| Basic Information | |
|---|---|
| Family ID | F028795 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 190 |
| Average Sequence Length | 42 residues |
| Representative Sequence | YVPRDVAPELAGDEQAVSLWRVEGGLRVLIVPADAWVGRPR |
| Number of Associated Samples | 161 |
| Number of Associated Scaffolds | 190 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 2.11 % |
| % of genes near scaffold ends (potentially truncated) | 97.37 % |
| % of genes from short scaffolds (< 2000 bps) | 94.74 % |
| Associated GOLD sequencing projects | 158 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.56 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (99.474 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (19.474 % of family members) |
| Environment Ontology (ENVO) | Unclassified (24.211 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (48.421 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 20.29% Coil/Unstructured: 79.71% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.56 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 190 Family Scaffolds |
|---|---|---|
| PF02817 | E3_binding | 54.21 |
| PF00364 | Biotin_lipoyl | 12.63 |
| PF13302 | Acetyltransf_3 | 10.00 |
| PF06475 | Glycolipid_bind | 8.42 |
| PF00583 | Acetyltransf_1 | 2.11 |
| PF03069 | FmdA_AmdA | 1.05 |
| PF02780 | Transketolase_C | 1.05 |
| PF00085 | Thioredoxin | 1.05 |
| PF07452 | CHRD | 1.05 |
| PF13374 | TPR_10 | 1.05 |
| PF03572 | Peptidase_S41 | 0.53 |
| PF12688 | TPR_5 | 0.53 |
| PF13277 | YmdB | 0.53 |
| PF00196 | GerE | 0.53 |
| PF04973 | NMN_transporter | 0.53 |
| PF01663 | Phosphodiest | 0.53 |
| PF04138 | GtrA | 0.53 |
| PF02673 | BacA | 0.53 |
| COG ID | Name | Functional Category | % Frequency in 190 Family Scaffolds |
|---|---|---|---|
| COG0508 | Pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide acyltransferase (E2) component | Energy production and conversion [C] | 54.21 |
| COG3554 | Uncharacterized conserved protein | Function unknown [S] | 8.42 |
| COG2421 | Acetamidase/formamidase | Energy production and conversion [C] | 1.05 |
| COG0793 | C-terminal processing protease CtpA/Prc, contains a PDZ domain | Posttranslational modification, protein turnover, chaperones [O] | 0.53 |
| COG1968 | Undecaprenyl pyrophosphate phosphatase | Lipid transport and metabolism [I] | 0.53 |
| COG3201 | Nicotinamide riboside transporter PnuC | Coenzyme transport and metabolism [H] | 0.53 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 99.47 % |
| Unclassified | root | N/A | 0.53 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000550|F24TB_12917017 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 670 | Open in IMG/M |
| 3300003987|Ga0055471_10091227 | All Organisms → cellular organisms → Bacteria | 883 | Open in IMG/M |
| 3300004114|Ga0062593_102063159 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Frankiales → Frankiaceae | 635 | Open in IMG/M |
| 3300004153|Ga0063455_101390963 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 541 | Open in IMG/M |
| 3300005171|Ga0066677_10793617 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 524 | Open in IMG/M |
| 3300005172|Ga0066683_10880163 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 514 | Open in IMG/M |
| 3300005343|Ga0070687_101311233 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 538 | Open in IMG/M |
| 3300005444|Ga0070694_100828827 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 760 | Open in IMG/M |
| 3300005455|Ga0070663_100283665 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1320 | Open in IMG/M |
| 3300005554|Ga0066661_10939417 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 506 | Open in IMG/M |
| 3300005556|Ga0066707_10714076 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 627 | Open in IMG/M |
| 3300005558|Ga0066698_10852600 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 586 | Open in IMG/M |
| 3300005577|Ga0068857_100532656 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1105 | Open in IMG/M |
| 3300005578|Ga0068854_102075488 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 525 | Open in IMG/M |
| 3300005587|Ga0066654_10207696 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1020 | Open in IMG/M |
| 3300005614|Ga0068856_102367328 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 539 | Open in IMG/M |
| 3300005713|Ga0066905_101216662 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 674 | Open in IMG/M |
| 3300005764|Ga0066903_103578368 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 837 | Open in IMG/M |
| 3300005764|Ga0066903_104941181 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 708 | Open in IMG/M |
| 3300005834|Ga0068851_10489847 | All Organisms → cellular organisms → Bacteria | 736 | Open in IMG/M |
| 3300005840|Ga0068870_10295380 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1021 | Open in IMG/M |
| 3300005843|Ga0068860_102060801 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 592 | Open in IMG/M |
| 3300005937|Ga0081455_10007552 | All Organisms → cellular organisms → Bacteria | 11433 | Open in IMG/M |
| 3300005937|Ga0081455_10395316 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 961 | Open in IMG/M |
| 3300005981|Ga0081538_10337879 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 547 | Open in IMG/M |
| 3300005985|Ga0081539_10316093 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 666 | Open in IMG/M |
| 3300006046|Ga0066652_100477700 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1153 | Open in IMG/M |
| 3300006046|Ga0066652_100671931 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 984 | Open in IMG/M |
| 3300006046|Ga0066652_100850423 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 872 | Open in IMG/M |
| 3300006058|Ga0075432_10201946 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 787 | Open in IMG/M |
| 3300006578|Ga0074059_12102451 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 619 | Open in IMG/M |
| 3300006581|Ga0074048_10011024 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1156 | Open in IMG/M |
| 3300006581|Ga0074048_10011821 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 808 | Open in IMG/M |
| 3300006605|Ga0074057_10039824 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 590 | Open in IMG/M |
| 3300006844|Ga0075428_101809482 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 636 | Open in IMG/M |
| 3300006852|Ga0075433_10006819 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 9053 | Open in IMG/M |
| 3300006854|Ga0075425_100962103 | All Organisms → cellular organisms → Bacteria | 975 | Open in IMG/M |
| 3300006854|Ga0075425_101610162 | All Organisms → cellular organisms → Bacteria | 732 | Open in IMG/M |
| 3300006880|Ga0075429_101762395 | All Organisms → cellular organisms → Bacteria | 537 | Open in IMG/M |
| 3300006953|Ga0074063_10059812 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 726 | Open in IMG/M |
| 3300006954|Ga0079219_10340673 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 956 | Open in IMG/M |
| 3300009011|Ga0105251_10658191 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 501 | Open in IMG/M |
| 3300009012|Ga0066710_104903762 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 501 | Open in IMG/M |
