEGGLRALIAPADAWVGRPR*
Ga0074048_1001182123300006581SoilGYVPRDVAPELAGDEQAVSLWRVDGGLRVLIAPADAWIGRPR*
Ga0074057_1003982423300006605SoilEMAPELAGDEQAVSLWRTEGGLRALIAPADAWVGRPR*
Ga0075428_10180948223300006844Populus RhizosphereVGYVPAAVAPELAGDEQALSLWRVEGGLRVLIVPAGTWVGTPR*
Ga0075433_10006819113300006852Populus RhizosphereVPRETAAELGGDEQAVSLWRVEGGLRVLIVPADAWVGRPS*
Ga0075425_10096210333300006854Populus RhizosphereYVPRDVAPELAGDEQAVSLWRVEGGLRVLIVPADAWVGRPR*
Ga0075425_10161016233300006854Populus RhizosphereQVGYVPREVAPEVRGDEQAVSLWRVDGGLRVLLAPADAWIGTPH*
Ga0075429_10176239513300006880Populus RhizospherePELRGDEQAVSLWRVDGGLRVLIVAADAWVATPRV*
Ga0074063_1005981223300006953SoilTLQAGYVPRDVAPELSGDEQAYSLWRVEGGLRVLVVPAGSWVGTPR*
Ga0079219_1034067323300006954Agricultural SoilVAAELGGDEQAVSLWRVEGGLRVLIVPATAWVGTPR*
Ga0105251_1065819113300009011Switchgrass RhizosphereTAAELAGDEQAVSLWRVEGGLRVLIVPPDAWVGRPRL*
Ga0066710_10490376213300009012Grasslands SoilIGYVPREDAPRLAGEEQAVSIWRTEGGLRVLIAPADAWIGRPR
Ga0099829_1091653713300009038Vadose Zone SoilIAPELSGDEQAISLWRVDGGLRVLIAPRDAWIGTPR*
Ga0105245_1303931023300009098Miscanthus RhizosphereNAQLTVQAGYVPRDVAPELTGDEQAVSLWRVEGGLRVLIAPADAWIGRPR*
Ga0066709_10192326923300009137Grasslands SoilYVPAETAPQLRGDEQAVTLWRVEGGLRVLLAPADAWIGRPR*
Ga0066709_10330759723300009137Grasslands SoilYVPRETAAELGGDEQAVSLWRVEGGLRVLIVPPDAWVGTPR*
Ga0066709_10354203533300009137Grasslands SoilYVPRDVAPDLRGDEQAVSLWRVDGGLRVLIAPADAWIGSPR*
Ga0105248_1289579623300009177Switchgrass RhizosphereLQVGYVPREVAPELAGDEQAVSLWRVDGGLRVLIVSPDTWVADPR*
Ga0126307_1161504513300009789Serpentine SoilIAPELGGDEQAVSIWRVEGGLRVLIAPADAWIGTPRS*
Ga0105078_106320313300009823Groundwater SandAGYVPAVVAPDLHGDEQAVSLWRVEGGLRVLIVPADAWVGTPR*
Ga0126313_1002260013300009840Serpentine SoilNADHTVHAGYVPRETAPDLDGSEQAVSLWRVEGGLRVLIAPRDAWIGHPR*
Ga0126313_1013008233300009840Serpentine SoilGYVPAAIAPELAGDEQALSLWRVEGGLRVLIVPAGTWLGTPR*
Ga0126313_1055837333300009840Serpentine SoilAGYVPREVAPELNGDEQAVSIWRVEGGLRVLIAPADAWIGRPHW*
Ga0126313_1063038613300009840Serpentine SoilAVAAELSGDEQAVSLWRAGEGLRILLVPADAWVGRPRR*
Ga0126313_1118171813300009840Serpentine SoilRETAAELVGDEQAVSLWRVEGGLRVLIAPPDAWIGQPR*
Ga0126305_1011407413300010036Serpentine SoilTAPELRGDEQAVSLWRVEGGLRVLIAPADAWLGVPRSLS*
