NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F028576

Metagenome / Metatranscriptome Family F028576

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F028576
Family Type Metagenome / Metatranscriptome
Number of Sequences 191
Average Sequence Length 49 residues
Representative Sequence NVAVQTNVNVDLRQIAERLIQKFDREPELKARIAQALLEVDDEQSA
Number of Associated Samples 161
Number of Associated Scaffolds 191

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 3.33 %
% of genes near scaffold ends (potentially truncated) 72.25 %
% of genes from short scaffolds (< 2000 bps) 71.73 %
Associated GOLD sequencing projects 149
AlphaFold2 3D model prediction Yes
3D model pTM-score0.49

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (77.487 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(16.754 % of family members)
Environment Ontology (ENVO) Unclassified
(24.607 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(51.309 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 40.54%    β-sheet: 0.00%    Coil/Unstructured: 59.46%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.49
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 191 Family Scaffolds
PF03237Terminase_6N 30.89
PF09588YqaJ 2.62
PF05127Helicase_RecD 1.57
PF07647SAM_2 0.52
PF04098Rad52_Rad22 0.52
PF08734GYD 0.52
PF04014MazE_antitoxin 0.52
PF04404ERF 0.52
PF03387Herpes_UL46 0.52
PF00005ABC_tran 0.52
PF06147DUF968 0.52
PF05565Sipho_Gp157 0.52

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 191 Family Scaffolds
COG1444tRNA(Met) C34 N-acetyltransferase TmcATranslation, ribosomal structure and biogenesis [J] 1.57
COG4274Uncharacterized conserved protein, contains GYD domainFunction unknown [S] 0.52


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms77.49 %
UnclassifiedrootN/A22.51 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000364|INPhiseqgaiiFebDRAFT_100588623All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae569Open in IMG/M
3300000655|AF_2010_repII_A100DRAFT_1027361All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae1061Open in IMG/M
3300000955|JGI1027J12803_103101960All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae545Open in IMG/M
3300001139|JGI10220J13317_10403675All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae539Open in IMG/M
3300001213|JGIcombinedJ13530_101068262All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae507Open in IMG/M
3300001991|JGI24743J22301_10001876All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium3043Open in IMG/M
3300002244|JGI24742J22300_10047055All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae776Open in IMG/M
3300003990|Ga0055455_10301107All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii513Open in IMG/M
3300004156|Ga0062589_100961679All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae793Open in IMG/M
3300004463|Ga0063356_100464097All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii1658Open in IMG/M
3300004463|Ga0063356_101718420All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii939Open in IMG/M
3300004479|Ga0062595_100198442All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii1238Open in IMG/M
3300004643|Ga0062591_101333762All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii707Open in IMG/M
3300004782|Ga0062382_10686350All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii506Open in IMG/M
3300005294|Ga0065705_11003403All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii546Open in IMG/M
3300005331|Ga0070670_100031095All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii4597Open in IMG/M
3300005332|Ga0066388_100576776All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii1751Open in IMG/M
3300005345|Ga0070692_10709095All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii678Open in IMG/M
3300005436|Ga0070713_100386637All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii1304Open in IMG/M
3300005437|Ga0070710_11450607All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii514Open in IMG/M
3300005456|Ga0070678_101443641All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii643Open in IMG/M
3300005518|Ga0070699_100998685All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii767Open in IMG/M
3300005564|Ga0070664_100180538All Organisms → cellular organisms → Bacteria → Proteobacteria1876Open in IMG/M
3300005575|Ga0066702_10713664All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii597Open in IMG/M
3300005587|Ga0066654_10848842All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii521Open in IMG/M
3300005618|Ga0068864_102221339All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii555Open in IMG/M
3300005713|Ga0066905_102152926All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii519Open in IMG/M
3300005718|Ga0068866_10656911All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii714Open in IMG/M
3300005764|Ga0066903_100716337All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii1768Open in IMG/M