| 3300009038|Ga0099829_10916537 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 727 | Open in IMG/M |
| 3300009098|Ga0105245_13039310 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 520 | Open in IMG/M |
| 3300009137|Ga0066709_101923269 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 822 | Open in IMG/M |
| 3300009137|Ga0066709_103307597 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 586 | Open in IMG/M |
| 3300009137|Ga0066709_103542035 | All Organisms → cellular organisms → Bacteria → Elusimicrobia → Elusimicrobia | 566 | Open in IMG/M |
| 3300009177|Ga0105248_12895796 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 547 | Open in IMG/M |
| 3300009789|Ga0126307_11615045 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 527 | Open in IMG/M |
| 3300009823|Ga0105078_1063203 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 512 | Open in IMG/M |
| 3300009840|Ga0126313_10022600 | All Organisms → cellular organisms → Bacteria | 4206 | Open in IMG/M |
| 3300009840|Ga0126313_10130082 | All Organisms → cellular organisms → Bacteria | 1883 | Open in IMG/M |
| 3300009840|Ga0126313_10558373 | All Organisms → cellular organisms → Bacteria | 920 | Open in IMG/M |
| 3300009840|Ga0126313_10630386 | Not Available | 865 | Open in IMG/M |
| 3300009840|Ga0126313_11181718 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 630 | Open in IMG/M |
| 3300010036|Ga0126305_10114074 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1640 | Open in IMG/M |
| 3300010038|Ga0126315_10017388 | All Organisms → cellular organisms → Bacteria | 3547 | Open in IMG/M |
| 3300010041|Ga0126312_10861647 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 659 | Open in IMG/M |
| 3300010042|Ga0126314_10371400 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1028 | Open in IMG/M |
| 3300010044|Ga0126310_11065932 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 641 | Open in IMG/M |
| 3300010045|Ga0126311_11232442 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 620 | Open in IMG/M |
| 3300010362|Ga0126377_12925806 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 551 | Open in IMG/M |
| 3300010371|Ga0134125_11226166 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 819 | Open in IMG/M |
| 3300010375|Ga0105239_10626538 | All Organisms → cellular organisms → Bacteria | 1228 | Open in IMG/M |
| 3300010375|Ga0105239_12597404 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 591 | Open in IMG/M |
| 3300010397|Ga0134124_12694108 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 540 | Open in IMG/M |
| 3300011119|Ga0105246_10526976 | All Organisms → cellular organisms → Bacteria | 1008 | Open in IMG/M |
| 3300012092|Ga0136621_1399002 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 530 | Open in IMG/M |
| 3300012094|Ga0136638_10627435 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 517 | Open in IMG/M |
| 3300012350|Ga0137372_10024031 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 5667 | Open in IMG/M |
| 3300012350|Ga0137372_10126155 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 2116 | Open in IMG/M |
| 3300012355|Ga0137369_11041785 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 539 | Open in IMG/M |
| 3300012358|Ga0137368_10854006 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 559 | Open in IMG/M |
| 3300012359|Ga0137385_11669913 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 501 | Open in IMG/M |
| 3300012529|Ga0136630_1049883 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1577 | Open in IMG/M |
| 3300012680|Ga0136612_10005569 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei | 6050 | Open in IMG/M |
| 3300012680|Ga0136612_10325785 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 780 | Open in IMG/M |
| 3300012682|Ga0136611_10925129 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 518 | Open in IMG/M |
| 3300012899|Ga0157299_10213331 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 590 | Open in IMG/M |
| 3300012908|Ga0157286_10316951 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 576 | Open in IMG/M |
| 3300012955|Ga0164298_10170987 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium 70-9 | 1242 | Open in IMG/M |
| 3300012957|Ga0164303_10264932 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 993 | Open in IMG/M |
| 3300012958|Ga0164299_10064552 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1771 | Open in IMG/M |
| 3300012961|Ga0164302_10555407 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 823 | Open in IMG/M |
| 3300012976|Ga0134076_10345714 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 653 | Open in IMG/M |
| 3300012984|Ga0164309_11903473 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 510 | Open in IMG/M |
| 3300012985|Ga0164308_10210761 | All Organisms → cellular organisms → Bacteria | 1488 | Open in IMG/M |
| 3300012985|Ga0164308_11130409 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 703 | Open in IMG/M |
| 3300012988|Ga0164306_10074423 | All Organisms → cellular organisms → Bacteria | 2140 | Open in IMG/M |
| 3300012988|Ga0164306_12029400 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 500 | Open in IMG/M |
| 3300013306|Ga0163162_12679633 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 574 | Open in IMG/M |
| 3300014150|Ga0134081_10393937 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 518 | Open in IMG/M |
| 3300014497|Ga0182008_10404934 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 734 | Open in IMG/M |
| 3300014497|Ga0182008_10918726 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 516 | Open in IMG/M |
| 3300014497|Ga0182008_10929452 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 514 | Open in IMG/M |
| 3300015077|Ga0173483_10723167 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 565 | Open in IMG/M |
| 3300015358|Ga0134089_10264192 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 707 | Open in IMG/M |
| 3300015373|Ga0132257_104381706 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 514 | Open in IMG/M |
| 3300017959|Ga0187779_10200722 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1248 | Open in IMG/M |
| 3300017965|Ga0190266_10116531 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1133 | Open in IMG/M |
| 3300017997|Ga0184610_1081945 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1001 | Open in IMG/M |
| 3300018027|Ga0184605_10053912 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1716 | Open in IMG/M |
| 3300018052|Ga0184638_1185343 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 737 | Open in IMG/M |
| 3300018053|Ga0184626_10114167 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales → Bacillaceae → Geobacillus → unclassified Geobacillus → Geobacillus sp. WSUCF1 | 1146 | Open in IMG/M |
| 3300018071|Ga0184618_10130781 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1011 | Open in IMG/M |
| 3300018073|Ga0184624_10096342 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales → Bacillaceae → Geobacillus → unclassified Geobacillus → Geobacillus sp. WSUCF1 | 1261 | Open in IMG/M |
| 3300018073|Ga0184624_10238149 | All Organisms → cellular organisms → Bacteria | 815 | Open in IMG/M |