Ga0126315_1001738873300010038Serpentine SoilRTLQVGYVPRDVAPEVRGDEQAVSLWRVEGGLRVLIAPPDAWIGTPR*
Ga0126312_1086164723300010041Serpentine SoilLQVGYVPREVAPELRGDEQAMSLWRVDGGLRVLIAPADAWIASPR*
Ga0126314_1037140013300010042Serpentine SoilPRETAAELGGDEQAVSLWRVEAGLRVLIVPHDAWVGRPR*
Ga0126310_1106593213300010044Serpentine SoilGYVPRDIAPDVHGDEQAVSLWRVDGGLRVLIAPADAWIGTPR*
Ga0126311_1123244213300010045Serpentine SoilARTLQVGYLPRAVASELRGDEQAMSLWRVDGGLRVLIAPADAWIASPR*
Ga0126377_1292580613300010362Tropical Forest SoilLQVGYVPREVAPDVRGDEQAVSLWRVDGGLRVLIAPADAWIGTPH*
Ga0134125_1122616623300010371Terrestrial SoilELAGDEQAVSLWRVEGGLRVLIVPRDAWVGTPRPR*
Ga0105239_1062653833300010375Corn RhizosphereRTLQAGYVPREVAPELTGDEQAVSLWRVEGGLRVLIAPADAWIGQPRS*
Ga0105239_1259740423300010375Corn RhizosphereGYVPRDVAPQLAGDEQAVSLWRAGEGLRVLLVPPTAWVGRPRR*
Ga0134124_1269410823300010397Terrestrial SoilAGGYVPRDLAPEVRGDEQAVSLWRVEGGLRVLIAPRDAWVGRPR*
Ga0105246_1052697633300011119Miscanthus RhizospherePELAGDEQAYSLWRVEGGLRVLIVPAGSWVGTPR*
Ga0136621_139900213300012092Polar Desert SandLQLGYVPAAVAPEVTGDEQALSLWRVDGGLRILIVPADAWIGAPR*
Ga0136638_1062743513300012094Polar Desert SandAIAPALHGDEQALSLWRVDGGLRVLIAPANAWLGTPR*
Ga0137372_10024031103300012350Vadose Zone SoilYVPRASAPTLTGDEQAFSLWRLDGGLRVLIVPADAWVGRPR*
Ga0137372_1012615513300012350Vadose Zone SoilRTLQAGYVPRETAAELAGDEQAVSLWRVEGGLRVLVVPADAWVATPRR*
Ga0137369_1104178513300012355Vadose Zone SoilEVAAELDGSEQAVSLWRVEGGLRVLIVPADAWIGWPRG*
Ga0137368_1085400613300012358Vadose Zone SoilQVGYVPRDVAPELRGDEQAVSLWRVDGGLRVLIVPAEAWVATPRR*
Ga0137385_1166991323300012359Vadose Zone SoilAPEVKGDEQAMSLWRVDAGLRVLIVPRDAWVGTPR*
Ga0136630_104988333300012529Polar Desert SandSAVAPELAGDEQAVSLWRVEGGLRVLIAPRDAWIGTPR*
Ga0136612_1000556913300012680Polar Desert SandNRSLQAGYVPAAVAPELAGDEQAVSLWRVEGGLRVLIAPRDAWIGAPR*
Ga0136612_1032578523300012680Polar Desert SandQLGYVPASVAPALTGDEQAVSLWRVDGGLRVLIVPANAWIATPR*
Ga0136611_1092512913300012682Polar Desert SandELRGDEQAVSLWRVDGGLRILIVPAEAWLGIPLSGPR*
Ga0157299_1021333113300012899SoilERTLQVGYVPAAVAPELAGDEQALALWRVEAGLRVLIAPAGAWIGTPR*
Ga0157286_1031695113300012908SoilRTLQAGYVPRETVAELAGDEQAVSLWRVEGGLRVLIVPPDAWVGTPRR*
Ga0164298_1017098723300012955SoilVPRDVAPELDGTEQAVSLWRAGEGLRVLIAPRDAWIGRPRR*
Ga0164303_1026493223300012957SoilAGYVPRDVAPELDGTEQAVSLWRAGEGLRVLIAPRDAWIGRPRR*
