NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F028578

Metagenome / Metatranscriptome Family F028578

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F028578
Family Type Metagenome / Metatranscriptome
Number of Sequences 191
Average Sequence Length 43 residues
Representative Sequence SFRARCVMSVQSRHWLDYDPVALVILVVGIGAVALLALSI
Number of Associated Samples 143
Number of Associated Scaffolds 191

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 20.34 %
% of genes near scaffold ends (potentially truncated) 69.63 %
% of genes from short scaffolds (< 2000 bps) 85.86 %
Associated GOLD sequencing projects 139
AlphaFold2 3D model prediction Yes
3D model pTM-score0.44

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (75.393 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(16.754 % of family members)
Environment Ontology (ENVO) Unclassified
(32.461 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(56.021 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Transmembrane (alpha-helical) Signal Peptide: No Secondary Structure distribution: α-helix: 48.53%    β-sheet: 0.00%    Coil/Unstructured: 51.47%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.44
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 191 Family Scaffolds
PF00557Peptidase_M24 37.70
PF01321Creatinase_N 3.66
PF03401TctC 3.14
PF00072Response_reg 2.09
PF00106adh_short 2.09
PF04392ABC_sub_bind 1.57
PF16113ECH_2 1.57
PF00924MS_channel 1.05
PF00011HSP20 1.05
PF03466LysR_substrate 0.52
PF08241Methyltransf_11 0.52
PF13649Methyltransf_25 0.52
PF13358DDE_3 0.52
PF13533Biotin_lipoyl_2 0.52
PF01638HxlR 0.52
PF01011PQQ 0.52
PF13551HTH_29 0.52
PF00528BPD_transp_1 0.52
PF13522GATase_6 0.52
PF00378ECH_1 0.52
PF00872Transposase_mut 0.52
PF13620CarboxypepD_reg 0.52
PF13565HTH_32 0.52
PF02397Bac_transf 0.52
PF01475FUR 0.52
PF01050MannoseP_isomer 0.52

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 191 Family Scaffolds
COG0006Xaa-Pro aminopeptidaseAmino acid transport and metabolism [E] 3.66
COG3181Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctCEnergy production and conversion [C] 3.14
COG2984ABC-type uncharacterized transport system, periplasmic componentGeneral function prediction only [R] 1.57
COG0071Small heat shock protein IbpA, HSP20 familyPosttranslational modification, protein turnover, chaperones [O] 1.05
COG0668Small-conductance mechanosensitive channelCell wall/membrane/envelope biogenesis [M] 1.05
COG3264Small-conductance mechanosensitive channel MscKCell wall/membrane/envelope biogenesis [M] 1.05
COG0735Fe2+ or Zn2+ uptake regulation protein Fur/ZurInorganic ion transport and metabolism [P] 0.52
COG1733DNA-binding transcriptional regulator, HxlR familyTranscription [K] 0.52
COG2148Sugar transferase involved in LPS biosynthesis (colanic, teichoic acid)Cell wall/membrane/envelope biogenesis [M] 0.52
COG3328Transposase (or an inactivated derivative)Mobilome: prophages, transposons [X] 0.52


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms75.39 %
UnclassifiedrootN/A24.61 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2124908045|KansclcFeb2_ConsensusfromContig551229Not Available500Open in IMG/M
2189573003|GZIR7W401BBMM1All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales509Open in IMG/M
3300002911|JGI25390J43892_10024378All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1458Open in IMG/M
3300003162|Ga0006778J45830_1027215Not Available505Open in IMG/M
3300004157|Ga0062590_100930629All Organisms → cellular organisms → Bacteria817Open in IMG/M
3300004479|Ga0062595_100134398All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1402Open in IMG/M
3300004479|Ga0062595_100671998Not Available825Open in IMG/M
3300004629|Ga0008092_11348248All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales828Open in IMG/M
3300004643|Ga0062591_100811403All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales864Open in IMG/M
3300004801|Ga0058860_12218288All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium963Open in IMG/M
3300005175|Ga0066673_10306483All Organisms → cellular organisms → Bacteria → Proteobacteria926Open in IMG/M
3300005179|Ga0066684_10810679All Organisms → cellular organisms → Bacteria → Proteobacteria618Open in IMG/M
3300005186|Ga0066676_10944990All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales576Open in IMG/M
3300005332|Ga0066388_100234521All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria2469Open in IMG/M
3300005332|Ga0066388_100449618Not Available1930Open in IMG/M
3300005332|Ga0066388_100677579All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1642Open in IMG/M
3300005332|Ga0066388_101649793Not Available1131Open in IMG/M
3300005332|Ga0066388_107705914Not Available539Open in IMG/M
3300005332|Ga0066388_107786198All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales536Open in IMG/M
3300005341|Ga0070691_10229344All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium987Open in IMG/M
3300005344|Ga0070661_101106923All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium660Open in IMG/M
3300005356|Ga0070674_100265484All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1354Open in IMG/M
3300005363|Ga0008090_10133400All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales528Open in IMG/M
3300005363|Ga0008090_10160673All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1039Open in IMG/M
3300005363|Ga0008090_10231814All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales567Open in IMG/M
3300005363|Ga0008090_10247686All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1102Open in IMG/M
3300005434|Ga0070709_10426428All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria995Open in IMG/M
3300005440|Ga0070705_101865642Not Available511Open in IMG/M
3300005467|Ga0070706_101744209All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales566Open in IMG/M
3300005548|Ga0070665_102651907All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales501Open in IMG/M
3300005555|Ga0066692_10737055Not Available609Open in IMG/M
3300005561|Ga0066699_10663522All Organisms → cellular organisms → Bacteria746Open in IMG/M
3300005713|Ga0066905_100252490All Organisms → cellular organisms → Bacteria → Proteobacteria1356Open in IMG/M
3300005713|Ga0066905_101215092All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium674Open in IMG/M
3300005764|Ga0066903_100036162All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales5716Open in IMG/M
3300005764|Ga0066903_100359123All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae2362Open in IMG/M
3300005764|Ga0066903_100474312Not Available2105Open in IMG/M
3300005764|Ga0066903_101068595All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium1484Open in IMG/M