| 3300018073|Ga0184624_10239616 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 813 | Open in IMG/M |
| 3300018074|Ga0184640_10436095 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 585 | Open in IMG/M |
| 3300018422|Ga0190265_11993750 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 686 | Open in IMG/M |
| 3300019867|Ga0193704_1017118 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1472 | Open in IMG/M |
| 3300019884|Ga0193741_1096090 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 758 | Open in IMG/M |
| 3300020020|Ga0193738_1156372 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 605 | Open in IMG/M |
| 3300020081|Ga0206354_10524147 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 543 | Open in IMG/M |
| 3300021078|Ga0210381_10200381 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 696 | Open in IMG/M |
| 3300021080|Ga0210382_10337491 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 665 | Open in IMG/M |
| 3300024178|Ga0247694_1003210 | All Organisms → cellular organisms → Bacteria | 2452 | Open in IMG/M |
| 3300025898|Ga0207692_10399937 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 856 | Open in IMG/M |
| 3300025901|Ga0207688_10424076 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 827 | Open in IMG/M |
| 3300025907|Ga0207645_10394401 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 930 | Open in IMG/M |
| 3300025908|Ga0207643_10244717 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1103 | Open in IMG/M |
| 3300025915|Ga0207693_10300457 | All Organisms → cellular organisms → Bacteria | 1258 | Open in IMG/M |
| 3300025922|Ga0207646_10589284 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 998 | Open in IMG/M |
| 3300025927|Ga0207687_10582297 | All Organisms → cellular organisms → Bacteria | 942 | Open in IMG/M |
| 3300025928|Ga0207700_11531768 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 591 | Open in IMG/M |
| 3300025929|Ga0207664_10365945 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1278 | Open in IMG/M |
| 3300025929|Ga0207664_11401330 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 620 | Open in IMG/M |
| 3300025931|Ga0207644_10465493 | All Organisms → cellular organisms → Bacteria | 1040 | Open in IMG/M |
| 3300025939|Ga0207665_10385992 | All Organisms → cellular organisms → Bacteria | 1064 | Open in IMG/M |
| 3300025939|Ga0207665_10670026 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 814 | Open in IMG/M |
| 3300025944|Ga0207661_11192406 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 701 | Open in IMG/M |
| 3300025945|Ga0207679_11489998 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 621 | Open in IMG/M |
| 3300025949|Ga0207667_11951755 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Propionibacteriaceae | 548 | Open in IMG/M |
| 3300025961|Ga0207712_10139424 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1859 | Open in IMG/M |
| 3300025981|Ga0207640_10939664 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 757 | Open in IMG/M |
| 3300026023|Ga0207677_11375509 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 650 | Open in IMG/M |
| 3300026095|Ga0207676_12180017 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 552 | Open in IMG/M |
| 3300026285|Ga0209438_1167440 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 578 | Open in IMG/M |
| 3300026301|Ga0209238_1282550 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 500 | Open in IMG/M |
| 3300026306|Ga0209468_1061439 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1265 | Open in IMG/M |
| 3300026326|Ga0209801_1103437 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1231 | Open in IMG/M |
| 3300028589|Ga0247818_10805943 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 656 | Open in IMG/M |
| 3300028589|Ga0247818_11210787 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 540 | Open in IMG/M |
| 3300028597|Ga0247820_10901565 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 627 | Open in IMG/M |
| 3300028704|Ga0307321_1085679 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 628 | Open in IMG/M |
| 3300028708|Ga0307295_10123444 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 708 | Open in IMG/M |
| 3300028717|Ga0307298_10261228 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 515 | Open in IMG/M |
| 3300028721|Ga0307315_10147422 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 713 | Open in IMG/M |
| 3300028755|Ga0307316_10367520 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 530 | Open in IMG/M |
| 3300028768|Ga0307280_10317666 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 570 | Open in IMG/M |
| 3300028778|Ga0307288_10489369 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 508 | Open in IMG/M |
| 3300028787|Ga0307323_10314252 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 562 | Open in IMG/M |
| 3300028791|Ga0307290_10101071 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1051 | Open in IMG/M |
| 3300028796|Ga0307287_10015919 | All Organisms → cellular organisms → Bacteria | 2577 | Open in IMG/M |
| 3300028800|Ga0265338_10801822 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 645 | Open in IMG/M |
| 3300028811|Ga0307292_10343612 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 629 | Open in IMG/M |
| 3300028812|Ga0247825_10654550 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 754 | Open in IMG/M |
| 3300028812|Ga0247825_10974354 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 616 | Open in IMG/M |
| 3300028814|Ga0307302_10456326 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 633 | Open in IMG/M |
| 3300028875|Ga0307289_10367112 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 592 | Open in IMG/M |
| 3300028876|Ga0307286_10134261 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 881 | Open in IMG/M |
| 3300028876|Ga0307286_10186951 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 749 | Open in IMG/M |
| 3300028876|Ga0307286_10318281 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 577 | Open in IMG/M |
| 3300028878|Ga0307278_10341870 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 660 | Open in IMG/M |
| 3300028884|Ga0307308_10212782 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 926 | Open in IMG/M |
| 3300030336|Ga0247826_11675374 | All Organisms → cellular organisms → Bacteria | 519 | Open in IMG/M |
| 3300030336|Ga0247826_11721333 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 512 | Open in IMG/M |
| 3300030619|Ga0268386_10467271 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 871 | Open in IMG/M |
| 3300031152|Ga0307501_10056563 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 893 | Open in IMG/M |
| 3300031229|Ga0299913_10234150 | All Organisms → cellular organisms → Bacteria | 1819 | Open in IMG/M |
| 3300031736|Ga0318501_10813775 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 518 | Open in IMG/M |
| 3300031769|Ga0318526_10281296 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 681 | Open in IMG/M |
| 3300031821|Ga0318567_10314885 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 883 | Open in IMG/M |
| 3300031824|Ga0307413_10544011 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 941 | Open in IMG/M |