3300005764|Ga0066903_102416878All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii1016Open in IMG/M
3300005764|Ga0066903_108694401All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii516Open in IMG/M
3300006028|Ga0070717_11687909All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii573Open in IMG/M
3300006046|Ga0066652_100941018All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii823Open in IMG/M
3300006178|Ga0075367_10780071All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii608Open in IMG/M
3300006642|Ga0075521_10055371All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii1741Open in IMG/M
3300006795|Ga0075520_1092147All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1386Open in IMG/M
3300006795|Ga0075520_1123094All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii1155Open in IMG/M
3300006795|Ga0075520_1179763All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria907Open in IMG/M
3300006871|Ga0075434_101119538All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii800Open in IMG/M
3300006949|Ga0075528_10061498All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii970Open in IMG/M
3300007822|Ga0104325_118220All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1487Open in IMG/M
3300009031|Ga0103682_10530804All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae609Open in IMG/M
3300009094|Ga0111539_11596641All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae756Open in IMG/M
3300009137|Ga0066709_101307963All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii1062Open in IMG/M
3300009148|Ga0105243_10762076All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae950Open in IMG/M
3300009553|Ga0105249_13167088All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae529Open in IMG/M
3300009792|Ga0126374_10070287All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae1869Open in IMG/M
3300010040|Ga0126308_10685049All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii704Open in IMG/M
3300010048|Ga0126373_11223805All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae817Open in IMG/M
3300010366|Ga0126379_11089403All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae905Open in IMG/M
3300010366|Ga0126379_13772482All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae508Open in IMG/M
3300010375|Ga0105239_10656793All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae1198Open in IMG/M
3300011270|Ga0137391_10148783All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium2039Open in IMG/M
3300012892|Ga0157294_10271341All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae531Open in IMG/M
3300012948|Ga0126375_10296876All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae1120Open in IMG/M
3300012971|Ga0126369_10734784All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae1066Open in IMG/M
3300012971|Ga0126369_11826688All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae696Open in IMG/M
3300012985|Ga0164308_12165066Not Available518Open in IMG/M
3300012987|Ga0164307_10338132All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae1088Open in IMG/M
3300012987|Ga0164307_10928679All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae702Open in IMG/M
3300013297|Ga0157378_11919653All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae641Open in IMG/M
3300013308|Ga0157375_11315052All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae850Open in IMG/M
3300014166|Ga0134079_10673055All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae524Open in IMG/M
3300015373|Ga0132257_104119754All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae529Open in IMG/M
3300015374|Ga0132255_102370344All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium810Open in IMG/M
3300016319|Ga0182033_11678099All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae575Open in IMG/M
3300016341|Ga0182035_10779344All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae838Open in IMG/M
3300016371|Ga0182034_10068456All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium2425Open in IMG/M
3300016371|Ga0182034_10294032All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1299Open in IMG/M
3300016371|Ga0182034_12090877All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae500Open in IMG/M
3300016387|Ga0182040_11667865All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii544Open in IMG/M
3300016387|Ga0182040_11802557All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae524Open in IMG/M
3300017933|Ga0187801_10407267All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae566Open in IMG/M
3300017943|Ga0187819_10847376All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae512Open in IMG/M
3300017955|Ga0187817_10516981All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae762Open in IMG/M
3300017955|Ga0187817_10539494All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae744Open in IMG/M
