| Basic Information | |
|---|---|
| Family ID | F028644 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 191 |
| Average Sequence Length | 45 residues |
| Representative Sequence | MNQEPKCECERPILRERAEQKGVSESFCDRCKRPIGLRPAAVRSAV |
| Number of Associated Samples | 148 |
| Number of Associated Scaffolds | 191 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 82.76 % |
| % of genes near scaffold ends (potentially truncated) | 26.18 % |
| % of genes from short scaffolds (< 2000 bps) | 72.25 % |
| Associated GOLD sequencing projects | 139 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.43 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (85.864 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (16.230 % of family members) |
| Environment Ontology (ENVO) | Unclassified (31.414 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (59.162 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 17.57% Coil/Unstructured: 82.43% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.43 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 191 Family Scaffolds |
|---|---|---|
| PF00909 | Ammonium_transp | 46.60 |
| PF00581 | Rhodanese | 21.47 |
| PF06772 | LtrA | 3.66 |
| PF13420 | Acetyltransf_4 | 2.62 |
| PF12697 | Abhydrolase_6 | 2.62 |
| PF00027 | cNMP_binding | 2.09 |
| PF00069 | Pkinase | 1.05 |
| PF00543 | P-II | 1.05 |
| PF14279 | HNH_5 | 1.05 |
| PF13472 | Lipase_GDSL_2 | 1.05 |
| PF13489 | Methyltransf_23 | 1.05 |
| PF14584 | DUF4446 | 1.05 |
| PF00120 | Gln-synt_C | 1.05 |
| PF16697 | Yop-YscD_cpl | 0.52 |
| PF03795 | YCII | 0.52 |
| PF12706 | Lactamase_B_2 | 0.52 |
| PF01202 | SKI | 0.52 |
| PF03951 | Gln-synt_N | 0.52 |
| PF01872 | RibD_C | 0.52 |
| PF07508 | Recombinase | 0.52 |
| PF13238 | AAA_18 | 0.52 |
| PF01844 | HNH | 0.52 |
| PF00561 | Abhydrolase_1 | 0.52 |
| COG ID | Name | Functional Category | % Frequency in 191 Family Scaffolds |
|---|---|---|---|
| COG0004 | Ammonia channel protein AmtB | Inorganic ion transport and metabolism [P] | 46.60 |
| COG0515 | Serine/threonine protein kinase | Signal transduction mechanisms [T] | 4.19 |
| COG4292 | Low temperature requirement protein LtrA (function unknown) | Function unknown [S] | 3.66 |
| COG0347 | Nitrogen regulatory protein PII | Signal transduction mechanisms [T] | 1.05 |
| COG0174 | Glutamine synthetase | Amino acid transport and metabolism [E] | 0.52 |
| COG0262 | Dihydrofolate reductase | Coenzyme transport and metabolism [H] | 0.52 |
| COG1961 | Site-specific DNA recombinase SpoIVCA/DNA invertase PinE | Replication, recombination and repair [L] | 0.52 |
| COG1985 | Pyrimidine reductase, riboflavin biosynthesis | Coenzyme transport and metabolism [H] | 0.52 |
| COG2350 | YciI superfamily enzyme, includes 5-CHQ dehydrochlorinase, contains active-site pHis | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.52 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 86.39 % |
| Unclassified | root | N/A | 13.61 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2124908045|KansclcFeb2_ConsensusfromContig505370 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 5728 | Open in IMG/M |
| 3300000033|ICChiseqgaiiDRAFT_c0793618 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1255 | Open in IMG/M |
| 3300000550|F24TB_10673840 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1178 | Open in IMG/M |
| 3300000956|JGI10216J12902_103412476 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1414 | Open in IMG/M |
| 3300002568|C688J35102_119988517 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 837 | Open in IMG/M |
| 3300002568|C688J35102_120274963 | All Organisms → cellular organisms → Bacteria | 962 | Open in IMG/M |
| 3300002568|C688J35102_120902449 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 2157 | Open in IMG/M |
| 3300002911|JGI25390J43892_10017237 | All Organisms → cellular organisms → Bacteria | 1724 | Open in IMG/M |
| 3300004114|Ga0062593_100090027 | All Organisms → cellular organisms → Bacteria | 2118 | Open in IMG/M |
| 3300004156|Ga0062589_100300567 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1240 | Open in IMG/M |
| 3300004643|Ga0062591_102999502 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 501 | Open in IMG/M |
| 3300005166|Ga0066674_10244888 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 851 | Open in IMG/M |
| 3300005167|Ga0066672_10657630 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 676 | Open in IMG/M |
| 3300005175|Ga0066673_10014824 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei | 3456 | Open in IMG/M |
| 3300005175|Ga0066673_10368990 | All Organisms → cellular organisms → Bacteria | 838 | Open in IMG/M |
| 3300005176|Ga0066679_10850946 | All Organisms → cellular organisms → Bacteria | 578 | Open in IMG/M |
| 3300005178|Ga0066688_10076370 | All Organisms → cellular organisms → Bacteria | 2002 | Open in IMG/M |
| 3300005179|Ga0066684_10478818 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 836 | Open in IMG/M |
| 3300005181|Ga0066678_10221169 | All Organisms → cellular organisms → Bacteria | 1216 | Open in IMG/M |
| 3300005184|Ga0066671_10041318 | All Organisms → cellular organisms → Bacteria | 2259 | Open in IMG/M |
| 3300005186|Ga0066676_10157970 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1431 | Open in IMG/M |
| 3300005187|Ga0066675_10310136 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1144 | Open in IMG/M |
| 3300005332|Ga0066388_100165231 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 2807 | Open in IMG/M |
| 3300005332|Ga0066388_100218618 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2534 | Open in IMG/M |
| 3300005332|Ga0066388_101043393 | All Organisms → cellular organisms → Bacteria | 1376 | Open in IMG/M |
| 3300005332|Ga0066388_107947676 | All Organisms → cellular organisms → Bacteria | 530 | Open in IMG/M |
| 3300005337|Ga0070682_100129850 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter → unclassified Solirubrobacter → Solirubrobacter sp. | 1704 | Open in IMG/M |
| 3300005347|Ga0070668_101167590 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 697 | Open in IMG/M |
| 3300005434|Ga0070709_10197632 | All Organisms → cellular organisms → Bacteria | 1422 | Open in IMG/M |
| 3300005440|Ga0070705_100931638 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales → Paenibacillaceae → Paenibacillus | 701 | Open in IMG/M |
| 3300005445|Ga0070708_100321092 | Not Available | 1458 | Open in IMG/M |
| 3300005455|Ga0070663_101176414 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 673 | Open in IMG/M |
| 3300005468|Ga0070707_100011299 | All Organisms → cellular organisms → Bacteria | 8325 | Open in IMG/M |