| 3300031846|Ga0318512_10512161 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 609 | Open in IMG/M |
| 3300031892|Ga0310893_10550901 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 523 | Open in IMG/M |
| 3300031903|Ga0307407_10639604 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 796 | Open in IMG/M |
| 3300031939|Ga0308174_10815224 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 785 | Open in IMG/M |
| 3300031939|Ga0308174_11053264 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 691 | Open in IMG/M |
| 3300032010|Ga0318569_10560053 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 532 | Open in IMG/M |
| 3300032039|Ga0318559_10401332 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 639 | Open in IMG/M |
| 3300032054|Ga0318570_10379618 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 644 | Open in IMG/M |
| 3300032089|Ga0318525_10133470 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1272 | Open in IMG/M |
| 3300032126|Ga0307415_101698229 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Frankiales → Frankiaceae | 609 | Open in IMG/M |
| 3300032897|Ga0335071_10191383 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1999 | Open in IMG/M |
| 3300033004|Ga0335084_11089200 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 802 | Open in IMG/M |
| 3300033551|Ga0247830_11240019 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 596 | Open in IMG/M |
| 3300034176|Ga0364931_0249941 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 583 | Open in IMG/M |
| 3300034384|Ga0372946_0103094 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium 70-9 | 1338 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 19.47% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 6.32% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 5.79% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 5.26% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 5.26% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 4.74% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.68% |
| Polar Desert Sand | Environmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand | 3.16% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 3.16% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 3.16% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 3.16% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 3.16% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.63% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.58% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 1.58% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.58% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 1.58% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 1.58% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 1.58% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.58% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.58% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 1.58% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 1.05% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.05% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.05% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 1.05% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.05% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.05% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 1.05% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 0.53% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 0.53% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.53% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.53% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.53% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil | 0.53% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.53% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.53% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.53% |
| Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 0.53% |
| Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 0.53% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.53% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.53% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.53% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.53% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 0.53% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.53% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.53% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000550 | Amended soil microbial communities from Kansas Great Prairies, USA - BrdU amended with acetate total DNA F2.4 TB clc assemly | Environmental | Open in IMG/M |
| 3300003987 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleB_D2 | Environmental | Open in IMG/M |
| 3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
| 3300004153 | Grasslands soil microbial communities from Hopland, California, USA (version 2) | Environmental | Open in IMG/M |
| 3300005171 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126 | Environmental | Open in IMG/M |
| 3300005172 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 | Environmental | Open in IMG/M |
| 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Environmental | Open in IMG/M |
| 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Environmental | Open in IMG/M |
| 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Host-Associated | Open in IMG/M |
| 3300005554 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 | Environmental | Open in IMG/M |
| 3300005556 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 | Environmental | Open in IMG/M |
| 3300005558 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 | Environmental | Open in IMG/M |
| 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Host-Associated | Open in IMG/M |
| 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Host-Associated | Open in IMG/M |
| 3300005587 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103 | Environmental | Open in IMG/M |
| 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Host-Associated | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Host-Associated | Open in IMG/M |
| 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Host-Associated | Open in IMG/M |
| 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
| 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Host-Associated | Open in IMG/M |
| 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Host-Associated | Open in IMG/M |
| 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Host-Associated | Open in IMG/M |
| 3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
| 3300006058 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Host-Associated | Open in IMG/M |
| 3300006578 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLMA (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006581 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLPB (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006605 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHAB (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Host-Associated | Open in IMG/M |