3300018001|Ga0187815_10254944All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae742Open in IMG/M
3300018017|Ga0187872_10418641All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii565Open in IMG/M
3300018468|Ga0066662_10421019All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii1183Open in IMG/M
3300018481|Ga0190271_10067642All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium3136Open in IMG/M
3300018482|Ga0066669_10591631All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae971Open in IMG/M
3300020579|Ga0210407_10354001All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae1149Open in IMG/M
3300020582|Ga0210395_10735717All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae737Open in IMG/M
3300021170|Ga0210400_10384959All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae1156Open in IMG/M
3300021171|Ga0210405_10040837All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii3690Open in IMG/M
3300021406|Ga0210386_10315234All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae1342Open in IMG/M
3300021420|Ga0210394_10154160All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii1997Open in IMG/M
3300021420|Ga0210394_10831444All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae806Open in IMG/M
3300021433|Ga0210391_10947589All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae671Open in IMG/M
3300021474|Ga0210390_11623275All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae508Open in IMG/M
3300021479|Ga0210410_11245014All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae636Open in IMG/M
3300021560|Ga0126371_11455597All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae814Open in IMG/M
3300021861|Ga0213853_11125264All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae879Open in IMG/M
3300022557|Ga0212123_10485987All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae805Open in IMG/M
3300022893|Ga0247787_1046163All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae636Open in IMG/M
3300023073|Ga0247744_1023355All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae909Open in IMG/M
3300025315|Ga0207697_10056955All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii1622Open in IMG/M
3300025650|Ga0209385_1057655All Organisms → cellular organisms → Bacteria → Proteobacteria1390Open in IMG/M
3300025679|Ga0207933_1008127All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales5301Open in IMG/M
3300025899|Ga0207642_10939020All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae555Open in IMG/M
3300025914|Ga0207671_10053864All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii2981Open in IMG/M
3300025934|Ga0207686_11148292All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae634Open in IMG/M
3300025935|Ga0207709_10713913All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae803Open in IMG/M
3300025938|Ga0207704_10790445All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae792Open in IMG/M
3300025941|Ga0207711_10011647All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii7306Open in IMG/M
3300026035|Ga0207703_10832007All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae882Open in IMG/M
3300026319|Ga0209647_1032553All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales3032Open in IMG/M
3300026852|Ga0207838_103409All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae958Open in IMG/M
3300026867|Ga0207475_1004881All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae790Open in IMG/M
3300026884|Ga0207455_1005315All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae640Open in IMG/M
3300026900|Ga0207444_1005327All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae898Open in IMG/M
3300026997|Ga0207784_1034287All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae518Open in IMG/M
3300027574|Ga0208982_1138584All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae500Open in IMG/M
3300027898|Ga0209067_10746272All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae569Open in IMG/M
3300028787|Ga0307323_10238516All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae656Open in IMG/M
3300029913|Ga0311362_11167539All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae578Open in IMG/M
3300029999|Ga0311339_10570269All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae1134Open in IMG/M
3300031057|Ga0170834_103720525All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae680Open in IMG/M
3300031236|Ga0302324_102572101All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae619Open in IMG/M
3300031446|Ga0170820_14134438All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae1110Open in IMG/M
3300031474|Ga0170818_104131264All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae1559Open in IMG/M
3300031474|Ga0170818_105291965All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae500Open in IMG/M
3300031545|Ga0318541_10270708All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae945Open in IMG/M