| 3300005468|Ga0070707_100114760 | All Organisms → cellular organisms → Bacteria | 2613 | Open in IMG/M |
| 3300005536|Ga0070697_100636607 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 939 | Open in IMG/M |
| 3300005557|Ga0066704_10333441 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1020 | Open in IMG/M |
| 3300005560|Ga0066670_10118124 | All Organisms → cellular organisms → Bacteria | 1511 | Open in IMG/M |
| 3300005575|Ga0066702_10576915 | All Organisms → cellular organisms → Bacteria | 678 | Open in IMG/M |
| 3300005586|Ga0066691_10898323 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 521 | Open in IMG/M |
| 3300005713|Ga0066905_100028149 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 3139 | Open in IMG/M |
| 3300005718|Ga0068866_10556741 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 768 | Open in IMG/M |
| 3300005764|Ga0066903_100049907 | All Organisms → cellular organisms → Bacteria | 5079 | Open in IMG/M |
| 3300005764|Ga0066903_100249450 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2736 | Open in IMG/M |
| 3300005764|Ga0066903_103317094 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 870 | Open in IMG/M |
| 3300006032|Ga0066696_10204737 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei | 1260 | Open in IMG/M |
| 3300006034|Ga0066656_10626028 | Not Available | 695 | Open in IMG/M |
| 3300006034|Ga0066656_10876827 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 575 | Open in IMG/M |
| 3300006046|Ga0066652_100324466 | All Organisms → cellular organisms → Bacteria | 1376 | Open in IMG/M |
| 3300006049|Ga0075417_10000312 | All Organisms → cellular organisms → Bacteria | 10363 | Open in IMG/M |
| 3300006058|Ga0075432_10038744 | Not Available | 1661 | Open in IMG/M |
| 3300006163|Ga0070715_10112053 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1288 | Open in IMG/M |
| 3300006573|Ga0074055_10000872 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 771 | Open in IMG/M |
| 3300006755|Ga0079222_11567748 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 622 | Open in IMG/M |
| 3300006796|Ga0066665_10152087 | All Organisms → cellular organisms → Bacteria | 1757 | Open in IMG/M |
| 3300006804|Ga0079221_11641338 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 522 | Open in IMG/M |
| 3300006852|Ga0075433_10850103 | All Organisms → cellular organisms → Bacteria | 796 | Open in IMG/M |
| 3300006903|Ga0075426_10005821 | All Organisms → cellular organisms → Bacteria | 8777 | Open in IMG/M |
| 3300006914|Ga0075436_100022440 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 4336 | Open in IMG/M |
| 3300006954|Ga0079219_11345422 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 633 | Open in IMG/M |
| 3300009012|Ga0066710_101729069 | All Organisms → cellular organisms → Bacteria | 950 | Open in IMG/M |
| 3300009137|Ga0066709_100869993 | All Organisms → cellular organisms → Bacteria | 1311 | Open in IMG/M |
| 3300009137|Ga0066709_102166677 | All Organisms → cellular organisms → Bacteria | 767 | Open in IMG/M |
| 3300009792|Ga0126374_10138730 | All Organisms → cellular organisms → Bacteria | 1454 | Open in IMG/M |
| 3300010043|Ga0126380_11762012 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 559 | Open in IMG/M |
| 3300010044|Ga0126310_10057128 | All Organisms → cellular organisms → Bacteria | 2196 | Open in IMG/M |
| 3300010320|Ga0134109_10421819 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 537 | Open in IMG/M |
| 3300010337|Ga0134062_10736315 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 521 | Open in IMG/M |
| 3300010366|Ga0126379_11781920 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 720 | Open in IMG/M |
| 3300010371|Ga0134125_10557417 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1268 | Open in IMG/M |
| 3300010398|Ga0126383_12427012 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 609 | Open in IMG/M |
| 3300010400|Ga0134122_11585438 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 678 | Open in IMG/M |
| 3300011003|Ga0138514_100121460 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 574 | Open in IMG/M |
| 3300012208|Ga0137376_10257347 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1514 | Open in IMG/M |
| 3300012211|Ga0137377_10038535 | All Organisms → cellular organisms → Bacteria | 4370 | Open in IMG/M |
| 3300012211|Ga0137377_10128912 | All Organisms → cellular organisms → Bacteria | 2416 | Open in IMG/M |
| 3300012211|Ga0137377_11584527 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 579 | Open in IMG/M |
| 3300012285|Ga0137370_10199603 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1173 | Open in IMG/M |
| 3300012350|Ga0137372_10056491 | All Organisms → cellular organisms → Bacteria | 3438 | Open in IMG/M |
| 3300012351|Ga0137386_11053441 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 576 | Open in IMG/M |
| 3300012351|Ga0137386_11266018 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 513 | Open in IMG/M |
| 3300012354|Ga0137366_10271516 | All Organisms → cellular organisms → Bacteria | 1253 | Open in IMG/M |
| 3300012361|Ga0137360_11787224 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 520 | Open in IMG/M |
| 3300012405|Ga0134041_1052683 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 500 | Open in IMG/M |
| 3300012957|Ga0164303_10490244 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 784 | Open in IMG/M |
| 3300012960|Ga0164301_10142837 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1452 | Open in IMG/M |
| 3300012977|Ga0134087_10110158 | All Organisms → cellular organisms → Bacteria | 1162 | Open in IMG/M |
| 3300012984|Ga0164309_10788063 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 764 | Open in IMG/M |
| 3300012984|Ga0164309_11918898 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 508 | Open in IMG/M |
| 3300012986|Ga0164304_10802044 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 727 | Open in IMG/M |
| 3300012987|Ga0164307_11883933 | Not Available | 507 | Open in IMG/M |
| 3300012989|Ga0164305_10991026 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 713 | Open in IMG/M |
| 3300013307|Ga0157372_11365079 | All Organisms → cellular organisms → Bacteria | 817 | Open in IMG/M |
| 3300014150|Ga0134081_10332318 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 553 | Open in IMG/M |
| 3300014488|Ga0182001_10007326 | All Organisms → cellular organisms → Bacteria | 2295 | Open in IMG/M |
| 3300014488|Ga0182001_10165339 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 772 | Open in IMG/M |
| 3300014745|Ga0157377_11683932 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 511 | Open in IMG/M |
| 3300015357|Ga0134072_10029773 | All Organisms → cellular organisms → Bacteria | 1419 | Open in IMG/M |