Ga0164299_1006455243300012958SoilAPDLDGTELAVSLWRFGEEGLRVLLVPAGSWVGRPRR*
Ga0164302_1055540723300012961SoilAGYVPREVAPELDGDEQALSLWRVEGGLRVLVVPADAWLGTPR*
Ga0134076_1034571423300012976Grasslands SoilYVPRETAAELGRDEQAFSLWRVERGLRVLIVPPDAWVGTPR*
Ga0164309_1190347323300012984SoilRTLQVGYVPRDVAAELEGNEQAISLWRVEGGLRVLIVPPNAWVGTPR*
Ga0164308_1021076133300012985SoilPRDVAPDLDGSEQAVSLWRAGEGLRVLIAPRDAWIGRPRR*
Ga0164308_1113040913300012985SoilRTLQLGYVPREDAPRLAGDEQAVSIWRTEGGLRVLIAPADAWVGRPR*
Ga0164306_1007442323300012988SoilVPREVAAELAGDEQAISIWRAGEGLRILLVPPTAWVGRPRR*
Ga0164306_1202940023300012988SoilPRDVAAELEGNEQAISLWRVEGGLRVLIVPPNAWVGTPR*
Ga0163162_1267963313300013306Switchgrass RhizosphereVPRDLAPEVRGDEQAVSLWRVEGGLRVLIAPRDAWVGRPR*
Ga0134081_1039393723300014150Grasslands SoilREEAPALDGTELAVSLWRFGDGLRVLLVPAGSWVGRPRR*
Ga0182008_1040493413300014497RhizospherePELAGDELAVSLWRAGEGLRVLIVPAGSWVGKPRR*
Ga0182008_1091872623300014497RhizosphereQAGYVPREVAAELDGEEQAVSLWRVEGGLRVLIVPEDAWVGMPRR*
Ga0182008_1092945223300014497RhizosphereLQAGYVPREVAPELAGDELAYSLWRVEGGLRVLVVPAGSWVGTPR*
Ga0173483_1072316723300015077SoilVPAAIAPELAGDEQAISLWRVDGGLRVLLVPADAWLGTPRR*
Ga0134089_1026419213300015358Grasslands SoilLGYVPREDAPRLSGGEQAVSIWRTDGGLRVLIAPADAWIGRPR*
Ga0132257_10438170613300015373Arabidopsis RhizosphereAGYVPREVAPELGGDEQAVSLWRVDGGLRVLIAPAAAWIGTPR*
Ga0187779_1020072213300017959Tropical PeatlandPREVAPELDGTELAVSLWRFGEGLRILVVPAGSWVGRPRR
Ga0190266_1011653133300017965SoilELAPQLKGDEQAISLWRVEGGLRVLIVPADAWVGRPR
Ga0184610_108194513300017997Groundwater SedimentEERTLQLGYVPREIAAELGGDEQAVSLWRVEAGLRVLIVPRDAWVGRPR
Ga0184605_1005391213300018027Groundwater SedimentAGYVPREAAPGLSGDEQAISLWRPEGGLRVLIVPADAWIGTPR
Ga0184638_118534323300018052Groundwater SedimentVPREVARELAGDEQALCLWRFEGGLRMLIAPADAWSGGPGRFSRRGV
Ga0184626_1011416713300018053Groundwater SedimentIAPKLTGDEQAVSLWRVEGGLRVLIVPADAWVGRPR
Ga0184618_1013078113300018071Groundwater SedimentVPRETAAELGGDEQAVSLWRVEGGLRVLIVPHDAWVGRPR
Ga0184624_1009634213300018073Groundwater SedimentVPREDAPRLAGNEQAVSIWRTDGGLRVLIAPADAWIGRPR
Ga0184624_1023814933300018073Groundwater SedimentVPRDVAPALEGDEQAVSLWRVDGGLRVLIAPATAWIGQPR
Ga0184624_1023961613300018073Groundwater SedimentGYVPREVAPELVGDEQAVSLWRVEGGLRVLIAPADAWIGRPR