| 3300006953 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHMB (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
| 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Host-Associated | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009789 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot28 | Environmental | Open in IMG/M |
| 3300009823 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_40_50 | Environmental | Open in IMG/M |
| 3300009840 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105A | Environmental | Open in IMG/M |
| 3300010036 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot26 | Environmental | Open in IMG/M |
| 3300010038 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot106 | Environmental | Open in IMG/M |
| 3300010041 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot104A | Environmental | Open in IMG/M |
| 3300010042 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105B | Environmental | Open in IMG/M |
| 3300010044 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot60 | Environmental | Open in IMG/M |
| 3300010045 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot61 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
| 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
| 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Host-Associated | Open in IMG/M |
| 3300012092 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ445A (23.06) | Environmental | Open in IMG/M |
| 3300012094 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ858 (22.06) | Environmental | Open in IMG/M |
| 3300012350 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012355 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaG | Environmental | Open in IMG/M |
| 3300012358 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012529 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ568 (21.06) | Environmental | Open in IMG/M |
| 3300012680 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ224A (23.06) | Environmental | Open in IMG/M |
| 3300012682 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ223 (23.06) | Environmental | Open in IMG/M |
| 3300012899 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S058-202B-2 | Environmental | Open in IMG/M |
| 3300012908 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S089-202R-1 | Environmental | Open in IMG/M |
| 3300012955 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MG | Environmental | Open in IMG/M |
| 3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
| 3300012958 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MG | Environmental | Open in IMG/M |
| 3300012961 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG | Environmental | Open in IMG/M |
| 3300012976 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_0_1 metaG | Environmental | Open in IMG/M |
| 3300012984 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MG | Environmental | Open in IMG/M |
| 3300012985 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MG | Environmental | Open in IMG/M |
| 3300012988 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MG | Environmental | Open in IMG/M |
| 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
| 3300014150 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Host-Associated | Open in IMG/M |
| 3300015077 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S178-409R-2 (version 2) | Environmental | Open in IMG/M |
| 3300015358 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300017959 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MG | Environmental | Open in IMG/M |
| 3300017965 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 220 T | Environmental | Open in IMG/M |
| 3300017997 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_coex | Environmental | Open in IMG/M |
| 3300018027 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_coex | Environmental | Open in IMG/M |
| 3300018052 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b2 | Environmental | Open in IMG/M |
| 3300018053 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_b1 | Environmental | Open in IMG/M |
| 3300018071 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_b1 | Environmental | Open in IMG/M |
| 3300018073 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_5_b1 | Environmental | Open in IMG/M |
| 3300018074 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b2 | Environmental | Open in IMG/M |
| 3300018422 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 T | Environmental | Open in IMG/M |
| 3300019867 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3m1 | Environmental | Open in IMG/M |
| 3300019884 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L2s2 | Environmental | Open in IMG/M |
| 3300020020 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L2a1 | Environmental | Open in IMG/M |
| 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300021078 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5_coex redo | Environmental | Open in IMG/M |
| 3300021080 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_coex redo | Environmental | Open in IMG/M |
| 3300024178 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK35 | Environmental | Open in IMG/M |
| 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026285 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026301 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026306 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102 (SPAdes) | Environmental | Open in IMG/M |
| 3300026326 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 (SPAdes) | Environmental | Open in IMG/M |
| 3300028589 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Glucose_Day1 | Environmental | Open in IMG/M |
| 3300028597 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Glucose_Day14 | Environmental | Open in IMG/M |
| 3300028704 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_379 | Environmental | Open in IMG/M |
| 3300028708 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_152 | Environmental | Open in IMG/M |
| 3300028717 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_158 | Environmental | Open in IMG/M |
| 3300028721 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_355 | Environmental | Open in IMG/M |
| 3300028755 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_356 | Environmental | Open in IMG/M |
| 3300028768 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_119 | Environmental | Open in IMG/M |
| 3300028778 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_142 | Environmental | Open in IMG/M |
| 3300028787 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_381 | Environmental | Open in IMG/M |
| 3300028791 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_144 | Environmental | Open in IMG/M |
| 3300028796 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_141 | Environmental | Open in IMG/M |
| 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Host-Associated | Open in IMG/M |
| 3300028811 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_149 | Environmental | Open in IMG/M |
| 3300028812 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Vanillin_Day48 | Environmental | Open in IMG/M |