3300031572|Ga0318515_10659991All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae554Open in IMG/M
3300031668|Ga0318542_10422077All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii690Open in IMG/M
3300031682|Ga0318560_10487742All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae668Open in IMG/M
3300031719|Ga0306917_11404465All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae538Open in IMG/M
3300031723|Ga0318493_10674324All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae579Open in IMG/M
3300031744|Ga0306918_10613922All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii852Open in IMG/M
3300031768|Ga0318509_10598432All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae614Open in IMG/M
3300031879|Ga0306919_10820748All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae714Open in IMG/M
3300031890|Ga0306925_11207937All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae757Open in IMG/M
3300031910|Ga0306923_10833990Not Available1015Open in IMG/M
3300031912|Ga0306921_12267654All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae570Open in IMG/M
3300031942|Ga0310916_11018374All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae691Open in IMG/M
3300031946|Ga0310910_10033710All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium3504Open in IMG/M
3300031954|Ga0306926_10206873All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae2435Open in IMG/M
3300031954|Ga0306926_10272885All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii2095Open in IMG/M
3300031954|Ga0306926_12574287All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae556Open in IMG/M
3300031996|Ga0308176_10310956All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii1539Open in IMG/M
3300032001|Ga0306922_11058807All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae834Open in IMG/M
3300032055|Ga0318575_10301400All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae811Open in IMG/M
3300032063|Ga0318504_10577695All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae539Open in IMG/M
3300032075|Ga0310890_11487039All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae558Open in IMG/M
3300032076|Ga0306924_11133236All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae851Open in IMG/M
3300032076|Ga0306924_11299283All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii782Open in IMG/M
3300032261|Ga0306920_101499421All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae963Open in IMG/M
3300032261|Ga0306920_102494749All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae711Open in IMG/M
3300033433|Ga0326726_10589335All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii1068Open in IMG/M
3300034090|Ga0326723_0312506All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae706Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil16.75%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil14.66%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil4.19%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil4.19%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere4.19%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil4.71%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil4.71%
Arctic Peat SoilEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil3.66%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil3.14%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment2.62%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil2.62%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil2.09%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil2.09%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere2.09%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa1.57%
Peat SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil1.57%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere1.57%
Corn, Switchgrass And Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere1.57%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere1.57%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland1.05%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil1.05%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil1.05%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere1.05%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere1.05%
Arabidopsis Thaliana RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere1.05%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere1.05%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere1.05%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere1.05%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere1.05%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere1.05%
WatershedsEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Watersheds0.52%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil0.52%
BogEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog0.52%
Wetland SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Wetland Sediment0.52%