3300005764|Ga0066903_101956412All Organisms → cellular organisms → Bacteria → Proteobacteria1125Open in IMG/M
3300005764|Ga0066903_102006593All Organisms → cellular organisms → Bacteria1111Open in IMG/M
3300005764|Ga0066903_103616408All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium832Open in IMG/M
3300005764|Ga0066903_104121411All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria778Open in IMG/M
3300005764|Ga0066903_104293919All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales762Open in IMG/M
3300005764|Ga0066903_104377395All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium754Open in IMG/M
3300005764|Ga0066903_105753382All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium651Open in IMG/M
3300005764|Ga0066903_106027478Not Available635Open in IMG/M
3300005764|Ga0066903_108390457All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium527Open in IMG/M
3300005764|Ga0066903_108500436Not Available523Open in IMG/M
3300005764|Ga0066903_109002258Not Available505Open in IMG/M
3300006038|Ga0075365_10212834All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1355Open in IMG/M
3300006051|Ga0075364_10777960All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium653Open in IMG/M
3300006175|Ga0070712_100719363All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium852Open in IMG/M
3300006572|Ga0074051_11478502All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium596Open in IMG/M
3300006576|Ga0074047_12028658All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1475Open in IMG/M
3300006755|Ga0079222_11451384Not Available639Open in IMG/M
3300006844|Ga0075428_101185117All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium805Open in IMG/M
3300006845|Ga0075421_102665378Not Available517Open in IMG/M
3300006854|Ga0075425_100475145All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1439Open in IMG/M
3300006903|Ga0075426_11113819All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales598Open in IMG/M
3300006954|Ga0079219_10729229All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. PRIMUS42761Open in IMG/M
3300007004|Ga0079218_12342793Not Available626Open in IMG/M
3300009089|Ga0099828_10263771All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1546Open in IMG/M
3300009100|Ga0075418_13172637All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium500Open in IMG/M
3300009137|Ga0066709_104316294Not Available518Open in IMG/M
3300009147|Ga0114129_12684674All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. PRIMUS42593Open in IMG/M
3300009174|Ga0105241_10552861All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1034Open in IMG/M
3300009792|Ga0126374_10293009All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium1087Open in IMG/M
3300009792|Ga0126374_10889092All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium689Open in IMG/M
3300009792|Ga0126374_11838206Not Available508Open in IMG/M
3300010043|Ga0126380_11665664All Organisms → cellular organisms → Bacteria → Proteobacteria572Open in IMG/M
3300010046|Ga0126384_10128808All Organisms → cellular organisms → Bacteria1917Open in IMG/M
3300010047|Ga0126382_10969966All Organisms → cellular organisms → Bacteria742Open in IMG/M
3300010147|Ga0126319_1445645All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1116Open in IMG/M
3300010154|Ga0127503_10204761All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1182Open in IMG/M
3300010154|Ga0127503_10537320All Organisms → cellular organisms → Bacteria → Proteobacteria578Open in IMG/M
3300010154|Ga0127503_11213804All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium935Open in IMG/M
3300010337|Ga0134062_10185263All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium942Open in IMG/M
3300010358|Ga0126370_11152905All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales718Open in IMG/M
3300010358|Ga0126370_12540382All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium511Open in IMG/M
3300010359|Ga0126376_10009701All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales5939Open in IMG/M
3300010360|Ga0126372_10612101All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → Rhodovulum → unclassified Rhodovulum → Rhodovulum sp.1047Open in IMG/M
3300010360|Ga0126372_11917100All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales638Open in IMG/M
3300010362|Ga0126377_11540557All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium739Open in IMG/M
3300010397|Ga0134124_10089409All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales2662Open in IMG/M
3300010398|Ga0126383_13106922All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria542Open in IMG/M
3300010398|Ga0126383_13536815Not Available510Open in IMG/M
3300012202|Ga0137363_10371499All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1187Open in IMG/M
3300012202|Ga0137363_10647744All Organisms → cellular organisms → Bacteria893Open in IMG/M
3300012203|Ga0137399_10735445All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium831Open in IMG/M
3300012204|Ga0137374_10087625All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria2987Open in IMG/M
3300012204|Ga0137374_11044686Not Available586Open in IMG/M
3300012205|Ga0137362_11065708All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria687Open in IMG/M
3300012205|Ga0137362_11694531All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium519Open in IMG/M
3300012212|Ga0150985_111537015All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium615Open in IMG/M
3300012212|Ga0150985_113804658All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1202Open in IMG/M
3300012361|Ga0137360_11211017All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium653Open in IMG/M
3300012392|Ga0134043_1208650All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales557Open in IMG/M
3300012469|Ga0150984_109192876All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales550Open in IMG/M
3300012914|Ga0157297_10356777Not Available571Open in IMG/M
3300012987|Ga0164307_10240392All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1258Open in IMG/M
3300013297|Ga0157378_12515346All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. PRIMUS42567Open in IMG/M
3300015264|Ga0137403_10277240All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1579Open in IMG/M
3300015374|Ga0132255_103803401All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. PRIMUS42641Open in IMG/M
3300016270|Ga0182036_11503287All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales565Open in IMG/M
3300016319|Ga0182033_11882249All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales544Open in IMG/M
3300016341|Ga0182035_11890837All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales541Open in IMG/M