| 3300015357|Ga0134072_10199738 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 691 | Open in IMG/M |
| 3300015371|Ga0132258_12834811 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1207 | Open in IMG/M |
| 3300015373|Ga0132257_101717620 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei | 805 | Open in IMG/M |
| 3300017654|Ga0134069_1084631 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1024 | Open in IMG/M |
| 3300017659|Ga0134083_10388435 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 607 | Open in IMG/M |
| 3300018027|Ga0184605_10001700 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 7181 | Open in IMG/M |
| 3300018027|Ga0184605_10294705 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 735 | Open in IMG/M |
| 3300018028|Ga0184608_10000352 | All Organisms → cellular organisms → Bacteria | 12081 | Open in IMG/M |
| 3300018051|Ga0184620_10043414 | All Organisms → cellular organisms → Bacteria | 1237 | Open in IMG/M |
| 3300018061|Ga0184619_10000709 | All Organisms → cellular organisms → Bacteria | 11508 | Open in IMG/M |
| 3300018061|Ga0184619_10023691 | All Organisms → cellular organisms → Bacteria | 2543 | Open in IMG/M |
| 3300018061|Ga0184619_10192372 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales | 937 | Open in IMG/M |
| 3300018076|Ga0184609_10233507 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 859 | Open in IMG/M |
| 3300018431|Ga0066655_10308976 | All Organisms → cellular organisms → Bacteria | 1031 | Open in IMG/M |
| 3300018431|Ga0066655_10670956 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 701 | Open in IMG/M |
| 3300018431|Ga0066655_10717126 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 677 | Open in IMG/M |
| 3300018431|Ga0066655_11262899 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 527 | Open in IMG/M |
| 3300018433|Ga0066667_10385961 | All Organisms → cellular organisms → Bacteria | 1127 | Open in IMG/M |
| 3300018433|Ga0066667_11624472 | All Organisms → cellular organisms → Bacteria | 577 | Open in IMG/M |
| 3300018433|Ga0066667_12098822 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 523 | Open in IMG/M |
| 3300018482|Ga0066669_10656568 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 923 | Open in IMG/M |
| 3300018482|Ga0066669_11065498 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 730 | Open in IMG/M |
| 3300018482|Ga0066669_11981556 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 545 | Open in IMG/M |
| 3300018482|Ga0066669_12315749 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 513 | Open in IMG/M |
| 3300019361|Ga0173482_10284740 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 720 | Open in IMG/M |
| 3300019789|Ga0137408_1190157 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 2916 | Open in IMG/M |
| 3300019875|Ga0193701_1034962 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1032 | Open in IMG/M |
| 3300019875|Ga0193701_1058132 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 774 | Open in IMG/M |
| 3300019875|Ga0193701_1101694 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 534 | Open in IMG/M |
| 3300019888|Ga0193751_1121245 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 975 | Open in IMG/M |
| 3300020002|Ga0193730_1026390 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1680 | Open in IMG/M |
| 3300020006|Ga0193735_1116832 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 729 | Open in IMG/M |
| 3300021344|Ga0193719_10009265 | All Organisms → cellular organisms → Bacteria | 4107 | Open in IMG/M |
| 3300025885|Ga0207653_10001655 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 7143 | Open in IMG/M |
| 3300025901|Ga0207688_10161504 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1328 | Open in IMG/M |
| 3300025906|Ga0207699_10211941 | All Organisms → cellular organisms → Bacteria | 1318 | Open in IMG/M |
| 3300025910|Ga0207684_10136763 | All Organisms → cellular organisms → Bacteria | 2104 | Open in IMG/M |
| 3300025916|Ga0207663_10508856 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 936 | Open in IMG/M |
| 3300025922|Ga0207646_10298309 | Not Available | 1456 | Open in IMG/M |
| 3300025922|Ga0207646_10828171 | All Organisms → cellular organisms → Bacteria | 823 | Open in IMG/M |
| 3300025926|Ga0207659_10444242 | All Organisms → cellular organisms → Bacteria | 1091 | Open in IMG/M |
| 3300025934|Ga0207686_10507902 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 936 | Open in IMG/M |
| 3300025939|Ga0207665_10122582 | All Organisms → cellular organisms → Bacteria | 1838 | Open in IMG/M |
| 3300025940|Ga0207691_10964345 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 712 | Open in IMG/M |
| 3300025949|Ga0207667_12212741 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 507 | Open in IMG/M |
| 3300026298|Ga0209236_1242578 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 601 | Open in IMG/M |
| 3300026300|Ga0209027_1058742 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1436 | Open in IMG/M |
| 3300026300|Ga0209027_1185240 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 679 | Open in IMG/M |
| 3300026312|Ga0209153_1001644 | All Organisms → cellular organisms → Bacteria | 7623 | Open in IMG/M |
| 3300026326|Ga0209801_1190664 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 832 | Open in IMG/M |
| 3300026342|Ga0209057_1081733 | Not Available | 1365 | Open in IMG/M |
| 3300026342|Ga0209057_1105496 | All Organisms → cellular organisms → Bacteria | 1114 | Open in IMG/M |
| 3300026550|Ga0209474_10223773 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1182 | Open in IMG/M |
| 3300026550|Ga0209474_10310140 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 920 | Open in IMG/M |
| 3300026552|Ga0209577_10301849 | Not Available | 1194 | Open in IMG/M |
| 3300027061|Ga0209729_1055046 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 508 | Open in IMG/M |
| 3300027787|Ga0209074_10025630 | Not Available | 1640 | Open in IMG/M |
| 3300027873|Ga0209814_10001104 | All Organisms → cellular organisms → Bacteria | 9403 | Open in IMG/M |
| 3300028705|Ga0307276_10145151 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 601 | Open in IMG/M |
| 3300028784|Ga0307282_10013671 | All Organisms → cellular organisms → Bacteria | 3303 | Open in IMG/M |
| 3300028787|Ga0307323_10000112 | All Organisms → cellular organisms → Bacteria | 23439 | Open in IMG/M |
| 3300028793|Ga0307299_10329014 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 573 | Open in IMG/M |
| 3300028799|Ga0307284_10104654 | All Organisms → cellular organisms → Bacteria | 1061 | Open in IMG/M |
| 3300028807|Ga0307305_10020124 | All Organisms → cellular organisms → Bacteria | 3001 | Open in IMG/M |