GroundwaterEnvironmental → Aquatic → Freshwater → Drinking Water → Chlorinated → Groundwater0.52%
Natural And Restored WetlandsEnvironmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands0.52%
WetlandEnvironmental → Aquatic → Marine → Wetlands → Sediment → Wetland0.52%
Iron-Sulfur Acid SpringEnvironmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring0.52%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds0.52%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil0.52%
Serpentine SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil0.52%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil0.52%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere0.52%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil0.52%
BogEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Bog0.52%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere0.52%
Populus EndosphereHost-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere0.52%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000364Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300000655Forest soil microbial communities from Amazon forest - 2010 replicate II A100EnvironmentalOpen in IMG/M
3300000955Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300000956Soil microbial communities from Great Prairies - Kansas, Native Prairie soilEnvironmentalOpen in IMG/M
3300001139Soil microbial communities from Great Prairies - Wisconsin, Switchgrass soilEnvironmentalOpen in IMG/M
3300001213Combined assembly of wetland microbial communities from Twitchell Island in the Sacramento Delta (Jan 2013 JGI Velvet Assembly)EnvironmentalOpen in IMG/M
3300001991Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2Host-AssociatedOpen in IMG/M
3300002244Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1Host-AssociatedOpen in IMG/M
3300003990Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Goodyear_PhragC_D2EnvironmentalOpen in IMG/M
3300004156Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1EnvironmentalOpen in IMG/M
3300004463Combined assembly of Arabidopsis thaliana microbial communitiesHost-AssociatedOpen in IMG/M
3300004479Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAsEnvironmentalOpen in IMG/M
3300004635Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3EnvironmentalOpen in IMG/M
3300004643Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3EnvironmentalOpen in IMG/M
3300004782Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare2FreshEnvironmentalOpen in IMG/M
3300005179Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133EnvironmentalOpen in IMG/M
3300005294Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk SoilEnvironmentalOpen in IMG/M
3300005331Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaGHost-AssociatedOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005345Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaGEnvironmentalOpen in IMG/M
3300005436Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaGEnvironmentalOpen in IMG/M
3300005437Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaGEnvironmentalOpen in IMG/M
3300005438Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaGEnvironmentalOpen in IMG/M
3300005456Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaGHost-AssociatedOpen in IMG/M
3300005518Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaGEnvironmentalOpen in IMG/M
3300005548Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaGHost-AssociatedOpen in IMG/M
3300005564Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaGHost-AssociatedOpen in IMG/M
3300005566Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_142EnvironmentalOpen in IMG/M
3300005575Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151EnvironmentalOpen in IMG/M
3300005587Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103EnvironmentalOpen in IMG/M
3300005618Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2Host-AssociatedOpen in IMG/M
3300005713Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2)EnvironmentalOpen in IMG/M
3300005718Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2Host-AssociatedOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300006028Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaGEnvironmentalOpen in IMG/M
3300006046Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101EnvironmentalOpen in IMG/M
3300006175Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaGEnvironmentalOpen in IMG/M
3300006178Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2Host-AssociatedOpen in IMG/M
3300006642Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostAB12-DEnvironmentalOpen in IMG/M
3300006795Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostAB12-BEnvironmentalOpen in IMG/M
3300006846Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4Host-AssociatedOpen in IMG/M
3300006871Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3Host-AssociatedOpen in IMG/M