3300016404|Ga0182037_11879336All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales536Open in IMG/M
3300016445|Ga0182038_11184647All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium681Open in IMG/M
3300017657|Ga0134074_1401018Not Available509Open in IMG/M
3300018055|Ga0184616_10141593All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium884Open in IMG/M
3300018078|Ga0184612_10184662All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1086Open in IMG/M
3300018081|Ga0184625_10192496All Organisms → cellular organisms → Bacteria1069Open in IMG/M
3300019228|Ga0180119_1132105All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales531Open in IMG/M
3300019263|Ga0184647_1262099All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales536Open in IMG/M
3300019356|Ga0173481_10595974Not Available580Open in IMG/M
3300020002|Ga0193730_1043413All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1301Open in IMG/M
3300020579|Ga0210407_10450251All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1007Open in IMG/M
3300020581|Ga0210399_11399282All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium547Open in IMG/M
3300021439|Ga0213879_10097963All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria820Open in IMG/M
3300021560|Ga0126371_10269227All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1823Open in IMG/M
3300021560|Ga0126371_10864253All Organisms → cellular organisms → Bacteria1049Open in IMG/M
3300021560|Ga0126371_12131605All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium676Open in IMG/M
3300021560|Ga0126371_12489526Not Available626Open in IMG/M
3300021560|Ga0126371_13309569All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium545Open in IMG/M
3300022726|Ga0242654_10054801All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1140Open in IMG/M
3300022726|Ga0242654_10390672Not Available532Open in IMG/M
3300022726|Ga0242654_10409561All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium522Open in IMG/M
3300025960|Ga0207651_11284393All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium658Open in IMG/M
3300026277|Ga0209350_1032878All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1544Open in IMG/M
3300026310|Ga0209239_1001705All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales13128Open in IMG/M
3300026550|Ga0209474_10043504All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC68603263Open in IMG/M
3300026552|Ga0209577_10683197All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales584Open in IMG/M
3300027646|Ga0209466_1010951All Organisms → cellular organisms → Bacteria → Proteobacteria1918Open in IMG/M
3300027738|Ga0208989_10041454All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1598Open in IMG/M
3300027903|Ga0209488_10660390Not Available753Open in IMG/M
3300027909|Ga0209382_10501868All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae1336Open in IMG/M
3300028778|Ga0307288_10267221Not Available674Open in IMG/M
3300028784|Ga0307282_10015702All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria3116Open in IMG/M
3300028793|Ga0307299_10109270All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1035Open in IMG/M
3300028889|Ga0247827_10889391All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales597Open in IMG/M
3300030829|Ga0308203_1015211All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium943Open in IMG/M
3300030902|Ga0308202_1011011All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1267Open in IMG/M
3300030902|Ga0308202_1034219All Organisms → cellular organisms → Bacteria871Open in IMG/M
3300030981|Ga0102770_11247906All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium555Open in IMG/M
3300030998|Ga0073996_12328280Not Available624Open in IMG/M
3300031058|Ga0308189_10465078All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales538Open in IMG/M
3300031091|Ga0308201_10360316All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium536Open in IMG/M
3300031094|Ga0308199_1079563All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium691Open in IMG/M
3300031094|Ga0308199_1164322All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria538Open in IMG/M
3300031152|Ga0307501_10087578All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium766Open in IMG/M
3300031231|Ga0170824_110131912Not Available651Open in IMG/M
3300031544|Ga0318534_10431991Not Available755Open in IMG/M
3300031545|Ga0318541_10395377All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium772Open in IMG/M
3300031572|Ga0318515_10225893All Organisms → cellular organisms → Bacteria → Proteobacteria1004Open in IMG/M
3300031572|Ga0318515_10727591All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales525Open in IMG/M
3300031573|Ga0310915_10018688All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales4180Open in IMG/M
3300031640|Ga0318555_10168622All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1176Open in IMG/M
3300031682|Ga0318560_10438216All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium707Open in IMG/M
3300031720|Ga0307469_11055781All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium761Open in IMG/M
3300031744|Ga0306918_10238313All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1384Open in IMG/M
3300031748|Ga0318492_10599859All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales587Open in IMG/M
3300031764|Ga0318535_10291135Not Available731Open in IMG/M
3300031768|Ga0318509_10535636Not Available654Open in IMG/M
3300031770|Ga0318521_10135834All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1386Open in IMG/M
3300031819|Ga0318568_10058490All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC68602240Open in IMG/M
3300031820|Ga0307473_10310334All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium997Open in IMG/M
3300031845|Ga0318511_10202820All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium881Open in IMG/M
3300031880|Ga0318544_10198912All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium773Open in IMG/M
3300031897|Ga0318520_10490772All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium757Open in IMG/M
3300031912|Ga0306921_10260802Not Available2030Open in IMG/M
3300031946|Ga0310910_10899181All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales695Open in IMG/M
3300031959|Ga0318530_10271677All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium699Open in IMG/M
3300032090|Ga0318518_10476320All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales640Open in IMG/M
3300032174|Ga0307470_11023976All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium659Open in IMG/M
3300032205|Ga0307472_102653960Not Available511Open in IMG/M
3300033290|Ga0318519_10066730All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1854Open in IMG/M