| 3300028811|Ga0307292_10065965 | Not Available | 1378 | Open in IMG/M |
| 3300028819|Ga0307296_10317477 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 850 | Open in IMG/M |
| 3300028824|Ga0307310_10039779 | All Organisms → cellular organisms → Bacteria | 1926 | Open in IMG/M |
| 3300028878|Ga0307278_10018054 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 3270 | Open in IMG/M |
| 3300028881|Ga0307277_10011658 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3389 | Open in IMG/M |
| 3300028881|Ga0307277_10058571 | All Organisms → cellular organisms → Bacteria | 1580 | Open in IMG/M |
| 3300028881|Ga0307277_10118015 | All Organisms → cellular organisms → Bacteria | 1135 | Open in IMG/M |
| 3300030511|Ga0268241_10107029 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 653 | Open in IMG/M |
| 3300030969|Ga0075394_12016944 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 810 | Open in IMG/M |
| 3300031740|Ga0307468_100295154 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon BMS3Abin16 | 1173 | Open in IMG/M |
| 3300031938|Ga0308175_100588307 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1196 | Open in IMG/M |
| 3300031938|Ga0308175_102468353 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 582 | Open in IMG/M |
| 3300033475|Ga0310811_10899311 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 800 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 16.23% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 15.18% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 9.95% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 9.95% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 6.28% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 4.19% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 4.19% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 4.19% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 4.71% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 3.14% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.09% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 2.09% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 2.09% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 2.09% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.05% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 1.05% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.05% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.05% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 1.05% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 0.52% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.52% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.52% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.52% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.52% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.52% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.52% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.52% |
| Soil | Environmental → Terrestrial → Agricultural Field → Unclassified → Unclassified → Soil | 0.52% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.52% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.52% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.52% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.52% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.52% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.52% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.52% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2124908045 | Soil microbial communities from Great Prairies - Kansas assembly 1 01_01_2011 | Environmental | Open in IMG/M |
| 3300000033 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
| 3300000550 | Amended soil microbial communities from Kansas Great Prairies, USA - BrdU amended with acetate total DNA F2.4 TB clc assemly | Environmental | Open in IMG/M |
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300002568 | Grasslands soil microbial communities from Hopland, California, USA - 2 | Environmental | Open in IMG/M |
| 3300002911 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_2_20cm | Environmental | Open in IMG/M |
| 3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
| 3300004156 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1 | Environmental | Open in IMG/M |
| 3300004643 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3 | Environmental | Open in IMG/M |
| 3300005166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123 | Environmental | Open in IMG/M |
| 3300005167 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 | Environmental | Open in IMG/M |
| 3300005175 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 | Environmental | Open in IMG/M |
| 3300005176 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 | Environmental | Open in IMG/M |
| 3300005178 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 | Environmental | Open in IMG/M |
| 3300005179 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 | Environmental | Open in IMG/M |
| 3300005181 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 | Environmental | Open in IMG/M |
| 3300005184 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120 | Environmental | Open in IMG/M |
| 3300005186 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 | Environmental | Open in IMG/M |
| 3300005187 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Environmental | Open in IMG/M |
| 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Environmental | Open in IMG/M |
| 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Host-Associated | Open in IMG/M |
| 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
| 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
| 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Environmental | Open in IMG/M |
| 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Environmental | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Host-Associated | Open in IMG/M |
| 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
| 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
| 3300005526 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 | Environmental | Open in IMG/M |
| 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
| 3300005557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 | Environmental | Open in IMG/M |
| 3300005560 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119 | Environmental | Open in IMG/M |
| 3300005575 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 | Environmental | Open in IMG/M |