3300006949Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE Permafrost159B-16BEnvironmentalOpen in IMG/M
3300007822Permafrost core soil microbial communities from Svalbard, Norway - sample 2-8-2 SoapdenovoEnvironmentalOpen in IMG/M
3300009031Microbial communities from groundwater in Rifle, Colorado, USA - 3D_0.1umEnvironmentalOpen in IMG/M
3300009094Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009137Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158EnvironmentalOpen in IMG/M
3300009148Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaGHost-AssociatedOpen in IMG/M
3300009176Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaGHost-AssociatedOpen in IMG/M
3300009553Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaGHost-AssociatedOpen in IMG/M
3300009792Tropical forest soil microbial communities from Panama - MetaG Plot_12EnvironmentalOpen in IMG/M
3300010040Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot55EnvironmentalOpen in IMG/M
3300010048Tropical forest soil microbial communities from Panama - MetaG Plot_11EnvironmentalOpen in IMG/M
3300010366Tropical forest soil microbial communities from Panama - MetaG Plot_24EnvironmentalOpen in IMG/M
3300010375Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaGHost-AssociatedOpen in IMG/M
3300011270Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaGEnvironmentalOpen in IMG/M
3300012892Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S209-509C-1EnvironmentalOpen in IMG/M
3300012948Tropical forest soil microbial communities from Panama - MetaG Plot_14EnvironmentalOpen in IMG/M
3300012971Tropical forest soil microbial communities from Panama - MetaG Plot_1EnvironmentalOpen in IMG/M
3300012984Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MGEnvironmentalOpen in IMG/M
3300012985Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MGEnvironmentalOpen in IMG/M
3300012987Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MGEnvironmentalOpen in IMG/M
3300013297Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaGHost-AssociatedOpen in IMG/M
3300013308Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaGHost-AssociatedOpen in IMG/M
3300014165Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_30_metaGEnvironmentalOpen in IMG/M
3300014166Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09182015EnvironmentalOpen in IMG/M
3300015373Combined assembly of cpr5 rhizosphereHost-AssociatedOpen in IMG/M
3300015374Col-0 rhizosphere combined assemblyHost-AssociatedOpen in IMG/M
3300016294Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178EnvironmentalOpen in IMG/M
3300016319Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00HEnvironmentalOpen in IMG/M
3300016341Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170EnvironmentalOpen in IMG/M
3300016357Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000EnvironmentalOpen in IMG/M
3300016371Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172EnvironmentalOpen in IMG/M
3300016387Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176EnvironmentalOpen in IMG/M
3300017933Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_1EnvironmentalOpen in IMG/M
3300017943Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4EnvironmentalOpen in IMG/M
3300017955Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2EnvironmentalOpen in IMG/M
3300018001Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_5EnvironmentalOpen in IMG/M
3300018017Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_40EnvironmentalOpen in IMG/M
3300018037Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_10EnvironmentalOpen in IMG/M
3300018468Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111EnvironmentalOpen in IMG/M
3300018469Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 TEnvironmentalOpen in IMG/M
3300018481Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 356 TEnvironmentalOpen in IMG/M
3300018482Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118EnvironmentalOpen in IMG/M
3300020579Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-MEnvironmentalOpen in IMG/M
3300020582Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-OEnvironmentalOpen in IMG/M
3300021170Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-MEnvironmentalOpen in IMG/M
3300021171Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-MEnvironmentalOpen in IMG/M
3300021406Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-OEnvironmentalOpen in IMG/M
3300021407Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-OEnvironmentalOpen in IMG/M
3300021420Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-MEnvironmentalOpen in IMG/M
3300021433Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-OEnvironmentalOpen in IMG/M
3300021474Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-OEnvironmentalOpen in IMG/M