3300033290|Ga0318519_10227610All Organisms → cellular organisms → Bacteria → Proteobacteria1072Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil16.75%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil13.09%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil9.95%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil8.38%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil5.76%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil5.24%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil3.66%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil3.66%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere3.66%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil2.62%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere2.62%
Tropical Rainforest SoilEnvironmental → Terrestrial → Soil → Unclassified → Tropical Rainforest → Tropical Rainforest Soil2.62%
SoilEnvironmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil2.09%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil2.09%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment1.57%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil1.57%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil1.57%
Groundwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment1.05%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil1.05%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere1.05%
Populus EndosphereHost-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere1.05%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere1.05%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere1.05%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil0.52%
Bulk SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Bulk Soil0.52%
Grass SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grass Soil0.52%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil0.52%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil0.52%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil0.52%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil0.52%
Host-AssociatedHost-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated0.52%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere0.52%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.52%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.52%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere0.52%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere0.52%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2124908045Soil microbial communities from Great Prairies - Kansas assembly 1 01_01_2011EnvironmentalOpen in IMG/M
2189573003Grass soil microbial communities from Rothamsted Park, UK - FE2 (NaCl 30g/L 5ml)EnvironmentalOpen in IMG/M
3300002906Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_60cmEnvironmentalOpen in IMG/M
3300002911Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_2_20cmEnvironmentalOpen in IMG/M
3300002914Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cmEnvironmentalOpen in IMG/M
3300003162Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_21 (Metagenome Metatranscriptome, Counting Only)Host-AssociatedOpen in IMG/M
3300004157Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2EnvironmentalOpen in IMG/M
3300004479Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAsEnvironmentalOpen in IMG/M
3300004480Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4EnvironmentalOpen in IMG/M
3300004629Tropical rainforest soil microbial communities from the Amazon Forest, Brazil, analyzing deforestation - Metatranscriptome P72I A01 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300004643Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3EnvironmentalOpen in IMG/M
3300004801Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300005175Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122EnvironmentalOpen in IMG/M
3300005179Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133EnvironmentalOpen in IMG/M
3300005186Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125EnvironmentalOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005341Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaGEnvironmentalOpen in IMG/M
3300005344Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaGHost-AssociatedOpen in IMG/M
3300005356Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaGHost-AssociatedOpen in IMG/M
3300005363Tropical rainforest soil microbial communities from the Amazon Forest, Brazil, analyzing deforestation - Metatranscriptome F II A100 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300005434Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaGEnvironmentalOpen in IMG/M
3300005440Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaGEnvironmentalOpen in IMG/M
3300005467Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaGEnvironmentalOpen in IMG/M
3300005548Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaGHost-AssociatedOpen in IMG/M
3300005555Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141EnvironmentalOpen in IMG/M
3300005561Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148EnvironmentalOpen in IMG/M
3300005713Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2)EnvironmentalOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300006038Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5Host-AssociatedOpen in IMG/M
3300006051Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4Host-AssociatedOpen in IMG/M
3300006175Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaGEnvironmentalOpen in IMG/M
3300006572Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHPB (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006576Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLPA (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006755Agricultural soil microbial communities from Georgia to study Nitrogen management - GA PlitterEnvironmentalOpen in IMG/M
3300006844Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2Host-AssociatedOpen in IMG/M
3300006845Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5Host-AssociatedOpen in IMG/M
3300006854Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4Host-AssociatedOpen in IMG/M
3300006903Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5Host-AssociatedOpen in IMG/M
3300006954Agricultural soil microbial communities from Georgia to study Nitrogen management - GA ControlEnvironmentalOpen in IMG/M
3300007004Agricultural soil microbial communities from Utah to study Nitrogen management - NC CompostEnvironmentalOpen in IMG/M
3300009089Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaGEnvironmentalOpen in IMG/M
3300009100Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2Host-AssociatedOpen in IMG/M