| 3300028814 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_183 | Environmental | Open in IMG/M |
| 3300028875 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_143 | Environmental | Open in IMG/M |
| 3300028876 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_140 | Environmental | Open in IMG/M |
| 3300028878 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_117 | Environmental | Open in IMG/M |
| 3300028884 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_195 | Environmental | Open in IMG/M |
| 3300030336 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day1 | Environmental | Open in IMG/M |
| 3300030619 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT150D86 (Novaseq) | Environmental | Open in IMG/M |
| 3300031152 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 15_S | Environmental | Open in IMG/M |
| 3300031229 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT155D38 | Environmental | Open in IMG/M |
| 3300031736 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f21 | Environmental | Open in IMG/M |
| 3300031769 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f24 | Environmental | Open in IMG/M |
| 3300031821 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f20 | Environmental | Open in IMG/M |
| 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Host-Associated | Open in IMG/M |
| 3300031846 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f19 | Environmental | Open in IMG/M |
| 3300031892 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D2 | Environmental | Open in IMG/M |
| 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Host-Associated | Open in IMG/M |
| 3300031939 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R2 | Environmental | Open in IMG/M |
| 3300032010 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f22 | Environmental | Open in IMG/M |
| 3300032039 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f21 | Environmental | Open in IMG/M |
| 3300032054 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f23 | Environmental | Open in IMG/M |
| 3300032089 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f23 | Environmental | Open in IMG/M |
| 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Host-Associated | Open in IMG/M |
| 3300032897 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.5 | Environmental | Open in IMG/M |
| 3300033004 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4 | Environmental | Open in IMG/M |
| 3300033551 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day5 | Environmental | Open in IMG/M |
| 3300034176 | Sediment microbial communities from East River floodplain, Colorado, United States - 21_j17 | Environmental | Open in IMG/M |
| 3300034384 | Forest soil microbial communities from Eldorado National Forest, California, USA - SNFC_MG_KNG_2.2 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| F24TB_129170172 | 3300000550 | Soil | ERTLQLGYVPRDVAPSLEGDEQAVSLWRVEGGLRVLIVPASAWIGQPR* |
| Ga0055471_100912271 | 3300003987 | Natural And Restored Wetlands | ERTLQVGYVPRDVAPDLRGDEQALSLWRVEGGLRVLIAPADAWIATPRS* |
| Ga0062593_1020631592 | 3300004114 | Soil | GYVPREVAPELTGDEQAVSLWRVEGGLRVLIAPADAWIGQPRS* |
| Ga0063455_1013909631 | 3300004153 | Soil | YVPREVAAELQGDEQAVSLWRVEAGLRVLIVPHDAWVGRPR* |
| Ga0066677_107936171 | 3300005171 | Soil | PRETAAELAGDEQAVSLWRVEGGLRVLIVPSNAWVGTPR* |
| Ga0066683_108801632 | 3300005172 | Soil | RETAAELAGDEQAVSLWRVEGGLRVLIVPADAWVGTPRP* |
| Ga0070687_1013112331 | 3300005343 | Switchgrass Rhizosphere | VPREVAPELAGDEQAYSLWRVEGGLRVLIVPAGSWVGTPR* |
| Ga0070694_1008288271 | 3300005444 | Corn, Switchgrass And Miscanthus Rhizosphere | ERTLQAGYVPREVAPELAGDEQAYSLWRVEGGLRVLIVPAGSWVGTPR* |
| Ga0070663_1002836653 | 3300005455 | Corn Rhizosphere | PRDAAPELVGDELAVSLWRAGAEGLRVLLVPAGSWVGRPRR* |
| Ga0066661_109394172 | 3300005554 | Soil | YVPADTAPQLRGDEQAIALWRVEGGLRVLLAPADAWIGRPR* |
| Ga0066707_107140761 | 3300005556 | Soil | LQAGYVPRETAAELAGDEQAVSLWRVEGGLRVLIVPADAWVGRPRP* |
| Ga0066698_108526001 | 3300005558 | Soil | GYVPRDVAPELRGDEQAVSLWRVDDGLRVLIAPVDAWIGTPR* |
| Ga0068857_1005326561 | 3300005577 | Corn Rhizosphere | PELTGDEQAVSLWRVEGGLRVLIAPADAWIGQPRS* |
| Ga0068854_1020754882 | 3300005578 | Corn Rhizosphere | RTLQAGYVPREVAPELGGDEQAYSLWRVEGGLRVLIVPAGSWVGTPR* |
| Ga0066654_102076962 | 3300005587 | Soil | AGYVPRETAAELGGDEQAVSLWRVEGGLRVLIVPADAWVGTPR* |
| Ga0068856_1023673281 | 3300005614 | Corn Rhizosphere | APELAGDELVVSLWRRGEGLRVLVAPAGSWVGRPRR* |
| Ga0066905_1012166621 | 3300005713 | Tropical Forest Soil | RTLQAGYVPATVAPELAGDEQAVSLWRPEGGLRVLIAPAGAWIGRPR* |
| Ga0066903_1035783681 | 3300005764 | Tropical Forest Soil | QAGYVPREVAPELQGDEQAVSLWRVEGGLRVLIVPADAWVGTPR* |
| Ga0066903_1049411811 | 3300005764 | Tropical Forest Soil | DAPGLAGDEQAVSIWRTDGGLRVLIAPADAWIGRPRP* |
| Ga0068851_104898473 | 3300005834 | Corn Rhizosphere | VPREVAPELTGDEQAVSLWRVEGGLRVLIAPADAWIGQPRS* |
| Ga0068870_102953801 | 3300005840 | Miscanthus Rhizosphere | VAPELSGNEQAVSLWRVDGGLRVLIVPADAWVGRPR* |
| Ga0068860_1020608011 | 3300005843 | Switchgrass Rhizosphere | VAPELAGDEQAYSLWRVEGGLRVLIVPAGSWVGTPR* |
| Ga0081455_1000755215 | 3300005937 | Tabebuia Heterophylla Rhizosphere | VGYVPRDATERLTGDEQAVSLWRVEGGLRVLIVPPEAWVGQPR* |
| Ga0081455_103953161 | 3300005937 | Tabebuia Heterophylla Rhizosphere | VAPELSGDEQAVSLWRVEGGLRVLIVPSDAWVGTPR* |
| Ga0081538_103378791 | 3300005981 | Tabebuia Heterophylla Rhizosphere | TAAELRGDEQAVSLWRVEGGLRVLIAPADAWVGRPR* |
| Ga0081539_103160931 | 3300005985 | Tabebuia Heterophylla Rhizosphere | ASELDGSEQAMSLWRVDGGLRILIVPKGAWIGRPRR* |
| Ga0066652_1004777001 | 3300006046 | Soil | GDRTLQVGYVPRDIAAELDGSEQAVSLWRVDGGLRVLIAPAGAWIGRPRR* |
| Ga0066652_1006719312 | 3300006046 | Soil | VPRETAAELAGDEQAVSLWRVEGGLRVLIVPSNAWVGTPR* |
| Ga0066652_1008504231 | 3300006046 | Soil | TLQAGYVPAETAPTLRGDEQAVSLWRVEGGLRVLLAPPDTWIGRPR* |
| Ga0075432_102019461 | 3300006058 | Populus Rhizosphere | GYVPRETAAELAGDEQAVSLWRVEGGLRVLIVPADAWVGRPRL* |
| Ga0074059_121024511 | 3300006578 | Soil | ERTLQLGYVPRDDAPRLAGDEQAVSIWRTDGGLRVLIARADTWIGQPR* |
| Ga0074048_100110242 | 3300006581 | Soil | APELAGDEQAVSLWRTEGGLRALIAPADAWVGRPR* |
| Ga0074048_100118212 | 3300006581 | Soil | GYVPRDVAPELAGDEQAVSLWRVDGGLRVLIAPADAWIGRPR* |
| Ga0074057_100398242 | 3300006605 | Soil | EMAPELAGDEQAVSLWRTEGGLRALIAPADAWVGRPR* |
| Ga0075428_1018094822 | 3300006844 | Populus Rhizosphere | VGYVPAAVAPELAGDEQALSLWRVEGGLRVLIVPAGTWVGTPR* |
| Ga0075433_1000681911 | 3300006852 | Populus Rhizosphere | VPRETAAELGGDEQAVSLWRVEGGLRVLIVPADAWVGRPS* |
| Ga0075425_1009621033 | 3300006854 | Populus Rhizosphere | YVPRDVAPELAGDEQAVSLWRVEGGLRVLIVPADAWVGRPR* |
| Ga0075425_1016101623 | 3300006854 | Populus Rhizosphere | QVGYVPREVAPEVRGDEQAVSLWRVDGGLRVLLAPADAWIGTPH* |
| Ga0075429_1017623951 | 3300006880 | Populus Rhizosphere | PELRGDEQAVSLWRVDGGLRVLIVAADAWVATPRV* |
| Ga0074063_100598122 | 3300006953 | Soil | TLQAGYVPRDVAPELSGDEQAYSLWRVEGGLRVLVVPAGSWVGTPR* |
| Ga0079219_103406732 | 3300006954 | Agricultural Soil | VAAELGGDEQAVSLWRVEGGLRVLIVPATAWVGTPR* |
| Ga0105251_106581911 | 3300009011 | Switchgrass Rhizosphere | TAAELAGDEQAVSLWRVEGGLRVLIVPPDAWVGRPRL* |
| Ga0066710_1049037621 | 3300009012 | Grasslands Soil | IGYVPREDAPRLAGEEQAVSIWRTEGGLRVLIAPADAWIGRPR |