Ga0184640_1043609513300018074Groundwater SedimentVGYVPAAIAPELAGDEQALSLWRVEGGLRVLIVPADAWLGTPR
Ga0190265_1199375013300018422SoilPELRGDEQAVSLWRVDGGLRVLIVPADAWVGSPRPNR
Ga0193704_101711813300019867SoilAPEVAGDEQAVSLWRVEGGLRVLIVPPDAWVGRPR
Ga0193741_109609023300019884SoilVGYVPREIAPQLAGDEQAISLWRVEGGLRVLIVPADAWVGRPR
Ga0193738_115637223300020020SoilQVGYVPREIAPQLAGDEQAISLWRVEGGLRVLIVPADAWVGRPR
Ga0206354_1052414713300020081Corn, Switchgrass And Miscanthus RhizosphereGYVPREVAAELDRSALAFSLWRAGESGLRVLLVPPGSWVGRPRRER
Ga0210381_1020038113300021078Groundwater SedimentAAELGGDEQAVSLWRVEAGLRVLIVPRDAWVGRPR
Ga0210382_1033749113300021080Groundwater SedimentLQLGYVPRDVAPTVSGDEQALSIWRSEGGLRVLIVPPDAWVGRPR
Ga0247694_100321053300024178SoilEVAPDLDGDEQAVSLWRVEGGLRVLLVPADAWVGTPR
Ga0207692_1039993713300025898Corn, Switchgrass And Miscanthus RhizosphereAGYVPRETAAELGGDEQAVSLWRVEGGLRVLIVPADAWVGRPS
Ga0207688_1042407613300025901Corn, Switchgrass And Miscanthus RhizosphereAPELSGDEQAYSLWRVEGGLRVLVVPAGSWVGTPR
Ga0207645_1039440133300025907Miscanthus RhizosphereEASELDGTELAVSLWRMGEGLRVLLVPAGSWVGRPRR
Ga0207643_1024471713300025908Miscanthus RhizosphereEVAPELSGNEQAVSLWRVDGGLRVLIVPADAWVGRPR
Ga0207693_1030045733300025915Corn, Switchgrass And Miscanthus RhizosphereQLGYIPRETAAELGGDEQAVSLWRVEGGLRVLIVPPDAWVGRPR
Ga0207646_1058928413300025922Corn, Switchgrass And Miscanthus RhizosphereRTLQAGYVPRETAAELGGDEQAVSLWRVEGGLRVLIVPADAWVGTPRL
Ga0207687_1058229713300025927Miscanthus RhizospherePRDVAPGLSGDEQAYSLWRVEGGLRVLVVPAGSWVGTPR
Ga0207700_1153176823300025928Corn, Switchgrass And Miscanthus RhizosphereVAVTLNGDEQAVSLWRAGEGLRVLIVPAGSWVGRPR
Ga0207664_1036594523300025929Agricultural SoilTLQAGYVPRETAAELGGDEQAVSLWRVEGGLRVLIVPADAWVGTPRP
Ga0207664_1140133013300025929Agricultural SoilVAVEIRGDEQAVSLWRVDGGLRVLIAPGDAWIGTPR
Ga0207644_1046549313300025931Switchgrass RhizosphereGCVPRDVAPELSGDEQAYSLWRVEGGLRVLVVPAGSWVGTPR
Ga0207665_1038599223300025939Corn, Switchgrass And Miscanthus RhizosphereREVAAELDGSEQAVALWRAGEGLRVLLAPKGAWIGRPRR
Ga0207665_1067002613300025939Corn, Switchgrass And Miscanthus RhizosphereAPDLAGDELAVSLWRAGEGLRILLVPAGSWVGRPRR
Ga0207661_1119240613300025944Corn RhizosphereDRSLQVGYVPREVAPELAGDEQAVSLWRVDGGLRVLIVSPDTWVADPR
Ga0207679_1148999823300025945Corn RhizosphereVPRDVAPQLAGDEQAVSLWRAGEGLRVLLVPPTAWVGRPRR