3300009137Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158EnvironmentalOpen in IMG/M
3300009147Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2)Host-AssociatedOpen in IMG/M
3300009174Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaGHost-AssociatedOpen in IMG/M
3300009792Tropical forest soil microbial communities from Panama - MetaG Plot_12EnvironmentalOpen in IMG/M
3300010043Tropical forest soil microbial communities from Panama - MetaG Plot_26EnvironmentalOpen in IMG/M
3300010046Tropical forest soil microbial communities from Panama - MetaG Plot_36EnvironmentalOpen in IMG/M
3300010047Tropical forest soil microbial communities from Panama - MetaG Plot_30EnvironmentalOpen in IMG/M
3300010147Soil microbial communities from California, USA to study soil gas exchange rates - BB-CA-RED metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010154Soil microbial communities from Willow Creek, Wisconsin, USA - WC-WI-TBF metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010337Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09082015EnvironmentalOpen in IMG/M
3300010358Tropical forest soil microbial communities from Panama - MetaG Plot_3EnvironmentalOpen in IMG/M
3300010359Tropical forest soil microbial communities from Panama - MetaG Plot_15EnvironmentalOpen in IMG/M
3300010360Tropical forest soil microbial communities from Panama - MetaG Plot_6EnvironmentalOpen in IMG/M
3300010362Tropical forest soil microbial communities from Panama - MetaG Plot_22EnvironmentalOpen in IMG/M
3300010397Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4EnvironmentalOpen in IMG/M
3300010398Tropical forest soil microbial communities from Panama - MetaG Plot_35EnvironmentalOpen in IMG/M
3300012202Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaGEnvironmentalOpen in IMG/M
3300012203Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaGEnvironmentalOpen in IMG/M
3300012204Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaGEnvironmentalOpen in IMG/M
3300012205Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaGEnvironmentalOpen in IMG/M
3300012212Combined assembly of Hopland grassland soilHost-AssociatedOpen in IMG/M
3300012361Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaGEnvironmentalOpen in IMG/M
3300012392Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_2_4_1 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012469Combined assembly of Soil carbon rhizosphereHost-AssociatedOpen in IMG/M
3300012882Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2EnvironmentalOpen in IMG/M
3300012914Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S028-104C-2EnvironmentalOpen in IMG/M
3300012987Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MGEnvironmentalOpen in IMG/M
3300013297Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaGHost-AssociatedOpen in IMG/M
3300015264Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300015374Col-0 rhizosphere combined assemblyHost-AssociatedOpen in IMG/M
3300016270Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080EnvironmentalOpen in IMG/M
3300016319Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00HEnvironmentalOpen in IMG/M
3300016341Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170EnvironmentalOpen in IMG/M
3300016387Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176EnvironmentalOpen in IMG/M
3300016404Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082EnvironmentalOpen in IMG/M
3300016445Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108EnvironmentalOpen in IMG/M
3300017657Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09212015EnvironmentalOpen in IMG/M
3300018055Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_90_coexEnvironmentalOpen in IMG/M
3300018078Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_coexEnvironmentalOpen in IMG/M
3300018081Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b1EnvironmentalOpen in IMG/M
3300019228Metatranscriptome of soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaT ERMLT790_16_1Ra (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019263Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019356Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S073-202C-2 (version 2)EnvironmentalOpen in IMG/M
3300020002Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1a1EnvironmentalOpen in IMG/M
3300020579Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-MEnvironmentalOpen in IMG/M
3300020581Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-MEnvironmentalOpen in IMG/M
3300021439Vellozia epidendroides bulk soil microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - BS_R03EnvironmentalOpen in IMG/M
3300021560Tropical forest soil microbial communities from Panama - MetaG Plot_4EnvironmentalOpen in IMG/M
3300022726Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-30-M (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300025960Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026277Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_2_20cm (SPAdes)EnvironmentalOpen in IMG/M
3300026310Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_2_20cm (SPAdes)EnvironmentalOpen in IMG/M
3300026320Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_40cm (SPAdes)EnvironmentalOpen in IMG/M
3300026550Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 (SPAdes)EnvironmentalOpen in IMG/M
3300026552Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 (SPAdes)EnvironmentalOpen in IMG/M
3300027646Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 30 MoBio (SPAdes)EnvironmentalOpen in IMG/M
3300027738Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM3_M1 (SPAdes)EnvironmentalOpen in IMG/M
3300027903Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes)EnvironmentalOpen in IMG/M
3300027909Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes)Host-AssociatedOpen in IMG/M
3300028778Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_142EnvironmentalOpen in IMG/M
3300028784Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_121EnvironmentalOpen in IMG/M
3300028793Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_159EnvironmentalOpen in IMG/M
3300028889Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day2EnvironmentalOpen in IMG/M