| Ga0099829_109165371 | 3300009038 | Vadose Zone Soil | IAPELSGDEQAISLWRVDGGLRVLIAPRDAWIGTPR* |
| Ga0105245_130393102 | 3300009098 | Miscanthus Rhizosphere | NAQLTVQAGYVPRDVAPELTGDEQAVSLWRVEGGLRVLIAPADAWIGRPR* |
| Ga0066709_1019232692 | 3300009137 | Grasslands Soil | YVPAETAPQLRGDEQAVTLWRVEGGLRVLLAPADAWIGRPR* |
| Ga0066709_1033075972 | 3300009137 | Grasslands Soil | YVPRETAAELGGDEQAVSLWRVEGGLRVLIVPPDAWVGTPR* |
| Ga0066709_1035420353 | 3300009137 | Grasslands Soil | YVPRDVAPDLRGDEQAVSLWRVDGGLRVLIAPADAWIGSPR* |
| Ga0105248_128957962 | 3300009177 | Switchgrass Rhizosphere | LQVGYVPREVAPELAGDEQAVSLWRVDGGLRVLIVSPDTWVADPR* |
| Ga0126307_116150451 | 3300009789 | Serpentine Soil | IAPELGGDEQAVSIWRVEGGLRVLIAPADAWIGTPRS* |
| Ga0105078_10632031 | 3300009823 | Groundwater Sand | AGYVPAVVAPDLHGDEQAVSLWRVEGGLRVLIVPADAWVGTPR* |
| Ga0126313_100226001 | 3300009840 | Serpentine Soil | NADHTVHAGYVPRETAPDLDGSEQAVSLWRVEGGLRVLIAPRDAWIGHPR* |
| Ga0126313_101300823 | 3300009840 | Serpentine Soil | GYVPAAIAPELAGDEQALSLWRVEGGLRVLIVPAGTWLGTPR* |
| Ga0126313_105583733 | 3300009840 | Serpentine Soil | AGYVPREVAPELNGDEQAVSIWRVEGGLRVLIAPADAWIGRPHW* |
| Ga0126313_106303861 | 3300009840 | Serpentine Soil | AVAAELSGDEQAVSLWRAGEGLRILLVPADAWVGRPRR* |
| Ga0126313_111817181 | 3300009840 | Serpentine Soil | RETAAELVGDEQAVSLWRVEGGLRVLIAPPDAWIGQPR* |
| Ga0126305_101140741 | 3300010036 | Serpentine Soil | TAPELRGDEQAVSLWRVEGGLRVLIAPADAWLGVPRSLS* |
| Ga0126315_100173887 | 3300010038 | Serpentine Soil | RTLQVGYVPRDVAPEVRGDEQAVSLWRVEGGLRVLIAPPDAWIGTPR* |
| Ga0126312_108616472 | 3300010041 | Serpentine Soil | LQVGYVPREVAPELRGDEQAMSLWRVDGGLRVLIAPADAWIASPR* |
| Ga0126314_103714001 | 3300010042 | Serpentine Soil | PRETAAELGGDEQAVSLWRVEAGLRVLIVPHDAWVGRPR* |
| Ga0126310_110659321 | 3300010044 | Serpentine Soil | GYVPRDIAPDVHGDEQAVSLWRVDGGLRVLIAPADAWIGTPR* |
| Ga0126311_112324421 | 3300010045 | Serpentine Soil | ARTLQVGYLPRAVASELRGDEQAMSLWRVDGGLRVLIAPADAWIASPR* |
| Ga0126377_129258061 | 3300010362 | Tropical Forest Soil | LQVGYVPREVAPDVRGDEQAVSLWRVDGGLRVLIAPADAWIGTPH* |
| Ga0134125_112261662 | 3300010371 | Terrestrial Soil | ELAGDEQAVSLWRVEGGLRVLIVPRDAWVGTPRPR* |
| Ga0105239_106265383 | 3300010375 | Corn Rhizosphere | RTLQAGYVPREVAPELTGDEQAVSLWRVEGGLRVLIAPADAWIGQPRS* |
| Ga0105239_125974042 | 3300010375 | Corn Rhizosphere | GYVPRDVAPQLAGDEQAVSLWRAGEGLRVLLVPPTAWVGRPRR* |
| Ga0134124_126941082 | 3300010397 | Terrestrial Soil | AGGYVPRDLAPEVRGDEQAVSLWRVEGGLRVLIAPRDAWVGRPR* |
| Ga0105246_105269763 | 3300011119 | Miscanthus Rhizosphere | PELAGDEQAYSLWRVEGGLRVLIVPAGSWVGTPR* |
| Ga0136621_13990021 | 3300012092 | Polar Desert Sand | LQLGYVPAAVAPEVTGDEQALSLWRVDGGLRILIVPADAWIGAPR* |
| Ga0136638_106274351 | 3300012094 | Polar Desert Sand | AIAPALHGDEQALSLWRVDGGLRVLIAPANAWLGTPR* |
| Ga0137372_1002403110 | 3300012350 | Vadose Zone Soil | YVPRASAPTLTGDEQAFSLWRLDGGLRVLIVPADAWVGRPR* |
| Ga0137372_101261551 | 3300012350 | Vadose Zone Soil | RTLQAGYVPRETAAELAGDEQAVSLWRVEGGLRVLVVPADAWVATPRR* |
| Ga0137369_110417851 | 3300012355 | Vadose Zone Soil | EVAAELDGSEQAVSLWRVEGGLRVLIVPADAWIGWPRG* |
| Ga0137368_108540061 | 3300012358 | Vadose Zone Soil | QVGYVPRDVAPELRGDEQAVSLWRVDGGLRVLIVPAEAWVATPRR* |
| Ga0137385_116699132 | 3300012359 | Vadose Zone Soil | APEVKGDEQAMSLWRVDAGLRVLIVPRDAWVGTPR* |
| Ga0136630_10498833 | 3300012529 | Polar Desert Sand | SAVAPELAGDEQAVSLWRVEGGLRVLIAPRDAWIGTPR* |
| Ga0136612_100055691 | 3300012680 | Polar Desert Sand | NRSLQAGYVPAAVAPELAGDEQAVSLWRVEGGLRVLIAPRDAWIGAPR* |
| Ga0136612_103257852 | 3300012680 | Polar Desert Sand | QLGYVPASVAPALTGDEQAVSLWRVDGGLRVLIVPANAWIATPR* |
| Ga0136611_109251291 | 3300012682 | Polar Desert Sand | ELRGDEQAVSLWRVDGGLRILIVPAEAWLGIPLSGPR* |
| Ga0157299_102133311 | 3300012899 | Soil | ERTLQVGYVPAAVAPELAGDEQALALWRVEAGLRVLIAPAGAWIGTPR* |
| Ga0157286_103169511 | 3300012908 | Soil | RTLQAGYVPRETVAELAGDEQAVSLWRVEGGLRVLIVPPDAWVGTPRR* |
| Ga0164298_101709872 | 3300012955 | Soil | VPRDVAPELDGTEQAVSLWRAGEGLRVLIAPRDAWIGRPRR* |
| Ga0164303_102649322 | 3300012957 | Soil | AGYVPRDVAPELDGTEQAVSLWRAGEGLRVLIAPRDAWIGRPRR* |
| Ga0164299_100645524 | 3300012958 | Soil | APDLDGTELAVSLWRFGEEGLRVLLVPAGSWVGRPRR* |
| Ga0164302_105554072 | 3300012961 | Soil | AGYVPREVAPELDGDEQALSLWRVEGGLRVLVVPADAWLGTPR* |
| Ga0134076_103457142 | 3300012976 | Grasslands Soil | YVPRETAAELGRDEQAFSLWRVERGLRVLIVPPDAWVGTPR* |
| Ga0164309_119034732 | 3300012984 | Soil | RTLQVGYVPRDVAAELEGNEQAISLWRVEGGLRVLIVPPNAWVGTPR* |
| Ga0164308_102107613 | 3300012985 | Soil | PRDVAPDLDGSEQAVSLWRAGEGLRVLIAPRDAWIGRPRR* |
| Ga0164308_111304091 | 3300012985 | Soil | RTLQLGYVPREDAPRLAGDEQAVSIWRTEGGLRVLIAPADAWVGRPR* |
| Ga0164306_100744232 | 3300012988 | Soil | VPREVAAELAGDEQAISIWRAGEGLRILLVPPTAWVGRPRR* |
| Ga0164306_120294002 | 3300012988 | Soil | PRDVAAELEGNEQAISLWRVEGGLRVLIVPPNAWVGTPR* |
| Ga0163162_126796331 | 3300013306 | Switchgrass Rhizosphere | VPRDLAPEVRGDEQAVSLWRVEGGLRVLIAPRDAWVGRPR* |
| Ga0134081_103939372 | 3300014150 | Grasslands Soil | REEAPALDGTELAVSLWRFGDGLRVLLVPAGSWVGRPRR* |
| Ga0182008_104049341 | 3300014497 | Rhizosphere | PELAGDELAVSLWRAGEGLRVLIVPAGSWVGKPRR* |
| Ga0182008_109187262 | 3300014497 | Rhizosphere | QAGYVPREVAAELDGEEQAVSLWRVEGGLRVLIVPEDAWVGMPRR* |
| Ga0182008_109294522 | 3300014497 | Rhizosphere | LQAGYVPREVAPELAGDELAYSLWRVEGGLRVLVVPAGSWVGTPR* |
| Ga0173483_107231672 | 3300015077 | Soil | VPAAIAPELAGDEQAISLWRVDGGLRVLLVPADAWLGTPRR* |
| Ga0134089_102641921 | 3300015358 | Grasslands Soil | LGYVPREDAPRLSGGEQAVSIWRTDGGLRVLIAPADAWIGRPR* |
| Ga0132257_1043817061 | 3300015373 | Arabidopsis Rhizosphere | AGYVPREVAPELGGDEQAVSLWRVDGGLRVLIAPAAAWIGTPR* |
| Ga0187779_102007221 | 3300017959 | Tropical Peatland | PREVAPELDGTELAVSLWRFGEGLRILVVPAGSWVGRPRR |
| Ga0190266_101165313 | 3300017965 | Soil | ELAPQLKGDEQAISLWRVEGGLRVLIVPADAWVGRPR |
| Ga0184610_10819451 | 3300017997 | Groundwater Sediment | EERTLQLGYVPREIAAELGGDEQAVSLWRVEAGLRVLIVPRDAWVGRPR |
| Ga0184605_100539121 | 3300018027 | Groundwater Sediment | AGYVPREAAPGLSGDEQAISLWRPEGGLRVLIVPADAWIGTPR |
| Ga0184638_11853432 | 3300018052 | Groundwater Sediment | VPREVARELAGDEQALCLWRFEGGLRMLIAPADAWSGGPGRFSRRGV |
| Ga0184626_101141671 | 3300018053 | Groundwater Sediment | IAPKLTGDEQAVSLWRVEGGLRVLIVPADAWVGRPR |
| Ga0184618_101307811 | 3300018071 | Groundwater Sediment | VPRETAAELGGDEQAVSLWRVEGGLRVLIVPHDAWVGRPR |
| Ga0184624_100963421 | 3300018073 | Groundwater Sediment | VPREDAPRLAGNEQAVSIWRTDGGLRVLIAPADAWIGRPR |
| Ga0184624_102381493 | 3300018073 | Groundwater Sediment | VPRDVAPALEGDEQAVSLWRVDGGLRVLIAPATAWIGQPR |
| Ga0184624_102396161 | 3300018073 | Groundwater Sediment | GYVPREVAPELVGDEQAVSLWRVEGGLRVLIAPADAWIGRPR |
| Ga0184640_104360951 | 3300018074 | Groundwater Sediment | VGYVPAAIAPELAGDEQALSLWRVEGGLRVLIVPADAWLGTPR |
| Ga0190265_119937501 | 3300018422 | Soil | PELRGDEQAVSLWRVDGGLRVLIVPADAWVGSPRPNR |
| Ga0193704_10171181 | 3300019867 | Soil | APEVAGDEQAVSLWRVEGGLRVLIVPPDAWVGRPR |
| Ga0193741_10960902 | 3300019884 | Soil | VGYVPREIAPQLAGDEQAISLWRVEGGLRVLIVPADAWVGRPR |
| Ga0193738_11563722 | 3300020020 | Soil | QVGYVPREIAPQLAGDEQAISLWRVEGGLRVLIVPADAWVGRPR |
| Ga0206354_105241471 | 3300020081 | Corn, Switchgrass And Miscanthus Rhizosphere | GYVPREVAAELDRSALAFSLWRAGESGLRVLLVPPGSWVGRPRRER |