3300021479Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-MEnvironmentalOpen in IMG/M
3300021560Tropical forest soil microbial communities from Panama - MetaG Plot_4EnvironmentalOpen in IMG/M
3300021861Metatranscriptome of freshwater sediment microbial communities from post-fracked creek in Pennsylvania, United States - ABR_2016 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300022557Paint Pots_combined assemblyEnvironmentalOpen in IMG/M
3300022893Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S126-311R-4EnvironmentalOpen in IMG/M
3300023073Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S154-409C-5EnvironmentalOpen in IMG/M
3300025315Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes)Host-AssociatedOpen in IMG/M
3300025650Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostAB12-B (SPAdes)EnvironmentalOpen in IMG/M
3300025679Arctic peat soil from Barrow, Alaska - NGEE Surface sample F53-3 deep-092012 (SPAdes)EnvironmentalOpen in IMG/M
3300025899Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025914Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025934Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025935Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025938Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025941Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026035Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026067Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026319Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_60cm (SPAdes)EnvironmentalOpen in IMG/M
3300026852Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 62 (SPAdes)EnvironmentalOpen in IMG/M
3300026867Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G09A5-12 (SPAdes)EnvironmentalOpen in IMG/M
3300026884Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G05K5-12 (SPAdes)EnvironmentalOpen in IMG/M
3300026900Soil microbial communities from Kellog Biological Station, Michigan, USA - Nitrogen cycling UWRJ-G01K4-12 (SPAdes)EnvironmentalOpen in IMG/M
3300026997Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 66 (SPAdes)EnvironmentalOpen in IMG/M
3300027574Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM1_O3 (SPAdes)EnvironmentalOpen in IMG/M
3300027898Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 (SPAdes)EnvironmentalOpen in IMG/M
3300028787Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_381EnvironmentalOpen in IMG/M
3300029913III_Bog_N3 coassemblyEnvironmentalOpen in IMG/M
3300029999I_Palsa_E3 coassemblyEnvironmentalOpen in IMG/M
3300030503III_Palsa_E3 coassemblyEnvironmentalOpen in IMG/M
3300031057Oak Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031236Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1EnvironmentalOpen in IMG/M
3300031446Fir Summer Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031474Fir Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031545Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26EnvironmentalOpen in IMG/M
3300031546Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23EnvironmentalOpen in IMG/M
3300031572Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19EnvironmentalOpen in IMG/M
3300031668Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f23EnvironmentalOpen in IMG/M
3300031682Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f22EnvironmentalOpen in IMG/M
3300031718Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05EnvironmentalOpen in IMG/M
3300031719Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2)EnvironmentalOpen in IMG/M
3300031723Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f23EnvironmentalOpen in IMG/M
3300031744Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2)EnvironmentalOpen in IMG/M
3300031768Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f22EnvironmentalOpen in IMG/M
3300031793Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f21EnvironmentalOpen in IMG/M
3300031823Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05EnvironmentalOpen in IMG/M
3300031879Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2)EnvironmentalOpen in IMG/M
3300031880Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f25EnvironmentalOpen in IMG/M
3300031890Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2)EnvironmentalOpen in IMG/M
3300031897Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16EnvironmentalOpen in IMG/M
3300031910Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2)EnvironmentalOpen in IMG/M
3300031912Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2)EnvironmentalOpen in IMG/M
3300031941Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080EnvironmentalOpen in IMG/M
3300031942Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176EnvironmentalOpen in IMG/M
3300031945Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082EnvironmentalOpen in IMG/M
3300031946Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172EnvironmentalOpen in IMG/M