3300030829Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_357 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030902Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_356 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030981Forest soil microbial communities from USA, for metatranscriptomics studies - Jemez Pines PO 4C (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030998Metatranscriptome of forest soil microbial communities from Montana, USA - Site 5 -Soil GP-3A (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031058Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_184 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031091Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_355 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031094Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_203 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031152Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 15_SEnvironmentalOpen in IMG/M
3300031231Coassembly Site 11 (all samples) - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031544Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26EnvironmentalOpen in IMG/M
3300031545Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26EnvironmentalOpen in IMG/M
3300031572Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19EnvironmentalOpen in IMG/M
3300031573Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111EnvironmentalOpen in IMG/M
3300031640Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23EnvironmentalOpen in IMG/M
3300031682Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f22EnvironmentalOpen in IMG/M
3300031720Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515EnvironmentalOpen in IMG/M
3300031736Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f21EnvironmentalOpen in IMG/M
3300031744Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2)EnvironmentalOpen in IMG/M
3300031748Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f22EnvironmentalOpen in IMG/M
3300031763Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f29EnvironmentalOpen in IMG/M
3300031764Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f27EnvironmentalOpen in IMG/M
3300031768Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f22EnvironmentalOpen in IMG/M
3300031770Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17EnvironmentalOpen in IMG/M
3300031819Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f21EnvironmentalOpen in IMG/M
3300031820Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515EnvironmentalOpen in IMG/M
3300031845Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f18EnvironmentalOpen in IMG/M
3300031846Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f19EnvironmentalOpen in IMG/M
3300031880Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f25EnvironmentalOpen in IMG/M
3300031897Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16EnvironmentalOpen in IMG/M
3300031912Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2)EnvironmentalOpen in IMG/M
3300031946Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172EnvironmentalOpen in IMG/M
3300031959Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f24EnvironmentalOpen in IMG/M
3300031981Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f25EnvironmentalOpen in IMG/M
3300032064Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f17EnvironmentalOpen in IMG/M
3300032090Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f22EnvironmentalOpen in IMG/M
3300032174Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05EnvironmentalOpen in IMG/M
3300032205Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05EnvironmentalOpen in IMG/M
3300033290Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
KansclcFeb2_022173302124908045SoilMSVQSRDVQSRHWLDYDPVALLILVVGIGAVALLALSI
FE2_022872302189573003Grass SoilKWVGRFRARCVMSVQSRHWLDYDPVALVILVVGIGAVALLALSI
JGI25614J43888_1004258523300002906Grasslands SoilLLRLRTDIRRNRRARRVMSVQTRHWLDYDPVALVVLLAGMSAVALLALSI*
JGI25390J43892_1002437823300002911Grasslands SoilDAAFRARCVMSVQSRHVQTRHWLDYDPVALLILVVGIGAVALLALSI*
JGI25617J43924_1006188423300002914Grasslands SoilLLRLRTDIRRNRRARRVMSVQSRHWLDYDPVALVVLLVGMSAVALLALSI*
Ga0006778J45830_102721513300003162Avena Fatua RhizosphereSRPYGAFGTRVAADRSLRARCVMRVQSGHWLDYDPVALVILVVGIGAVALLALSI*
Ga0062590_10093062913300004157SoilSKSGAQVCCQVRRVMRVQSGQWLDYDPLALVVLVLGIGAVALIAFTI*
Ga0062595_10013439823300004479SoilLDLWGPGRRVGWSFRARCVMSVQSRHWLDYDPVALVILVVGIGAVALLALSI*
Ga0062595_10067199813300004479SoilREWTRVDATFRARCVMNVQSRHWLDYDPVALVILVVGIGAVALLALSI*
Ga0062592_10181778623300004480SoilMWDWDKSGRDPSLRARCVMRVQSGHWLDYDPVALVILVVGIGAVALLALSI*
Ga0008092_1134824823300004629Tropical Rainforest SoilMGPGRRVGWSFRARCVMSVQSRHWLDYDPVALVILVVGIGAVALLALSI*
Ga0062591_10081140323300004643SoilMALVVAYRVRGVMRVHGRGHWLDYDPVALAILVIGIGVVALLAISI*
Ga0058860_1221828823300004801Host-AssociatedGRPYGAFGTRVAADRSLRARCVMRVQSGHWLDYDPVALVILVVGIGAVALLALSI*
Ga0066673_1030648323300005175SoilMDRVKVMRVQSGHWLDYDPIALVVLILGIGAVALLALSI*
Ga0066684_1081067913300005179SoilVDAAFRARCVMTVQTRHWLDYDPIALLVLVVGIGAVALLALSI*
Ga0066676_1094499013300005186SoilPPALDLWGPGRRVGWSFRARCVMSVQSRHWLDYDPVALVILVVGIGAVALLALSI*
Ga0066388_10023452153300005332Tropical Forest SoilMRFSGARCFMTAQTRHWLDYDPIALLVLVVGIGAVALLAVSI*
Ga0066388_10044961833300005332Tropical Forest SoilMDRVKVMRVQSGHWLDYDPVALLVLIVGIGAVALLALSI*
Ga0066388_10067757913300005332Tropical Forest SoilMDRARVDATFRARYVMSVQSRHWLDYDPVALVILVVGIGAVALLALSI*
Ga0066388_10164979313300005332Tropical Forest SoilLAVRFQGIVMRVHSGHWLDYDPIALVVLVLGIAAVALLVLSI*
Ga0066388_10770591413300005332Tropical Forest SoilSVAGFFSARCSMSVQSSHWLDYDPVALVVLLVGYGAVAFLALSI*
Ga0066388_10778619823300005332Tropical Forest SoilLDVGPGRRVGWSFRARCVMSVQSRHWLDYDPVALLILVVGIGAVALLALSI*
Ga0070691_1022934423300005341Corn, Switchgrass And Miscanthus RhizosphereAFGTRVAADRSLRARCVMRVQSGHWLDYDPVALVILVVGIGAVALLALSI*
Ga0070661_10110692313300005344Corn RhizosphereLAGTEWRLWLLTGVRGVMRVHGRGHWLDYDPVALAILVIGIGVVALLAISI*
Ga0070674_10026548413300005356Miscanthus RhizosphereGTRVAADRSLRARCVMRVQSGHWLDYDPVALVILVVGIGAVALLALSI*
Ga0008090_1013340013300005363Tropical Rainforest SoilKPPPALDLWGPGRRVGWSFRARCVMSVQSRHWLDYDPVALVILVVGIGAVALLALSI*
Ga0008090_1016067323300005363Tropical Rainforest SoilMDRTRVDATFRARFVMSVQSRHWLDYDPVALVILVVGIGAVALLALSI*
Ga0008090_1023181423300005363Tropical Rainforest SoilGPGRRVGWSFRARCVMSVQSRHWLDYDPVALLILVVGIGAVALLALSI*
Ga0008090_1024768613300005363Tropical Rainforest SoilRVDATFRARFVMSVQSRHWLDYDPVALVILVVGIGAVALLALSI*
Ga0070709_1042642823300005434Corn, Switchgrass And Miscanthus RhizosphereWVFSGLRCVMSVQSRHWLDYDPVALVVLLVGMSAVALLALSI*
Ga0070705_10186564213300005440Corn, Switchgrass And Miscanthus RhizosphereRPYGAFGTRVAADRSLRARCVMRVQSGHWLDYDPVALVILVVGIGAVALLALSI*
Ga0070706_10174420913300005467Corn, Switchgrass And Miscanthus RhizosphereGPGRRVGWSFRARCVMSVQSRHWLDYDPVALVILVVGIGAVALLALSI*
Ga0070665_10265190713300005548Switchgrass RhizosphereRCVMRVQSGHWLDYDPVALVILVVGIGAVALLALSI*
Ga0066692_1073705513300005555SoilMSVQSRHVQTRHWLDYDPVALLILVVGIGAVALLALSI*
Ga0066699_1066352233300005561SoilVDAAFRARCVMSVQSRHVQTRHWLDYDPVALLILVVGIGAVALLALSI*