| 3300005586 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 | Environmental | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Host-Associated | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300006032 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 | Environmental | Open in IMG/M |
| 3300006034 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105 | Environmental | Open in IMG/M |
| 3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
| 3300006049 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 | Host-Associated | Open in IMG/M |
| 3300006058 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Host-Associated | Open in IMG/M |
| 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Environmental | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006573 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLAC (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
| 3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
| 3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
| 3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010044 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot60 | Environmental | Open in IMG/M |
| 3300010320 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_11112015 | Environmental | Open in IMG/M |
| 3300010337 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09082015 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
| 3300011003 | Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t9i015 | Environmental | Open in IMG/M |
| 3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012285 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012350 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012354 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012405 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_5_24_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012955 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MG | Environmental | Open in IMG/M |
| 3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
| 3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
| 3300012977 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300012984 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MG | Environmental | Open in IMG/M |
| 3300012986 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MG | Environmental | Open in IMG/M |
| 3300012987 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MG | Environmental | Open in IMG/M |
| 3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
| 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Host-Associated | Open in IMG/M |
| 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Host-Associated | Open in IMG/M |
| 3300014150 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300014488 | Bulk soil microbial communities from Mexico - San Felipe (SF) metaG | Environmental | Open in IMG/M |
| 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Host-Associated | Open in IMG/M |
| 3300015357 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_0_1 metaG | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300017654 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300017659 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300018027 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_coex | Environmental | Open in IMG/M |
| 3300018028 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_coex | Environmental | Open in IMG/M |
| 3300018051 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5_b1 | Environmental | Open in IMG/M |
| 3300018061 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_b1 | Environmental | Open in IMG/M |
| 3300018076 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_coex | Environmental | Open in IMG/M |
| 3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300019361 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2 (version 2) | Environmental | Open in IMG/M |
| 3300019789 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300019875 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3s2 | Environmental | Open in IMG/M |
| 3300019888 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1c2 | Environmental | Open in IMG/M |
| 3300020002 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1a1 | Environmental | Open in IMG/M |
| 3300020006 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1m2 | Environmental | Open in IMG/M |
| 3300021344 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2a2 | Environmental | Open in IMG/M |
| 3300021413 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1c1 | Environmental | Open in IMG/M |
| 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026298 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026300 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026312 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120 (SPAdes) | Environmental | Open in IMG/M |
| 3300026326 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 (SPAdes) | Environmental | Open in IMG/M |
| 3300026342 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 (SPAdes) | Environmental | Open in IMG/M |
| 3300026550 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 (SPAdes) | Environmental | Open in IMG/M |
| 3300026552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 (SPAdes) | Environmental | Open in IMG/M |
| 3300027061 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM1H0_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027787 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter (SPAdes) | Environmental | Open in IMG/M |
| 3300027873 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028705 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_115 | Environmental | Open in IMG/M |
| 3300028784 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_121 | Environmental | Open in IMG/M |
| 3300028787 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_381 | Environmental | Open in IMG/M |
| 3300028793 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_159 | Environmental | Open in IMG/M |
| 3300028799 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_123 | Environmental | Open in IMG/M |
| 3300028807 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_186 | Environmental | Open in IMG/M |
| 3300028811 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_149 | Environmental | Open in IMG/M |
| 3300028819 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_153 | Environmental | Open in IMG/M |
| 3300028824 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_197 | Environmental | Open in IMG/M |
| 3300028878 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_117 | Environmental | Open in IMG/M |
| 3300028881 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_116 | Environmental | Open in IMG/M |
| 3300030511 | Bulk soil microbial communities from Mexico - Amatitan (Am) metaG (v2) | Environmental | Open in IMG/M |