Ga0207667_1195175523300025949Corn RhizosphereAPELVGDELAVSLWRAGAEGLRVLLVPAGSWVGRPRR
Ga0207712_1013942413300025961Switchgrass RhizosphereAGYIPRETAAELAGDEQAVSLWRVEGGLRVLIVPPDAWVGRPRP
Ga0207640_1093966413300025981Corn RhizospherePREVAPELTGDEQAVSLWRVEGGLRVLIAPADAWIGQPRS
Ga0207677_1137550913300026023Miscanthus RhizosphereVPRGTAPDLDGTELAVSLWRFGEEGLRVLLAPAGSWVGRPRR
Ga0207676_1218001713300026095Switchgrass RhizosphereGYVPREVAPELGGDEQAYSLWRVEGGLRVLIVPAGSWVGTPR
Ga0209438_116744023300026285Grasslands SoilETAAELAGDEQAVSLWRVEGGLRVLIVPPDAWVGRPR
Ga0209238_128255013300026301Grasslands SoilETAAELGGDEQAVSLWRVEGGLRVLIVPRDAWVGTPR
Ga0209468_106143913300026306SoilEEQTLHAGYVPRETAPELIGDEQAVSLWRVEGSLRVLIVPADAWVGTPRPG
Ga0209801_110343713300026326SoilRALQAGYVPRETAAELGGDEQAVSLWRVEGGLRVLIVPSNAWVGTPRP
Ga0247818_1080594313300028589SoilERALQLGYVPAAIAPELAGDEQALSLWRVDGGLRVLIAPADAAGT
Ga0247818_1121078723300028589SoilQAGYVPREVAPELAGDEQALSLWRVEGGLRVLIVPADAWLGTPR
Ga0247820_1090156523300028597SoilAQAALDAPELAGDEQAVSLWRVEGGLRVLIVPRDAWVGTPHR
Ga0307321_108567923300028704SoilRDVAPELGGDEQAVSLWRLEGGLRVLIAPADAWIGHPR
Ga0307295_1012344423300028708SoilGYVPRDLAPEVRGDEQAVSLWRVEGGLRVLIAPRDAWVGRPR
Ga0307298_1026122823300028717SoilVPRDLAPEVRGDEQAVSLWRVEGGLRVLIAPRDAWVGRPR
Ga0307315_1014742223300028721SoilLQLGYVPREVAPELAGDEQAVSLWRVEGGLRVLIVPPDAWVGRPR
Ga0307316_1036752013300028755SoilPREVAPELAGDEQAVSLWRVEGGLRVLIVPPDAWVGRPR
Ga0307280_1031766613300028768SoilLQAGYVPRDLAPEVRGDEQAVSLWRVEGGLRVLIAPRDAWVGRPR
Ga0307288_1048936923300028778SoilPREILAELGGDEQAVSLWRVEAGLRVLIVPHDAWVGRPR
Ga0307323_1031425213300028787SoilQARTLQAGYVPRDVAPELEGNEQAISLWRVEGGLRVLIVPPDAWVGTPR
Ga0307290_1010107123300028791SoilRDVAPQLKGDEQAISLWRVEGGLRVLIAPPDAWVGRPR
Ga0307287_1001591953300028796SoilAAALGGDEQAISLWRVEAGLRVLIVPHDAWVGRPR
Ga0265338_1080182223300028800RhizosphereAGYVPRNVVAELDGSEQAVSLWRSGEGLRILLVPADAWVGRPRR
Ga0307292_1034361223300028811SoilEERSLQLGYVPRDRTAELRGDEQAVSLWRVEGGLRVLIIPANAWVGTPR
Ga0247825_1065455023300028812SoilLQLGYVPRETAAELGGDEQAVSLWRVEGGLRVLIVPPDAWVGRPR
Ga0247825_1097435433300028812SoilYVPAAIAPELAGDEQALSLWRVDGGLRVLIAPAGAWLGTPR
Ga0307302_1045632613300028814SoilGYVPRDVAPELEGDEQEVSLWRFEGGLRVLIAPADAWLGLPR
Ga0307289_1036711213300028875SoilVPREVAPELSGDEQAVSLWRVDGGLRVLIVPGDAWLGTPR