Ga0066905_10025249013300005713Tropical Forest SoilMAQAVFRVRCVMRAQSSHWLDYDPVALVILVVGIGAVALLALSI*
Ga0066905_10121509223300005713Tropical Forest SoilRARCVMSVQSRHWLDYDPVALLILVVGIGAVALLALSI*
Ga0066903_10003616263300005764Tropical Forest SoilMHDGIGAQSRHWLDYDPVALLVLILGIGAVALVALSI*
Ga0066903_10035912323300005764Tropical Forest SoilMHDGMRAQSRHWLDYDPVALVVLIVGIGVVALLALSI*
Ga0066903_10047431243300005764Tropical Forest SoilDGMRAQSRHWLDYDPVALVVLIVGMGVVALLALNI*
Ga0066903_10106859533300005764Tropical Forest SoilMHDGMRAQSRHWLDYDPVALVVLIVGMGVVALLALNI*
Ga0066903_10195641223300005764Tropical Forest SoilMRAAYSGHWLDYDPIALVVLVVGIGAVALLAISI*
Ga0066903_10200659323300005764Tropical Forest SoilRKPPPALDVGPGRRAGWSFRARCVMSVQSRHWLDYDPVALVILVVGIGAVALLALSI*
Ga0066903_10361640823300005764Tropical Forest SoilRFVMSVQSRHWLDYDPVALVILVVGIGAVALLALSI*
Ga0066903_10412141133300005764Tropical Forest SoilMHHGMRAQSRYWLDYDPVALIVLIVGIGVVALLALSI*
Ga0066903_10429391923300005764Tropical Forest SoilLLFGEIVMHVLSGHWLDYDHIALVVLIIGLGTVELLALSM*
Ga0066903_10437739513300005764Tropical Forest SoilGRRVGWSFRARCVMSVQSRHWLDYDPVALVILVVGIGAVALLALSI*
Ga0066903_10575338213300005764Tropical Forest SoilRCVMSVQSRHWLDYDPVALVILVVGIGAVALLALSI*
Ga0066903_10602747823300005764Tropical Forest SoilMHDRMRAQGGHWLDYDPVALVVLILGIGAVALLTLSI*
Ga0066903_10755357913300005764Tropical Forest SoilLEGVGVMRIQRGQWLDYDPIALAVLIIGIGIVMLVALGM*
Ga0066903_10839045713300005764Tropical Forest SoilRARCVMNVQSRHWLDYDPVALVILVVGIGAVALLALSI*
Ga0066903_10850043623300005764Tropical Forest SoilKARSATARRVMKVQSRHWLDYDSVALVVLVVGMSAVALLAAR*
Ga0066903_10900225813300005764Tropical Forest SoilMHDGMRAQSRHWLDYDPVAVVVLIVGIGVVALLVLSI*
Ga0075365_1021283413300006038Populus EndosphereLRARCVMRVQSGHWLDYDPVALVILVVGIGAVALLALSI*
Ga0075364_1077796023300006051Populus EndosphereGTRVAADRSLRARCVMRAQSGHWLDYDPVALVILVVGIGAVALLALSI*
Ga0070712_10071936313300006175Corn, Switchgrass And Miscanthus RhizosphereCVMNVQSRHWLDYDPVALVILVVGIGAVALLALSI*
Ga0074051_1147850223300006572SoilADRSLRARCVMRVQSGHWLDYDPVALVILVVGIGAVALLALSI*
Ga0074047_1202865813300006576SoilFGTRVAADRSLRARCVMRVQSGHWLDYDPVALVILVVGIGAVALLALSI*
Ga0079222_1145138413300006755Agricultural SoilVDATFQVRCVMNVQSRHWLDYDPVALVILVVGIGAVALLALSI*
Ga0075428_10118511723300006844Populus RhizosphereSFRARCVMRVQSGHWLDYDPVALVILVVGIGAVALLALSI*
Ga0075421_10266537823300006845Populus RhizosphereVSFYRVRCVMRVQSGHWLDYDPVALVVLVLGIGAVALLALSI*
Ga0075425_10047514523300006854Populus RhizosphereEWTRVDATFRARCVMNVQSRHWLDYDPVALVILVVGIGAVALLALSI*
Ga0075426_1111381913300006903Populus RhizosphereKSGRDPSLRARCVMRVQSGHWLDYDPVALVILVVGIGAVALLALSI*
Ga0079219_1072922923300006954Agricultural SoilMALVVAYRVRGVMHVHGRGHWLDYDPVALAILVIGIGVVALLAISI*
Ga0079218_1234279313300007004Agricultural SoilARLVMRVQARHWLDYDPVALVVLVVGIGAIALLALSI*
Ga0099828_1026377113300009089Vadose Zone SoilRRVMRVQSGHWLDYDPLALVVLVLGIGAVALIAFTI*
Ga0075418_1317263723300009100Populus RhizosphereSSFCRVRCVMRVQSGHWLDYDPVALVVLVLGIGAVALLALSI*
Ga0066709_10431629423300009137Grasslands SoilMHHGMRAQSRHWLDYDPVALVVLIVGIGVVALLALSI*
Ga0114129_1268467423300009147Populus RhizosphereMRVQSRGHWLDYDPVALAILIIGIGIVALLAVSI*
Ga0105241_1055286113300009174Corn RhizosphereRVAADRSLRARCVMRVQSGHWLDYDPVALVILVVGIGAVALLALSI*
Ga0126374_1029300933300009792Tropical Forest SoilMHDGMRAQSRHWLYYDPVALVVLIVGMGVVALLALNI*
Ga0126374_1088909213300009792Tropical Forest SoilPGRRVGWSFRARCVMSVQSRHWLDYDPVALVILVVGIGAVALLALSI*
Ga0126374_1183820623300009792Tropical Forest SoilMRDGMRAQRRHWLDCDPVALLVLILGIGAVAFPALSI*
Ga0126380_1166566413300010043Tropical Forest SoilMGVGVDAAFRARCVMSVQSRHWLDYDPVALLILVVGIGAVALLA
Ga0126384_1012880823300010046Tropical Forest SoilMDRTREDATFRARFVIGVQSSRWRDYDPVALVILVVGIGAVALLALSI*
Ga0126382_1096996623300010047Tropical Forest SoilWSFRARCVMSVQSRHWLDYDPVALVILVVGIGAVALLALSI*
Ga0126319_144564513300010147SoilHRPPSMGGFGTRVIADRSLRARCVMRVQSGHWLDYDPVALVILVVGIGAVALLALSI*
Ga0127503_1020476113300010154SoilPEAPSRVASAAGFFSGRGALMSVQSRHWLDYDPVALVVLLVGMSAVALLALSI*
Ga0127503_1053732013300010154SoilGFRARRVMSVQSRHWLDYDPVALVVLLVGMSAVALLALSI*
Ga0127503_1121380413300010154SoilRVRRKVDAAFRARCIMTAQTRHWLDYDPIALLVLVVGIGAVALLAVSI*
Ga0134062_1018526313300010337Grasslands SoilRVDATFRARCVMNVQSRHWLDYDPVALVILVVGIGAVALLALSI*
Ga0126370_1115290513300010358Tropical Forest SoilMDRARVDATFRARFVMSVQSRHWLDYDPVALVILVVGIGAVALLALSI*
Ga0126370_1254038223300010358Tropical Forest SoilVMRAQSSHWLDYDPVALVILVVGIGAVALLALSI*
Ga0126376_1000970173300010359Tropical Forest SoilMDGIRAQSRHWLDYDPVALVVLIVGIGVVALLALSI*
Ga0126372_1061210123300010360Tropical Forest SoilMHVGMRAQSRHWLDYDPVALVVLIVGIGVVALLALSI*
Ga0126372_1191710013300010360Tropical Forest SoilRVGWSFRARCVMSVQSRHWLDYDPVALVILVVGIGAVALLALSI*
Ga0126377_1154055723300010362Tropical Forest SoilCVMRVQSGHWLDYDPVALVILVVGIGAVALLALSI*
Ga0134124_1008940943300010397Terrestrial SoilMRVHGRGHWLDYDLVALAILVIGIGVVALLAISI*
Ga0126383_1310692223300010398Tropical Forest SoilMRDGMRAQSRHWLDYDPVALVVLIVGIGVVALLALSI*
Ga0126383_1353681513300010398Tropical Forest SoilIMSVQSRHWLEYDPVALVVLLVGMSAVAFLVLSI*
Ga0137363_1037149923300012202Vadose Zone SoilARRVMSVQSRHWLDYDPVALVVLLVGMSAVALLALSI*
Ga0137363_1064774413300012202Vadose Zone SoilRARRVMSVQSRHWLDYDPVALVVLLVGMSAVALLALSI*
Ga0137399_1073544513300012203Vadose Zone SoilWFGRVRYVMRVYSGHWLDYDPVALVILVVGIGAVALLALSI*
Ga0137374_1008762533300012204Vadose Zone SoilMAAASSFFQVRRVMRVQSGHWLDYDPLALVVLVLGIGAVAIIAFTI*
Ga0137374_1104468613300012204Vadose Zone SoilDAAFRARCVMSVQSRHWLDYDPVALVVLVVGMSAVALLALSI*
Ga0137362_1106570813300012205Vadose Zone SoilKVDAAFRARCIMTAQTRHWLDYDPIALLVLVVGIGAVALLAVSI*
Ga0137362_1169453113300012205Vadose Zone SoilTARRVMNVQSRHWLDYDPVALVVLVVGMSAVALLALSI*
Ga0150985_11153701513300012212Avena Fatua RhizosphereTRVTADRSLRARCVMRVQSGHWLDYDPVALVILVVGIGAVALLALSI*
Ga0150985_11380465813300012212Avena Fatua RhizosphereRARCVMRVQSGHWLDYDPVALVILVVGIGAVALLALSI*
Ga0137360_1121101713300012361Vadose Zone SoilARRVMNVQSRHWLDYDPVALVVLVVGMSAVALLALSI*
Ga0134043_120865023300012392Grasslands SoilLDMGPGRRVGWSFRARCVMSVQSRHWLDYDPVALVILVVGIGAVALLALSI*
Ga0150984_10919287613300012469Avena Fatua RhizosphereTRVAADRSLRARCVMRVQSGHWLDYDPVALVILVVGIGAVALLALSI*
Ga0157304_105465323300012882SoilMRVHGRGHWLDYDPIALAILVIGIGVVALLAISI*
Ga0157297_1035677713300012914SoilQVCCQVRRVMRVQSGQWLDYDPLALVVLVLGIGAVALIAFTI*
Ga0164307_1024039223300012987SoilVMSVQSRHWLDYDPVALVILVVGIGAVALLALSI*
Ga0157378_1251534623300013297Miscanthus RhizosphereMALVVAYRVRGVMRVHGRGHWLDYDPVALAILVIGIGVVALLA
Ga0137403_1027724023300015264Vadose Zone SoilWLVGRVRYVMRAYSGHWLDYDPVALVILVVGIGAVALLALSI*
Ga0132255_10380340113300015374Arabidopsis RhizosphereMALVVAYRVRGVMHVHGRGHWLDYDPVALAILVIGIGVVAL
Ga0182036_1150328713300016270SoilPPALDLWGPGRRVGWSFRARCVMSVQSRHWLDYDPVALVILVVGIGAVALLALSI
Ga0182033_1188224913300016319SoilKPPPALDLWGPGRRVGWSFRARCVMSVQSRHWLDYDPVALVILVVGIGAVALLALSI