| 3300030969 | Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - FA12 Emin (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
| 3300031938 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1 | Environmental | Open in IMG/M |
| 3300033475 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YC | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| KansclcFeb2_04871060 | 2124908045 | Soil | MNQEPKCECERPILRERAEQKGVSESFCDRCKRPIGLRPAAIRSAV |
| ICChiseqgaiiDRAFT_07936181 | 3300000033 | Soil | MNQEPKCECERPILRERAEQKGVSESFCDRCKRPIGLRPAALRRVI* |
| F24TB_106738403 | 3300000550 | Soil | MNQEPKCECERPILRERAEQKGVSESFCDRCKRPIGLRPAAIRSAV* |
| JGI10216J12902_1034124762 | 3300000956 | Soil | MIQEPKCECQRPILRERAEQKGVSESFCDRCKRPIGLRTAAIRPSRSIS* |
| C688J35102_1199885171 | 3300002568 | Soil | VKLEAKCECERPILRERAEQKGVSESFCARCKREIGLRPAAIRPA* |
| C688J35102_1202749632 | 3300002568 | Soil | MNQEPKCECERPILRERAEHKGVSESFCDRCKRPIGLRPAAVRVA* |
| C688J35102_1203534912 | 3300002568 | Soil | MTDQKCECAKPILRERSEAKGISESYCDRCKRPLGLRLAAVRPAA* |
| C688J35102_1205886742 | 3300002568 | Soil | MTDQKCECGKPILRERSEAKGISESYCDRCKRPLGLRLATVRPAA* |
| C688J35102_1209024493 | 3300002568 | Soil | MNDTKCDCARPILREHAEAKGISESYCDRCKRPLGLRLATVRPAA* |
| JGI25390J43892_100172372 | 3300002911 | Grasslands Soil | MNQEPKCECERPILRERAEQKGVSESFCDRCKRPIGLRPAAVRSAV* |
| Ga0062593_1000900272 | 3300004114 | Soil | MIQEPKCECQRPILRERAEQKGVSESFCDRCKRPIGLRTAAVRPSRSIS* |
| Ga0062589_1003005672 | 3300004156 | Soil | MSQQPKCECERPILRERAEQKGVSESFCDRCKRPIGLRTAAVRPGRLIS* |
| Ga0062589_1011260942 | 3300004156 | Soil | MTTQKCECEKPILREHSEWKGSSESYCDRCKRPIGLRSATVPAETVLRL* |
| Ga0062591_1029995021 | 3300004643 | Soil | MSQQPKCECERPILRERAEQKGVSESFCDRCKRPIGLRSASVRSAV* |
| Ga0066674_102448881 | 3300005166 | Soil | MNHEPKCECERPILRERAEQKGVSESFCDRCKRPLGLRLAAVRSTA* |
| Ga0066672_106576301 | 3300005167 | Soil | MNHEPKCECERPILRERAEHKGVSESFCDRCKRPIGLRPAAFRAA* |
| Ga0066673_100148245 | 3300005175 | Soil | MSHEPKCECERPILRERAEQKGVSESFCDRCKRPLGLRLAAVRSTA* |
| Ga0066673_103689902 | 3300005175 | Soil | MNHQNCQCERPILRERAEQKGVSESFCGRCKRPIGLRVAANVTVR* |
| Ga0066679_108232432 | 3300005176 | Soil | MKTEKCECEKPILREHSEWKGSSESYCDRCKRPIGLRAATIPAETVPRL* |
| Ga0066679_108509462 | 3300005176 | Soil | QEPKCECERPILRERAEHKGVSESFCDRCKRAIGLRPAAVRAG* |
| Ga0066688_100763702 | 3300005178 | Soil | MNQEPKCQCERPILRERAEQKGVSESFCDRCKRAIGFRPAVVRGVA* |
| Ga0066684_104788182 | 3300005179 | Soil | SYPDETGRGGRMKPEQKCECEKPILRERSEWKGSSESFCDRCKRPLGLRLAAIRPG* |
| Ga0066678_102211692 | 3300005181 | Soil | MNKEPKCECERPILRERAEQKGVSESFCDRCKRPIGLRPAAVRSAV* |
| Ga0066671_100413182 | 3300005184 | Soil | MSQEPKCECERPILRERAEHKGVSESFCDRCKRAIGLRPAAVRSVA* |
| Ga0066676_101579702 | 3300005186 | Soil | MNPQNCQCERPILRERAEQKGVSESFCGRCKRPIGLRVAANVTVR* |
| Ga0066675_103101362 | 3300005187 | Soil | MNHEPKCECERPILRERAEQKGISESFCDRCKRQIGLRPAAFRAA* |
| Ga0066388_1001652312 | 3300005332 | Tropical Forest Soil | MKPEPKCTCERPILREQTEQKGVSESFCGRCKRPIGLRLAAVRA* |
| Ga0066388_1002186184 | 3300005332 | Tropical Forest Soil | MNEKTKCECERPILREHAEQKGVSESYCDRCKRPIGLRTAVVRPG* |
| Ga0066388_1010433932 | 3300005332 | Tropical Forest Soil | MKPEPKCTCERPILREHAEQKGVSESFCGRCKQPIGLRLAAVRA* |
| Ga0066388_1079476762 | 3300005332 | Tropical Forest Soil | MKPEPKCTCERPILREQAEQKGVSVSFCGRCKRPIGLRLAAVRA* |
| Ga0070682_1001298502 | 3300005337 | Corn Rhizosphere | MNQQPKCECERPILRERAEQKGVSESFCDRCKRPIGLRTAAVRPGRLIS* |
| Ga0070687_1014748942 | 3300005343 | Switchgrass Rhizosphere | MTTEKCECEKPILREHSEWKGSSESYCDRCKRPIGLRSATVPAETVLRL* |
| Ga0070668_1011675902 | 3300005347 | Switchgrass Rhizosphere | MNQEPKCECERPILRERAEQKGVSESFCDRCKRPIGLRPAAVRSAM* |
| Ga0070709_101976322 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | MNQQPKCECERPILRERAEQKGVSESFCDRCKRPIGLRTAAVHPGRLIS* |
| Ga0070714_1009678182 | 3300005435 | Agricultural Soil | MTTEKCECEKPILREHSEWKGSSESYCDRCKRPIGLRSATVPADTVLRL* |
| Ga0070710_112008552 | 3300005437 | Corn, Switchgrass And Miscanthus Rhizosphere | MTTEKCECEKPILREHSEWKGSSESYCDRCKRPIGLRSATV |
| Ga0070705_1009316382 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | MNQEPKCECERPNLRERAEQKGVSESFCDRCKRPIGLRPAAVRSAM* |
| Ga0070708_1003210921 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MNQEPKCECERPILRERAEQKGVSESFCDRCKRPISLRTAAARPAA* |
| Ga0070663_1011764141 | 3300005455 | Corn Rhizosphere | MNQQPKCECERPILRERAEQKGVSESFCDRCKRPIGLRPAAVRSAM* |
| Ga0070706_1002731092 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | MTIQKCECKKPILREHSEWKGSSESYCDRCKRPIGLRSATVPA |
| Ga0070707_1000112999 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | MNQEPKCECERPILRERAEQKGVSESFCDRCKRPISLRTAPARPAA* |
| Ga0070707_1001147602 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | MNREPKCECERPILRERAEQKGVSESFCDRCKRPIGLRTATVRPSRVI* |
| Ga0070707_1012251091 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | MTTEKCECEKPILREHSEWKGSSESYCDRCKRPIGLRSATVPA |
| Ga0073909_103185252 | 3300005526 | Surface Soil | MTIQKCECEKPILREHSEWKGSSESYCDRCKRPIGLRSATVPAGTVLRL* |
| Ga0070697_1006366072 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | MNQEPKCECERPILRERAEQKGVSESFCDRCKRPIGLRTATVRPSRVI* |
| Ga0066704_103334411 | 3300005557 | Soil | MNQEQKCQCERPILRERAEQKGFSESFCDRCKRPIGFRPAAVRNIA* |
| Ga0066670_101181242 | 3300005560 | Soil | MNHQNCQCERPILRERAEQKGASESFCGRCKRPIGLRPAAVRAP* |
| Ga0066702_105769152 | 3300005575 | Soil | MNHEPKCECERPILRERAEQKGISESFCDRCKRPIGLRPAAFRAA* |
| Ga0066691_108983232 | 3300005586 | Soil | MKQEPKCECERPILRERAEQKGVSESFCDRCKRQIGLRPAAVRSVR* |
| Ga0066905_1000281495 | 3300005713 | Tropical Forest Soil | MNEKPKCECERPILREHAEQKGVSESYCDRCKRPIGLRTAVVRPG* |
| Ga0068866_105567412 | 3300005718 | Miscanthus Rhizosphere | MNQEPKCECERPILRERAEQKGVSESFCDRCKRPIGLRPAAVRSVV* |
| Ga0066903_1000499078 | 3300005764 | Tropical Forest Soil | MKPEPMCTCERPILREHAEQKGASESFCGRCKRPIGLRLAAVRA* |
| Ga0066903_1002494503 | 3300005764 | Tropical Forest Soil | MRPEPKCACERPILREHAEQKGVSESFCGRCKRPIGLRPAAVRA* |
| Ga0066903_1033170943 | 3300005764 | Tropical Forest Soil | PEPKCACERPILREHAEQKGVSESYCGRCKLPIGLRLAAVRA* |
| Ga0066696_102047373 | 3300006032 | Soil | HEPKCECERPILRERAEQKGVSESFCDRCKRPLGLRLAAVRSTA* |
| Ga0066656_106260282 | 3300006034 | Soil | ECERPILRERAEQKGVSESFCDRCKRPIGLRPAAIRLNA* |
| Ga0066656_108768271 | 3300006034 | Soil | MNHQNCQCERPILRERAEQKGASESFCGRCKRPIGLRPAA |
| Ga0066652_1003244662 | 3300006046 | Soil | MSHQNCQCERPILRERAEQKGASESFCGRCKRPIGLRPAAVRAT* |
| Ga0075417_1000031212 | 3300006049 | Populus Rhizosphere | MNHQSCQCERPILRERAEQKGASESFCGRCKRPIGLRVAANVTAR* |
| Ga0075432_100387441 | 3300006058 | Populus Rhizosphere | MNHQSCQCERPILRERAEQKGASESFCGRCKRPIGLRVAANVTVR* |