| Ga0210381_102003811 | 3300021078 | Groundwater Sediment | AAELGGDEQAVSLWRVEAGLRVLIVPRDAWVGRPR |
| Ga0210382_103374911 | 3300021080 | Groundwater Sediment | LQLGYVPRDVAPTVSGDEQALSIWRSEGGLRVLIVPPDAWVGRPR |
| Ga0247694_10032105 | 3300024178 | Soil | EVAPDLDGDEQAVSLWRVEGGLRVLLVPADAWVGTPR |
| Ga0207692_103999371 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | AGYVPRETAAELGGDEQAVSLWRVEGGLRVLIVPADAWVGRPS |
| Ga0207688_104240761 | 3300025901 | Corn, Switchgrass And Miscanthus Rhizosphere | APELSGDEQAYSLWRVEGGLRVLVVPAGSWVGTPR |
| Ga0207645_103944013 | 3300025907 | Miscanthus Rhizosphere | EASELDGTELAVSLWRMGEGLRVLLVPAGSWVGRPRR |
| Ga0207643_102447171 | 3300025908 | Miscanthus Rhizosphere | EVAPELSGNEQAVSLWRVDGGLRVLIVPADAWVGRPR |
| Ga0207693_103004573 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | QLGYIPRETAAELGGDEQAVSLWRVEGGLRVLIVPPDAWVGRPR |
| Ga0207646_105892841 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | RTLQAGYVPRETAAELGGDEQAVSLWRVEGGLRVLIVPADAWVGTPRL |
| Ga0207687_105822971 | 3300025927 | Miscanthus Rhizosphere | PRDVAPGLSGDEQAYSLWRVEGGLRVLVVPAGSWVGTPR |
| Ga0207700_115317682 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | VAVTLNGDEQAVSLWRAGEGLRVLIVPAGSWVGRPR |
| Ga0207664_103659452 | 3300025929 | Agricultural Soil | TLQAGYVPRETAAELGGDEQAVSLWRVEGGLRVLIVPADAWVGTPRP |
| Ga0207664_114013301 | 3300025929 | Agricultural Soil | VAVEIRGDEQAVSLWRVDGGLRVLIAPGDAWIGTPR |
| Ga0207644_104654931 | 3300025931 | Switchgrass Rhizosphere | GCVPRDVAPELSGDEQAYSLWRVEGGLRVLVVPAGSWVGTPR |
| Ga0207665_103859922 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | REVAAELDGSEQAVALWRAGEGLRVLLAPKGAWIGRPRR |
| Ga0207665_106700261 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | APDLAGDELAVSLWRAGEGLRILLVPAGSWVGRPRR |
| Ga0207661_111924061 | 3300025944 | Corn Rhizosphere | DRSLQVGYVPREVAPELAGDEQAVSLWRVDGGLRVLIVSPDTWVADPR |
| Ga0207679_114899982 | 3300025945 | Corn Rhizosphere | VPRDVAPQLAGDEQAVSLWRAGEGLRVLLVPPTAWVGRPRR |
| Ga0207667_119517552 | 3300025949 | Corn Rhizosphere | APELVGDELAVSLWRAGAEGLRVLLVPAGSWVGRPRR |
| Ga0207712_101394241 | 3300025961 | Switchgrass Rhizosphere | AGYIPRETAAELAGDEQAVSLWRVEGGLRVLIVPPDAWVGRPRP |
| Ga0207640_109396641 | 3300025981 | Corn Rhizosphere | PREVAPELTGDEQAVSLWRVEGGLRVLIAPADAWIGQPRS |
| Ga0207677_113755091 | 3300026023 | Miscanthus Rhizosphere | VPRGTAPDLDGTELAVSLWRFGEEGLRVLLAPAGSWVGRPRR |
| Ga0207676_121800171 | 3300026095 | Switchgrass Rhizosphere | GYVPREVAPELGGDEQAYSLWRVEGGLRVLIVPAGSWVGTPR |
| Ga0209438_11674402 | 3300026285 | Grasslands Soil | ETAAELAGDEQAVSLWRVEGGLRVLIVPPDAWVGRPR |
| Ga0209238_12825501 | 3300026301 | Grasslands Soil | ETAAELGGDEQAVSLWRVEGGLRVLIVPRDAWVGTPR |
| Ga0209468_10614391 | 3300026306 | Soil | EEQTLHAGYVPRETAPELIGDEQAVSLWRVEGSLRVLIVPADAWVGTPRPG |
| Ga0209801_11034371 | 3300026326 | Soil | RALQAGYVPRETAAELGGDEQAVSLWRVEGGLRVLIVPSNAWVGTPRP |
| Ga0247818_108059431 | 3300028589 | Soil | ERALQLGYVPAAIAPELAGDEQALSLWRVDGGLRVLIAPADAAGT |
| Ga0247818_112107872 | 3300028589 | Soil | QAGYVPREVAPELAGDEQALSLWRVEGGLRVLIVPADAWLGTPR |
| Ga0247820_109015652 | 3300028597 | Soil | AQAALDAPELAGDEQAVSLWRVEGGLRVLIVPRDAWVGTPHR |
| Ga0307321_10856792 | 3300028704 | Soil | RDVAPELGGDEQAVSLWRLEGGLRVLIAPADAWIGHPR |
| Ga0307295_101234442 | 3300028708 | Soil | GYVPRDLAPEVRGDEQAVSLWRVEGGLRVLIAPRDAWVGRPR |
| Ga0307298_102612282 | 3300028717 | Soil | VPRDLAPEVRGDEQAVSLWRVEGGLRVLIAPRDAWVGRPR |
| Ga0307315_101474222 | 3300028721 | Soil | LQLGYVPREVAPELAGDEQAVSLWRVEGGLRVLIVPPDAWVGRPR |
| Ga0307316_103675201 | 3300028755 | Soil | PREVAPELAGDEQAVSLWRVEGGLRVLIVPPDAWVGRPR |
| Ga0307280_103176661 | 3300028768 | Soil | LQAGYVPRDLAPEVRGDEQAVSLWRVEGGLRVLIAPRDAWVGRPR |
| Ga0307288_104893692 | 3300028778 | Soil | PREILAELGGDEQAVSLWRVEAGLRVLIVPHDAWVGRPR |
| Ga0307323_103142521 | 3300028787 | Soil | QARTLQAGYVPRDVAPELEGNEQAISLWRVEGGLRVLIVPPDAWVGTPR |
| Ga0307290_101010712 | 3300028791 | Soil | RDVAPQLKGDEQAISLWRVEGGLRVLIAPPDAWVGRPR |
| Ga0307287_100159195 | 3300028796 | Soil | AAALGGDEQAISLWRVEAGLRVLIVPHDAWVGRPR |
| Ga0265338_108018222 | 3300028800 | Rhizosphere | AGYVPRNVVAELDGSEQAVSLWRSGEGLRILLVPADAWVGRPRR |
| Ga0307292_103436122 | 3300028811 | Soil | EERSLQLGYVPRDRTAELRGDEQAVSLWRVEGGLRVLIIPANAWVGTPR |
| Ga0247825_106545502 | 3300028812 | Soil | LQLGYVPRETAAELGGDEQAVSLWRVEGGLRVLIVPPDAWVGRPR |
| Ga0247825_109743543 | 3300028812 | Soil | YVPAAIAPELAGDEQALSLWRVDGGLRVLIAPAGAWLGTPR |
| Ga0307302_104563261 | 3300028814 | Soil | GYVPRDVAPELEGDEQEVSLWRFEGGLRVLIAPADAWLGLPR |
| Ga0307289_103671121 | 3300028875 | Soil | VPREVAPELSGDEQAVSLWRVDGGLRVLIVPGDAWLGTPR |
| Ga0307286_101342611 | 3300028876 | Soil | APRLAGDEQAVSIWRTDGGLRVLIAPADAWIGRPR |
| Ga0307286_101869511 | 3300028876 | Soil | TLQAGYVPRDVALELQGDEQAISLWRVEGGLRVLIVPPDAWVGTPR |
| Ga0307286_103182812 | 3300028876 | Soil | LQAGYVPRDVAPELAGDEQAVSLWRVDGGLRVLVVPRDTWVGAPR |
| Ga0307278_103418702 | 3300028878 | Soil | ETATELTGDEQAVSLWRVEGGLRVLIVPAGAWVGTPR |
| Ga0307308_102127822 | 3300028884 | Soil | AGYVPREMAVELGGDEQAVSLWRVEGGLRVLIVPPDAWVGLPR |
| Ga0247826_116753741 | 3300030336 | Soil | GYVPAAVAPELRGDEQAVSLWRVEGGLRVLIVPADAWVGTPR |
| Ga0247826_117213331 | 3300030336 | Soil | YVPREVAPELAGDEQALSLWRVEGGLRVLIVPADAWLGTPR |
| Ga0268386_104672713 | 3300030619 | Soil | QLGYVPAAVAPELVGDEQAVSLWRVDGGLRVLIVPADAWIGAPS |
| Ga0307501_100565632 | 3300031152 | Soil | TAAELGGDEQAVSLWRVEAGLRVLIVPHDAWVGRPR |
| Ga0299913_102341503 | 3300031229 | Soil | LQLGYVPAAVAPELSGAEQAVSLWRVEGGLRVLLAPADAWLGTPR |
| Ga0318501_108137752 | 3300031736 | Soil | PQGDCELDGSELAVSLWRAGEGLRVLIVPAGTWVGRPRR |
| Ga0318526_102812962 | 3300031769 | Soil | GYVPRELAAELDGSELAVSLWRAGEGLRVLIVPAGTWVGRPRR |
| Ga0318567_103148851 | 3300031821 | Soil | LQAGYVPRVHASALDGTEQAVSLWRVGVGLRVLIAPAGSWVGRPRRR |
| Ga0307413_105440111 | 3300031824 | Rhizosphere | PAALAPELAGDEQAISLWRVDGGLRVLIVPPDAWVGTPR |
| Ga0318512_105121611 | 3300031846 | Soil | GYVPRELAPELHGDEQAVSLWRVDGGLRVLVAPADAWIGQPR |
| Ga0310893_105509012 | 3300031892 | Soil | AAVAPELAGDEQALSLWRVEGGLRVLIVAADAWVGRPREPLS |
| Ga0307407_106396042 | 3300031903 | Rhizosphere | VAPELGGGEQALSLWRVEGGLRVLIAPGDAWIGSPR |
| Ga0308174_108152242 | 3300031939 | Soil | PRDLAPELHGDEQAVSLWRVEGGLRVLIVPRDAWVGRPR |
| Ga0308174_110532641 | 3300031939 | Soil | VPREAAPELDGSELAVSLWRAGEGLRVLVVPAGSWVGRPR |
| Ga0318569_105600531 | 3300032010 | Soil | VPRDVAPELRGDEQAVSLWRVDGGLRVLVAPADAWIGQPR |
| Ga0318559_104013322 | 3300032039 | Soil | LQVGYVPRDVAPELRGDEQAVSLWRVDGGLRVLVAPADAWIGQPR |
| Ga0318570_103796182 | 3300032054 | Soil | DCELDGSELAVSLWRAGEGLRVLIVPAGTWVGRPRR |
| Ga0318525_101334701 | 3300032089 | Soil | GYVPRDRASELQGGEQAVSLWRMGIGLRVLIVPAGAWVGRPRR |
| Ga0307415_1016982291 | 3300032126 | Rhizosphere | GYVPRELAPELSGDEQAISLWRVEGGLRVLIAPADAWIGTPRL |
| Ga0335071_101913831 | 3300032897 | Soil | AELAGGEQAVSLWRAGEGLRILIVPADAWIGRPRR |
| Ga0335084_110892001 | 3300033004 | Soil | TLQAGYVPREVAPELAGDEQAVSLWRVEGGLRVLIVPADAWVGRPR |
| Ga0247830_112400191 | 3300033551 | Soil | LQVGYVPAAIAPELAGDEQALSLWRVEGGLRVLIVPADAWVGTPR |
| Ga0364931_0249941_450_581 | 3300034176 | Sediment | LGYVPAVVAPELTGDEQAVSLWRVDGGLRVLIVSADAWVGTPR |
| Ga0372946_0103094_1200_1337 | 3300034384 | Soil | LQVGYVPAAVAPELAGGEQAVSLWRVDGGLRVLIAPADAWIGTPR |
| ⦗Top⦘ |