Ga0182035_1189083713300016341SoilLWGPGRRVGWSFRARCVMSVQSRHWLDYDPVALVILVVGIGAVALLALSI
Ga0182040_1039907813300016387SoilLFSGWVMRIQRGHWLDYDPVALAVLVIGIGIVMLVALSI
Ga0182037_1029361723300016404SoilLFSGWVMRVQRGHWLDYDPVALAALVIGIGIVMLVALS
Ga0182037_1187933613300016404SoilRRVGWSFRARCVMSVQSRHWLDYDPVALVILVVGIGAVALLALSI
Ga0182038_1118464723300016445SoilGWSFRARCVMSVQSRHWLDYDPVALVILVVGIGAVALLALSI
Ga0134074_140101813300017657Grasslands SoilMSVQSRHVQTRHWLDYDPVALVILVVGIGAVALLALSI
Ga0184616_1014159313300018055Groundwater SedimentRGFGTRVAADRSLRARCVMRVQSGHWLDYDPVALVILVVGIGAVALLALSI
Ga0184612_1018466213300018078Groundwater SedimentAGSFYRVRCVMRVQSGHWLDYDPVALVVLVLGIGAVALLALSI
Ga0184625_1019249613300018081Groundwater SedimentVSQVRRVMRVQSGQWLDYDPLALVVLVLGIGAVAIIAFTI
Ga0180119_113210523300019228Groundwater SedimentGAFGTRVAADRSLRARCVMRVQSGHWLDYDPVALVILVVGIGAVALLALSI
Ga0184647_126209913300019263Groundwater SedimentFGTRVAADRSLRARCVMRVQSGHWLDYDPVALVILVVGIGAVALLALSI
Ga0173481_1059597423300019356SoilMALVVAYRVRGVMRVHGRGHWLDYDPVALAILVIGIGVVALLAISI
Ga0193730_104341313300020002SoilRCVMRVQSGHWLDYDPVALVILVVGIGAVALLALSI
Ga0210407_1045025113300020579SoilFRARCVMNVQSRHWLDYDPVALVILVVGIGAVALLALSI
Ga0210399_1139928213300020581SoilPSAARVREWTRVDATFRARCVMNVQSRHWLDYDPVALVILVVGIGAVALLALSI
Ga0213879_1009796323300021439Bulk SoilIFQARCVMRAYSEHWLDYDPVALVILVVGIGAVVLLALSI
Ga0126371_1026922733300021560Tropical Forest SoilMHDGMRAQSRHWLDYDPVALVVLIVGIGVVALLVLSI
Ga0126371_1086425313300021560Tropical Forest SoilRCVMSVQSRHWLDYDPVALVILVVGIGAVALLALSI
Ga0126371_1213160523300021560Tropical Forest SoilPGRRVGWSFRARCVMSVQSRHWLDYDPVALVILVVGIGAVALLALSI
Ga0126371_1248952623300021560Tropical Forest SoilLQGEDVMRVQSGHWLDYDPVALVILVVGIGAVALLALSI
Ga0126371_1330956923300021560Tropical Forest SoilRARCVMSVQSRHWLDYDPVALLILVVGIGAVALLALSI
Ga0242654_1005480113300022726SoilLDLWGPGRRVGWSFRARCVMSVQSRHWLDYDPVALVILVVGIGAVALLALSI
Ga0242654_1039067213300022726SoilQRVDIMRTNIRRWLEYDAVALTVLLIGIGVVALLVLSI
Ga0242654_1040956113300022726SoilAARDRDWTRGDETFRARCAKKVHRRHWIDYEPVALVILVVGIGAVALLALSI
Ga0207651_1128439313300025960Switchgrass RhizosphereLRARCVMRVQSGHWLDYDPVALVILVVGIGAVALLALSI
Ga0209350_103287813300026277Grasslands SoilLIETQTTHPPPIWEWTRVDAAFRARCVMSVQSRHVQTRHWLDYDPVALLILVVGIGAVALLALSI
Ga0209239_1001705123300026310Grasslands SoilMSVQSRHVQTRHWLDYDPVALLILVVGIGAVALLALSI
Ga0209131_135232513300026320Grasslands SoilLLRLRTDIRRNRRARRVMSVQTRHWLDYDPVALVVLLAGMSAVALLALSI
Ga0209474_1004350453300026550SoilMDRVKVMRVQSGHWLDYDPIALVVLILGIGAVALLALSI
Ga0209577_1068319713300026552SoilTFRARCVMNVQSRHWLDYDPVALVILVVGIGAVALLALSI
Ga0209466_101095133300027646Tropical Forest SoilMAQAVFRVRCVMRAQSSHWLDYDPVALVILVVGIGAVALLALSI
Ga0208989_1004145413300027738Forest SoilFVCRVRFVMRVHSGHWLDYDPIALVVLVIGIGAVALLALSI
Ga0209488_1066039023300027903Vadose Zone SoilCANSRVFLRARHVMSVQSRHWLDYDPVALVVLLVGMSAVALLALSI
Ga0209382_1050186813300027909Populus RhizosphereVSFYRVRCVMRVQSGHWLDYDPVALVVLVLGIGAVASNQHG
Ga0307288_1026722113300028778SoilSWEARRVMSLQSRHWLDYDPVALVVLLAGMSAVALLALSI
Ga0307282_1001570213300028784SoilARCVMRVQSGHWLDYDPVALVILVVGIGAVALLALSI
Ga0307299_1010927023300028793SoilEARRVMSLQSRHWLDYDPVALVVLLAGMSAVALLALSI
Ga0247827_1088939113300028889SoilDKSGRDPSLRARCVMRVQSGHWLDYDPVALVILVVGIGAVALLALSI
Ga0308203_101521113300030829SoilADRSLRARCVMRVQSGHWLDYDPVALVILVVGIGAVALLALSI
Ga0308202_101101113300030902SoilFWTRVTADRSLRARCVMRVQSGHWLDYDPVALVILVVGIGAVALLALSI
Ga0308202_103421933300030902SoilWEARRVMSLQSRHWLDYDPVALVVLLAGMSAVALLALSI
Ga0102770_1124790613300030981SoilAADRSLRARCVMRVQSGHWLDYDPVALVILVVGIGAVALLALSI
Ga0073996_1232828013300030998SoilRRSPAILDMGFGTRVAAYRSLRARCVMRVQSGHWLDYDPVALVILVVGIGAVALLALSI
Ga0308189_1046507813300031058SoilQPPYGAFGTRVAADRSLRARCVMRVQSGHWLDYDPVALVILVVGIGAVALLALSI
Ga0308201_1036031613300031091SoilPIRSLQGISVMRVHSTSTTHWLDYDPVAFVVLVLGIGAVSLLALSI
Ga0308199_107956323300031094SoilATLYGGFGTRVIADRSLRARCVMRVQSGHWLDYDPVALVILVVGIGAVALLALSI
Ga0308199_116432213300031094SoilSSWEARRVMSLQSRHWLDYDPVALVVLLAGMSAVALLTLSI
Ga0307501_1008757813300031152SoilAGTRVASSVYRVRFVMRVHSGHWLDYDPIALVVLVIGIGAVALLALSI
Ga0170824_11013191223300031231Forest SoilVDATFRARCVMNVQSRHWLDYDPVALVILVVGIGAVALLALSI
Ga0318534_1043199113300031544SoilMDRVKVMRVQSGHWLDYDPVALLVLIVGIGAVALLALSI
Ga0318541_1039537723300031545SoilGPGRRVGWSFRARCVMSVQSRHWLDYDPVALVILVVGIGAVALLALSI
Ga0318515_1022589323300031572SoilKVMRVQSGHWLDYDPVALLVLIVGIGAVALLALSI
Ga0318515_1072759123300031572SoilKPPPALDIDLWGPGRRVGWSFRARCVMSVQSRHWLDYDPVALVILVVGIGAVALLALSI
Ga0310915_1001868853300031573SoilWSFRARCVMSVQSRHWLDYDPVALVILVVGIGAVALLALSI
Ga0318555_1016862213300031640SoilALDMGPGRRVGWSFRARCVMSVQSRHWLDYDPVALVILVVGIGAVALLALSI
Ga0318560_1043821613300031682SoilHPPLMDRTRVDATFRARFVMSVQSRHWLDYDPVALVILVVGIGAVALLALSI
Ga0307469_1105578123300031720Hardwood Forest SoilRSLRARCVMRVQSGHWLDYDPVALVILVVGIGAVALLALSI
Ga0318501_1016581513300031736SoilEWDIMRVQGGHWLDYDPIALAALLFGIGTVLLVALNI
Ga0306918_1023831323300031744SoilDRTRVDATFRARFVMSVQSRHWLDYDPVALVILVVGIGAVALLALSI
Ga0318492_1059985923300031748SoilKCVMSVQSRHWLDYDPVALVILVVGIGAVALLALSI
Ga0318537_1000162813300031763SoilLGEAGVMRVLGGHWLDYDPIALVVLVVGIGIVTLLALSI
Ga0318535_1029113513300031764SoilCIMSVQSGHWLDYDPVALVVLLVGMSAVAFLVLSI
Ga0318509_1053563623300031768SoilSVAGFFSARCIMSVQSGHWLDYDPVALVVLLVGMSAVAFLVLSI
Ga0318521_1013583413300031770SoilGPGRRVDWSFRARCVMSVQSRHWLDYDPVALVILVVGIGAVALLALSI
Ga0318568_1005849033300031819SoilMDRTRVDATFRARFVMSVQSRHWLDYDPVALVILVVGIGAVALLALSI
Ga0307473_1031033423300031820Hardwood Forest SoilRVDATFRARCVMNVQSRHWLDYDPVALVILVVGIGAVALLALSI
Ga0318511_1020282013300031845SoilRKPPPALDVGPGRRVGWSFRAKCVMSVQSRHWLDYDPVALVILVVGIGAVALLALSI
Ga0318512_1007699413300031846SoilIDWDIMRVQGGHWLDYDPIALAALLFGIGTVLLVALNI
Ga0318544_1019891223300031880SoilSFRARCVMSVQSRHWLDYDPVALVILVVGIGAVALLALSI
Ga0318520_1049077223300031897SoilCVMSVQSRHWLDYDPVALVILVVGIGAVALLALSI
Ga0306921_1026080233300031912SoilLFSGWVMRIQRGHWLDYDPVALAVLVIGIGIVMLVAL
Ga0306921_1105615913300031912SoilDIMRVQGGHWLDYDPIALAALLFGIGTVLLVALNI
Ga0310910_1089918113300031946SoilKPPPALDIDLWGPGRRVGWSFRARCVMSVQSRHWLDYDPVAFVILVVGIGAVALLALSI
Ga0318530_1027167713300031959SoilPPAFDLWEPGRRVGWSFRARCVMSVQSRHWLDYDPVALVILVVGIGAVALLALSI
Ga0318531_1012200513300031981SoilGEAGVMRVLGGHWLDYDPIALVVLVVGIGIVTLLALSI
Ga0318510_1019985913300032064SoilCGVMRVLGGHWLDHDPIAFAALIVGIGLVMLVVLSF
Ga0318518_1047632013300032090SoilRRVGWSFRARCVMSVQSRHLLDYDPVALVILVVGIGAVALLALSI
Ga0307470_1102397613300032174Hardwood Forest SoilRVMNVQSRHWLDYDPVALVVLVGGMSAVALLALSI
Ga0307472_10265396013300032205Hardwood Forest SoilKQMPVQSGHWLDCDPWALVILILGIGGVAIIAFTI
Ga0318519_1006673013300033290SoilGRRVGWSFRARCVMSVQSRHWLDYDPVALVILVVGIGAVALLALSI
Ga0318519_1022761013300033290SoilDRVKVMRVQSGHWLDYDPVALLVLIVGIGAVALLALSI


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.