| Ga0070715_101120531 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | CRGGRMNQQPKCECERPILRERAEQKGVSESFCDRCKRPIGLRTAAVRPGRLIS* |
| Ga0070716_1004600862 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | MTIQKCECKKPILREHSEWKGSSESYCDRCKRPIGLRSATVPADTVLRL* |
| Ga0074055_100008722 | 3300006573 | Soil | MKQEPKCECERPILRERAEQNGASESFCDRCKRQIGLRLAAVRPVV* |
| Ga0079222_115677482 | 3300006755 | Agricultural Soil | MNHQNCQCERPILRERAEQKGASESFCGRCKRPIGLRVAANVTVR* |
| Ga0066665_101520872 | 3300006796 | Soil | MNQEPKCECERPILRERAEQKGVSESFCDRCKRPIGLRPAAIRLNA* |
| Ga0079221_116413381 | 3300006804 | Agricultural Soil | MIQEPKCECQRPILRERAEQKGVSESFCDRCKRPIGLRTA |
| Ga0075433_108501032 | 3300006852 | Populus Rhizosphere | MNQQAKCECERPILRERAEQKGVSESFCDRCKRPIGLRTAAVRPGRLIS* |
| Ga0075426_100058217 | 3300006903 | Populus Rhizosphere | MNHQNCQCERPILRERAEQKGASESFCGRCKRPIGLRVAANVTAR* |
| Ga0075436_1000224401 | 3300006914 | Populus Rhizosphere | CQCERPILRERAEQKGASESFCGRCKRPIGLRVAANVTVR* |
| Ga0079219_113454222 | 3300006954 | Agricultural Soil | MIQEPKCECQRPILRERAEQKGVSESFCDRCKRPIGLRTAAVRPSPSIS* |
| Ga0066710_1017290692 | 3300009012 | Grasslands Soil | MKPEQKCECEKPILRERSEWKGSSESFCDRCKRPLGLRLAAIRPG |
| Ga0066709_1008699931 | 3300009137 | Grasslands Soil | CERPILRERAEQKGISESFCGRCKRPIGLRLAAVRNVA* |
| Ga0066709_1021666772 | 3300009137 | Grasslands Soil | MKPEQKCECEKPILRERSEWKGSSESFCDRCKRPLGLRLAAIRPG* |
| Ga0126374_101387303 | 3300009792 | Tropical Forest Soil | MKPEPKCTCERPILREQAEQKGVSESFCGRCKRPIGLRLAAVRA* |
| Ga0126380_117620122 | 3300010043 | Tropical Forest Soil | MNHQNCQCERPILRERAEQKGASESFCARCKRPIALRVAANVTMR* |
| Ga0126310_100571282 | 3300010044 | Serpentine Soil | MKHEPKCECERPILRERAKQKGVSESFCGRCKRQIGLRLAAVRTIA* |
| Ga0134109_104218191 | 3300010320 | Grasslands Soil | MNHEPKCECERPILRERAEQKGVSESFCDRCKRAIGFRPAVVRGVA* |
| Ga0134062_107363151 | 3300010337 | Grasslands Soil | MNHEPKCECERPILRERAEHKGVSESFCDRCKRPIGLRPAAYRAA* |
| Ga0126379_117819202 | 3300010366 | Tropical Forest Soil | MKPEPMCTCERPILREHAEQKGASESFCGRCKRPIGLRLAANVTAR* |
| Ga0134125_105574172 | 3300010371 | Terrestrial Soil | MNDPKCECAKPILREHAEAKGISESYCDRCKRPLGLRLAAVKPAA* |
| Ga0126383_124270121 | 3300010398 | Tropical Forest Soil | MNSQNRQCERPVLRERAEQKGASESFCGRCKRPIGLRLAANVTAR* |
| Ga0134122_115854381 | 3300010400 | Terrestrial Soil | DPKCECAKPILREHAEAKGISESYCDRCKRPLGLRLAAVKPAA* |
| Ga0138514_1001214602 | 3300011003 | Soil | MIQEPKCECQRPILRERAEQKGVSESFCDRCKRPIG |
| Ga0137365_100027965 | 3300012201 | Vadose Zone Soil | MKSEKCECEKPILREHSEWKGSSESYCDRCKRPIGLRAATIPPETVRPL* |
| Ga0137376_102573472 | 3300012208 | Vadose Zone Soil | MNHEPKCECERPILRERAEHKGVSESFCDRCKRPIGLRPAAIRAA* |
| Ga0137377_100385355 | 3300012211 | Vadose Zone Soil | MNKEPKCECERPILRERAEQKGVSESFCDRCKRPIGLRPAAVRSPG* |
| Ga0137377_101289122 | 3300012211 | Vadose Zone Soil | MNQEPKCECERPILRERAEQKGVSESFCDRCKRQIGLRPAAVRSVR* |
| Ga0137377_115845271 | 3300012211 | Vadose Zone Soil | MKQEPKCECERPILRERAEQKGVSESFCDRCKRPIGLRPAAIRLNA* |
| Ga0137370_101996032 | 3300012285 | Vadose Zone Soil | VKLEAKCECERPILRERAEQKGVSESFCARCMREIGLRPAAIRPA* |
| Ga0137372_100564912 | 3300012350 | Vadose Zone Soil | MKPEQKCECERPILRERAEQKGISESFCDRCKRPIGLRLAAIRNVG* |
| Ga0137386_110534412 | 3300012351 | Vadose Zone Soil | MNQEPKCECERPILRERAKQKGVSESFCDRCKRPIGLRPAAVRSAV* |
| Ga0137386_112660181 | 3300012351 | Vadose Zone Soil | KCECERPILRERAEQKGVSESFCDRCKRPIGLRPAAVRSPG* |
| Ga0137366_102715163 | 3300012354 | Vadose Zone Soil | MNQEPKCECERPILRERAEQKGVSESFCGRCKRPIGLRPAAIRSAV* |
| Ga0137360_117872241 | 3300012361 | Vadose Zone Soil | EPKCECERPILRERAEQKGVSESFCDRCKRPIGLRPAAVRSTV* |
| Ga0134041_10526832 | 3300012405 | Grasslands Soil | MNHEPKCECERPILRERAEQKGVSESFCDRCKRPLGLRLAAVRS |
| Ga0164298_104671412 | 3300012955 | Soil | MTTQKCECEKPILREHSEWKGSSESYCDRCKRPSGLRAATIPADTGPRL* |
| Ga0164303_104902442 | 3300012957 | Soil | MKQEPKCECERPILRERAEQKGASESFCDRCKRQIGLRLAAVRPIV* |
| Ga0164301_101428373 | 3300012960 | Soil | MKQEPKCECERPILRERAEQKGVSESFCDRCKRQIGLRLAAVRPIV* |
| Ga0134087_101101581 | 3300012977 | Grasslands Soil | CERPILRERAEQKGVSESFCDRCKRAIGFRPAVVRGVA* |
| Ga0164309_107880632 | 3300012984 | Soil | MNQEPKCECERPILRERAEQKGVSESFCDRCKRPVGLRPAAVRSAV* |
| Ga0164309_119188982 | 3300012984 | Soil | MKQEPKCECERPILRERAEQKGASESFCDRCKRQIGLRLAAVRPVA* |
| Ga0164304_108020442 | 3300012986 | Soil | MNDPKCECTKPILREHAEAKGISESYCDRCKRPLGLRLAAVKPAA* |
| Ga0164307_118839331 | 3300012987 | Soil | RAGDGSSPGPTSRGGGMKQEPKCECERPILRERAEQKGVSESFCDRCKRPIGLRPAAVRSAV* |
| Ga0164305_109910262 | 3300012989 | Soil | MNDPKCECAKPILREHAEAKGISESYCDRCKRPLGLRLAAVK |
| Ga0157370_115702412 | 3300013104 | Corn Rhizosphere | ERPILRERAEQKGVSESFCDRCKRPIGLRPAAVRSAV* |
| Ga0157372_113650792 | 3300013307 | Corn Rhizosphere | MNQEPKCECERPNLRERAEQKGVSESFCDRCKRPIGLRPAAVRSAV* |
| Ga0134081_103323182 | 3300014150 | Grasslands Soil | CECERPILRERAEQKGISESFCDRCKRPIGLRLAAVRNVA* |
| Ga0182001_100073264 | 3300014488 | Soil | GRMKQPTCECEKPILRERSEWKGAAEAYCDRCKRALTLRPRGRRAA* |
| Ga0182001_101653392 | 3300014488 | Soil | MKQVTCECEKPILRERSEWKGASEMYCDRCKRPIGLRPASKRAA* |
| Ga0157377_116839322 | 3300014745 | Miscanthus Rhizosphere | CMNQEPKCECERPILRERAEQKGVSESFCDRCKRPIGFRPAAVRSAM* |
| Ga0134072_100297732 | 3300015357 | Grasslands Soil | MNQEPKCQCERPILRERAEQKGVSKSFCDRCKRPLGLRLAAVRSTA* |
| Ga0134072_101997381 | 3300015357 | Grasslands Soil | MNQEPKCECERPILRERAEQKGISESFCDRCKRPIGLRPAAFRAA* |
| Ga0132258_128348112 | 3300015371 | Arabidopsis Rhizosphere | MNKQNCQCERPVLRERAEQKGVSESFCGRCKGPIGLRLAANVTAR* |
| Ga0132257_1017176201 | 3300015373 | Arabidopsis Rhizosphere | RPVLRERAEQKGVSESFCGRCKRPIGLRLAANVTAR* |
| Ga0134069_10846312 | 3300017654 | Grasslands Soil | MKQEPKCECERPILRERAEQKGVSESFCDRCKRPLGLRLAAVRSTA |
| Ga0134083_103884352 | 3300017659 | Grasslands Soil | MNQEPKCECERPILRERAEQKGVSESFCDRCKRPIGLRPAAI |
| Ga0184605_100017002 | 3300018027 | Groundwater Sediment | MKPEQKCECERPILRERAEQKGISESFCDRCKRPIGLRLAAVRNVA |
| Ga0184605_102947051 | 3300018027 | Groundwater Sediment | MNQEPKCECERPILRERAEQKGVSESFCDRCKRPIGLRPAALRSTV |
| Ga0184608_100003521 | 3300018028 | Groundwater Sediment | MNDPKCECAKPILREHSEAKGISESYCDRCKRPLG |
| Ga0184620_100434142 | 3300018051 | Groundwater Sediment | MNQEPKCECERPILRERAEQKGVSESFCDRCKRPIGLRPAALRRVI |
| Ga0184619_1000070911 | 3300018061 | Groundwater Sediment | MNEQPKCECEKPILRERSEWKGASESYCDRCKRPIGLRLSAVRPAA |
| Ga0184619_100236912 | 3300018061 | Groundwater Sediment | MNQEPKCECERPILRERAEQKGVSESFCDRCKRPIGLRPAAVRSAE |
| Ga0184619_101923722 | 3300018061 | Groundwater Sediment | MNQEPKCECERPILRERAEQKGVSESFCDRCKRPIGLRPAAVRSTV |
| Ga0184609_102335071 | 3300018076 | Groundwater Sediment | CECERILHERAEQKGVSESFCDRCKRPIGLRPAAVRSAE |
| Ga0066655_103089761 | 3300018431 | Grasslands Soil | MNQEPKCECERPILRERAEQKGVSESFCDRCKRPIGLRPAAIRLNA |