Ga0307286_1013426113300028876SoilAPRLAGDEQAVSIWRTDGGLRVLIAPADAWIGRPR
Ga0307286_1018695113300028876SoilTLQAGYVPRDVALELQGDEQAISLWRVEGGLRVLIVPPDAWVGTPR
Ga0307286_1031828123300028876SoilLQAGYVPRDVAPELAGDEQAVSLWRVDGGLRVLVVPRDTWVGAPR
Ga0307278_1034187023300028878SoilETATELTGDEQAVSLWRVEGGLRVLIVPAGAWVGTPR
Ga0307308_1021278223300028884SoilAGYVPREMAVELGGDEQAVSLWRVEGGLRVLIVPPDAWVGLPR
Ga0247826_1167537413300030336SoilGYVPAAVAPELRGDEQAVSLWRVEGGLRVLIVPADAWVGTPR
Ga0247826_1172133313300030336SoilYVPREVAPELAGDEQALSLWRVEGGLRVLIVPADAWLGTPR
Ga0268386_1046727133300030619SoilQLGYVPAAVAPELVGDEQAVSLWRVDGGLRVLIVPADAWIGAPS
Ga0307501_1005656323300031152SoilTAAELGGDEQAVSLWRVEAGLRVLIVPHDAWVGRPR
Ga0299913_1023415033300031229SoilLQLGYVPAAVAPELSGAEQAVSLWRVEGGLRVLLAPADAWLGTPR
Ga0318501_1081377523300031736SoilPQGDCELDGSELAVSLWRAGEGLRVLIVPAGTWVGRPRR
Ga0318526_1028129623300031769SoilGYVPRELAAELDGSELAVSLWRAGEGLRVLIVPAGTWVGRPRR
Ga0318567_1031488513300031821SoilLQAGYVPRVHASALDGTEQAVSLWRVGVGLRVLIAPAGSWVGRPRRR
Ga0307413_1054401113300031824RhizospherePAALAPELAGDEQAISLWRVDGGLRVLIVPPDAWVGTPR
Ga0318512_1051216113300031846SoilGYVPRELAPELHGDEQAVSLWRVDGGLRVLVAPADAWIGQPR
Ga0310893_1055090123300031892SoilAAVAPELAGDEQALSLWRVEGGLRVLIVAADAWVGRPREPLS
Ga0307407_1063960423300031903RhizosphereVAPELGGGEQALSLWRVEGGLRVLIAPGDAWIGSPR
Ga0308174_1081522423300031939SoilPRDLAPELHGDEQAVSLWRVEGGLRVLIVPRDAWVGRPR
Ga0308174_1105326413300031939SoilVPREAAPELDGSELAVSLWRAGEGLRVLVVPAGSWVGRPR
Ga0318569_1056005313300032010SoilVPRDVAPELRGDEQAVSLWRVDGGLRVLVAPADAWIGQPR
Ga0318559_1040133223300032039SoilLQVGYVPRDVAPELRGDEQAVSLWRVDGGLRVLVAPADAWIGQPR
Ga0318570_1037961823300032054SoilDCELDGSELAVSLWRAGEGLRVLIVPAGTWVGRPRR
Ga0318525_1013347013300032089SoilGYVPRDRASELQGGEQAVSLWRMGIGLRVLIVPAGAWVGRPRR
Ga0307415_10169822913300032126RhizosphereGYVPRELAPELSGDEQAISLWRVEGGLRVLIAPADAWIGTPRL
Ga0335071_1019138313300032897SoilAELAGGEQAVSLWRAGEGLRILIVPADAWIGRPRR
Ga0335084_1108920013300033004SoilTLQAGYVPREVAPELAGDEQAVSLWRVEGGLRVLIVPADAWVGRPR
Ga0247830_1124001913300033551SoilLQVGYVPAAIAPELAGDEQALSLWRVEGGLRVLIVPADAWVGTPR
Ga0364931_0249941_450_5813300034176SedimentLGYVPAVVAPELTGDEQAVSLWRVDGGLRVLIVSADAWVGTPR
Ga0372946_0103094_1200_13373300034384SoilLQVGYVPAAVAPELAGGEQAVSLWRVDGGLRVLIAPADAWIGTPR


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.