| Ga0066655_106709562 | 3300018431 | Grasslands Soil | MNLQNCQCERPILRERAEQKGVSESFCGRCKRPIGLRVAANVTVR |
| Ga0066655_107171261 | 3300018431 | Grasslands Soil | TGRGGCMNHEPKCECERPILRERAEQKGISESFCDRCKRPIGLRPAAFRAA |
| Ga0066655_112628991 | 3300018431 | Grasslands Soil | MNQEPKCQCERPILRERAEQKGVSESFCDRCKRAIGFRPAVVRGVA |
| Ga0066667_103859612 | 3300018433 | Grasslands Soil | MNHEPKCECERPILRERAEQKGVSESFCDRCKRPLGLRLAAVRSTA |
| Ga0066667_116244721 | 3300018433 | Grasslands Soil | GRGGCMNQEPKCECERPILRERAEQKGVSESFCDRCKRPIGLRPAAIRLNA |
| Ga0066667_120988222 | 3300018433 | Grasslands Soil | MNHEPKCECERPILRERAEQKGVSESFCDRCKRPIGLRPAAFRAA |
| Ga0066662_102152292 | 3300018468 | Grasslands Soil | MKTEKCECEKPILREHSEWKGSSESYCDRCKRPIGLRAATIPAETVPRL |
| Ga0066669_106565682 | 3300018482 | Grasslands Soil | MSHEPKCECERPILRERAEQKGVSESFCDRCKRPLGLRLAAVRSTA |
| Ga0066669_110654982 | 3300018482 | Grasslands Soil | MNPQNCQCERPILRERAEQKGASESFCGRCKRPIGLRPAAVRAT |
| Ga0066669_119815562 | 3300018482 | Grasslands Soil | MKQTTCECPKPILRERAEAKGSSESYCDRCKRPLGLRLAAVRSAA |
| Ga0066669_123157491 | 3300018482 | Grasslands Soil | GMKQEPKCECERPILRERAEQKGVSESFCDRCKRPIGLRPAAVRSAV |
| Ga0173482_102847402 | 3300019361 | Soil | MSQQPKCECERPILRERAEQKGVSESFCDRCKRPIGLRTAAVRPGRLIS |
| Ga0137408_11901575 | 3300019789 | Vadose Zone Soil | MNQEPKCECERPILRERAEQKGVSESFCDRCKRPIGLRPAAVRSAV |
| Ga0193701_10349623 | 3300019875 | Soil | MNDPKCECAKPILREHSEAKGISESYCDRCKRPLGLRLAAVKPAA |
| Ga0193701_10581322 | 3300019875 | Soil | MNQEPKCECERPILRERAEQKGVSESFCDRCKRPIGLRPAALRS |
| Ga0193701_11016942 | 3300019875 | Soil | RGGCMNQEPKCECERPILRERAEQKGVSESFCDRCKRPIGLRPAAVRSAE |
| Ga0193751_11212452 | 3300019888 | Soil | VKRHDKCICLKPVLRERAEAKGIAESYCGRCKLPLGLRSAAVRPAA |
| Ga0193730_10263901 | 3300020002 | Soil | RGGRMSQEPKCECERPILRERAEQKGVSESFCDRCKRSIGLRPAALRQ |
| Ga0193735_11168322 | 3300020006 | Soil | EPKCECERPILRERAEQKGVSESFCDRCKRPIGLRPAAVRSAE |
| Ga0193719_100092652 | 3300021344 | Soil | MSQEPKCECERPILRERAEQKGVSESFCDRCKRSIGLRPAALRR |
| Ga0193750_10114862 | 3300021413 | Soil | MKTEKCECEKPILREHSEWKGSSESYCDRCKRPIGLRAATIPADTVPRL |
| Ga0207653_100016551 | 3300025885 | Corn, Switchgrass And Miscanthus Rhizosphere | MNQQPKCECERPILRERAEQKGVSESFCDRCKRPIGLRTAAVRPGRLI |
| Ga0207688_101615042 | 3300025901 | Corn, Switchgrass And Miscanthus Rhizosphere | MNQEPKCECERPILRERAEQKGVSESFCDRCKRPIGLRTAAVRPGRLIS |
| Ga0207699_102119412 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | MNQQPKCECERPILRERAEQKGVSESFCDRCKRPIGLRTAAVHPGRLIS |
| Ga0207699_104101722 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | MTIQKCECKKPILREHSEWKGSSESYCDRCKRPIGLRSATVPADTVLRL |
| Ga0207684_101367632 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MNQEPKCECERPILRERAEQKGVSESFCDRCKRPISLRTAAARPAA |
| Ga0207663_105088562 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | MNQEPKCECERPILRERAEQKGVSESFCDRCKRPIGL |
| Ga0207646_102983092 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | MNQEPKCECERPILRERAEQKGVSESFCDRCKRPISLRTAPARPAA |
| Ga0207646_108281713 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | TGRGGCMNQEPKCECERPILRERAEQKGVSESFCDRCKRPIGLRTATVRPSRVI |
| Ga0207659_104442422 | 3300025926 | Miscanthus Rhizosphere | MNQEPKCECERPILRERAEQKGVSESFCDRCKRPIGLRPAAVRSAM |
| Ga0207686_105079023 | 3300025934 | Miscanthus Rhizosphere | PKCECERPILRERAEQKGVSESFCDRCKRPIGLRPAAVRSAV |
| Ga0207665_101225821 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | ERPILRERAEQKGVYESFCDRCKRPIGLRPAAVRSAV |
| Ga0207691_109643451 | 3300025940 | Miscanthus Rhizosphere | MNQEPKCECERPILRERAEQKGVSESFCDRCKRPIG |
| Ga0207667_122127412 | 3300025949 | Corn Rhizosphere | MNQQPKCECERPILRERAEQKGVSESFCDRCKRPIGLRTAAVR |
| Ga0209236_12425781 | 3300026298 | Grasslands Soil | MNQEPKCECERPILCERAEQKGVSESFCDRCKRPIGLRTATVRPAA |
| Ga0209027_10587422 | 3300026300 | Grasslands Soil | MNHEPKCECERPILRERAEHKGVSESFCDRCKRPIGLRPAAFRAA |
| Ga0209027_11852402 | 3300026300 | Grasslands Soil | VKLEAKCECERPILRERAEQKGISESFCARCKREIGLRPAAIRPA |
| Ga0209153_10016442 | 3300026312 | Soil | MSQEPKCECERPILRERAEHKGVSESFCDRCKRAIGLRPAAVRSVA |
| Ga0209801_11906641 | 3300026326 | Soil | MNKEPKCECERPILRERAEQKGVSESFCDRCKRPIGLRPAAIRLNA |
| Ga0209057_10817332 | 3300026342 | Soil | MNHEPKCECERPILRERAEQKGVSESFCDRCKRPLGL |
| Ga0209057_11054962 | 3300026342 | Soil | MNQEPKCECERPILRERAEQKGVSESFCDRCKRPIGLRPAAIRLNT |
| Ga0209474_102237732 | 3300026550 | Soil | MSQEPKCECERPILRERAERKGVSESFCDRCKRAIGLRPAAVRSVA |
| Ga0209474_103101401 | 3300026550 | Soil | KCECERPILRERAEQKGVSESFCDRCKRPLGLRLAAVRSTA |
| Ga0209577_103018492 | 3300026552 | Soil | MSQEPKCECERPILRERAEHKGVSESFCDRCKRAIGLRPAAVRSVT |
| Ga0209729_10550462 | 3300027061 | Forest Soil | MNQQPKCECERPILRERAEQKGVSESFCDRCKRPIGLRTAAV |
| Ga0209074_100256301 | 3300027787 | Agricultural Soil | MIQEPKCECQRPILRERAEQKGVSESFCDRCKRPIGLRTAAVRPSRSIS |
| Ga0209814_100011041 | 3300027873 | Populus Rhizosphere | MNHQSCQCERPILRERAEQKGASESFCGRCKRPIGLRVAANVTAR |
| Ga0307276_101451511 | 3300028705 | Soil | MKSEPKCECERPILRERAEQKGISESFCDRCKRPIGL |
| Ga0307282_100136711 | 3300028784 | Soil | MNQERKCECERPILRERAEQKGVSESFCDRCKRPIGLRPAALRSAV |
| Ga0307323_100001127 | 3300028787 | Soil | MNDPKCECAKPILREHSEAKGISDSYCDRCKRPLGLRLAAVKPAA |
| Ga0307299_103290142 | 3300028793 | Soil | MNQEPKCECERPILRERAEQKGVSESFCDRCKRPIGLR |
| Ga0307284_101046542 | 3300028799 | Soil | MKPEQKCECERPILRERAEQKGISESFCDRCKRPIGLRLAAVRNVP |
| Ga0307305_100201242 | 3300028807 | Soil | MKSEPKCECERPILRERAEQKGISESFCDRCKRPIGLRLAAFRNLA |
| Ga0307292_100659651 | 3300028811 | Soil | MNQEPKCECERPILRERAEQKGVSESFCDRCKRPIGLRPAAFAP |
| Ga0307296_103174772 | 3300028819 | Soil | MSQEPKCECERPILRERAEQKGVSESFCDRCKRSIGLRPAALRQ |
| Ga0307310_100397792 | 3300028824 | Soil | MNQEPKCECERPILRERAEQKGVSESFCDRCKRPIGLRPAALRSAV |
| Ga0307278_100180544 | 3300028878 | Soil | MNQEPKCECERPILHERAEQKGVSESFCDRCKRPIGLRPAALRSAV |
| Ga0307277_100116582 | 3300028881 | Soil | MKHEPKCECERPILRERAKQKGVSESFCDRCKRQIGLRLAAVRTIA |
| Ga0307277_100585713 | 3300028881 | Soil | MTQQATCECEKPILRERSEWKGASESFCDRCKRPLGLKPKKRAA |
| Ga0307277_101180152 | 3300028881 | Soil | MKPEQKCECERPILRERAEQKGISESFCDRCKRPIGLRLAAVRNIA |
| Ga0268241_101070292 | 3300030511 | Soil | MNHQNCQCERPILRERAEQKGVSESFCGRCKRPIGLRVAANVTVR |
| Ga0075394_120169442 | 3300030969 | Soil | MKQEPKCECERPILRERAEQKGVSESFCDRCKRQIGLRLAAVRPVV |
| Ga0307468_1002951541 | 3300031740 | Hardwood Forest Soil | MNQQPKCECERPILRERAEQKGVSESFCDRCKRPIGLRTA |
| Ga0308175_1005883072 | 3300031938 | Soil | VKLEAKCECERPILRERAEQKGVSESFCARCKREIGLRPAAIRPA |
| Ga0308175_1024683532 | 3300031938 | Soil | MKPEPKCECERPILRERAEQKGISESFCGRCKRQIGLRPAAIRTA |
| Ga0310811_108993111 | 3300033475 | Soil | EPKCECERPILRERAEQKGVSESFCDRCKRPIGLRPAALRRVI |
| ⦗Top⦘ |