3300031954Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2)EnvironmentalOpen in IMG/M
3300031996Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R2EnvironmentalOpen in IMG/M
3300032001Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2)EnvironmentalOpen in IMG/M
3300032035Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF170EnvironmentalOpen in IMG/M
3300032055Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f23EnvironmentalOpen in IMG/M
3300032063Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f17EnvironmentalOpen in IMG/M
3300032075Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D3EnvironmentalOpen in IMG/M
3300032076Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2)EnvironmentalOpen in IMG/M
3300032090Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f22EnvironmentalOpen in IMG/M
3300032091Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f25EnvironmentalOpen in IMG/M
3300032261Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2)EnvironmentalOpen in IMG/M
3300033433Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MNEnvironmentalOpen in IMG/M
3300034090Peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF00NEnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
INPhiseqgaiiFebDRAFT_10058862323300000364SoilVAVQTNINFDLTQIAERVIKKFDHEPELKARIAQALLEIDNERTT*
AF_2010_repII_A100DRAFT_102736133300000655Forest SoilQTNVNLDLTQIVERVIKRFDHEPELKARIAQALLEVDHEQSE*
JGI1027J12803_10310196023300000955SoilNLDLMQIAERVLKRFDQEPQLKARIAQALLEVSDEQSE*
JGI10216J12902_10877448313300000956SoilLDSLSRLAGFDRQGAQISVAVQTNVNVDLRQISERVIQQFDREPELKARIARALLEVDDEQAA*
JGI10220J13317_1040367513300001139SoilVQTNVNVGATEIAERLIQKFDHQPQLKAQIAQALLEEDHECTS*
JGIcombinedJ13530_10106826213300001213WetlandINLAQVAERLIKHFDHEPELKARIAQALVEIDDDPST*
JGI24743J22301_1000187653300001991Corn, Switchgrass And Miscanthus RhizosphereLQPAGTQVNVAVQTNVNVGATEIAERLIQKFDHQPQLKAQIAQALLEEDHECTS*
JGI24742J22300_1004705523300002244Corn, Switchgrass And Miscanthus RhizosphereGTQVNVAVQTNVNVGATEIAERLIQKFDHQPQLKAQIAQALLEEDHECTS*
Ga0055455_1030110723300003990Natural And Restored WetlandsVNVAVQTNVNVVAEQFAERLIQKFDHEPQLKAQIAQALLEVDNEHP
Ga0062589_10096167913300004156SoilVNVGAKQIAERLIQEFDHEPELKARLAQALLEVDDGYSS*
Ga0063356_10046409713300004463Arabidopsis Thaliana RhizosphereVAVQTNVNVGVNQITERLIRAFDHEPELKARIAQTLLEVNHEQPIS*
Ga0063356_10171842023300004463Arabidopsis Thaliana RhizosphereHLQPASTQVNVAVQTNVNVDARHIAERLIQQFDHEPDLKARIAQALLEVDHEHSS*
Ga0062595_10019844233300004479SoilPAGTQVNVAVQTNVNVGAAQIAERLIQKFDHQPEIRTQIAQALLEDSDA*
Ga0062388_10213274223300004635Bog Forest SoilTLDSLSRLAGFDRQGTQVNVAVQTNVNVDLRLIAERIIQKFDGEPELKARIAQALLEVDDERAA*
Ga0062591_10133376213300004643SoilTNVNVGAKQIAERLIQEFDHEPELKARIAQALLEVDDGYSS*
Ga0062382_1068635013300004782Wetland SedimentVQNNVNVDVSVLADRLIQAFDHEPELKGRIAQALLEIDRQ*
Ga0066684_1024414733300005179SoilLNSVRQTLDSLSRLAGFERQGTQVNVAIQTHVNLDVNRIAERVILKFDREPELKARIAQALLEVDHEQAA*
Ga0065705_1100340323300005294Switchgrass RhizosphereAGTQVNVAVQTNVNVGAKQIAERLIQEFDHEPELKARIAQALLEVDDGYSS*
Ga0070670_10003109563300005331Switchgrass RhizosphereQPAGTQVNVAVQTNVNVGATEIAERLIQKFDHQPQLKAQIAQALLEEDHEPTS*
Ga0066388_10057677633300005332Tropical Forest SoilAGYDRPIGSQVNVAVQTNVNFNLLKLAERLSKRFDHEPELKERIAQALLEIDDEQPA*
Ga0070692_1070909523300005345Corn, Switchgrass And Miscanthus RhizosphereQGSQVNVAVQTNINFDLTQIAERVINKFDHEPELKARIARALLEIDNEQST*
Ga0070713_10038663713300005436Corn, Switchgrass And Miscanthus RhizosphereQTNLKLEATQIAERLIAEFDHEPEMKARIAQALLEVDHEQAA*
Ga0070710_1145060723300005437Corn, Switchgrass And Miscanthus RhizosphereQVNVAVQTNVNVDLRQIAERVIQRFDREPELKARIAQALLEVDDEQAA*
Ga0070701_1028133423300005438Corn, Switchgrass And Miscanthus RhizosphereLSRLSGFDRQGSQVNVAVQTNINFDLTQIAERVINKFDHEPELKARIARALLEIDNEQST
Ga0070678_10144364113300005456Miscanthus RhizosphereNVAVQTNVNLNLTQIAERVIGKFDREPELKARIAQALLEIDNERTT*
Ga0070699_10099868523300005518Corn, Switchgrass And Miscanthus RhizosphereVQTNVNLDLTQIAERLIRQFDDEPELKARIAQALLGVDDEQSA*
Ga0070665_10237313423300005548Switchgrass RhizosphereHTLDSLSRLSGFDRQGTQVNVAVQTNVNLNLVRITAKLVGAFDREPEVKARIAQALLELDNEQN*
Ga0070664_10018053853300005564Corn RhizosphereVNVALQANVNVGAVQIAERLIEAFDHQPELKAQIARVLLEDSHEYPS*
Ga0066693_1015253513300005566SoilSIRQTLDSLSRLAGFERQGTQVNVAVQNTLKLDLSQIAERLILQFDREPELKARIAQALLEVDREQAA*
Ga0066702_1071366413300005575SoilNVAVQTNVNVDLRQIAERLIQKFDREPELKARIAQALLEVDDEQSA*
Ga0066654_1084884213300005587SoilVSVDLRQIAERVILQFDREPELKARIAQALLEVDDEQAA*
Ga0068864_10222133923300005618Switchgrass RhizosphereLNLTQIAERVISKFDHEPELKARIARALLEIDDEQSA*
Ga0066905_10215292623300005713Tropical Forest SoilSNLAERLSKKFDHEPELKGRIARALLEVDDEQPA*
Ga0068866_1065691123300005718Miscanthus RhizosphereVNVAVQTNVNLGLTSIVERVIQKFDDEPELKARIACALLEIDNEQSA*
Ga0066903_10071633713300005764Tropical Forest SoilTNVNVGAAEIAERLIQKFDHQPQLKAQIAQALLEVDHEHSS*
Ga0066903_10241687813300005764Tropical Forest SoilVQTNVNLDIRQIAERLLVKFDREPELKGRIAQALMEVDHEQAA*
Ga0066903_10747938623300005764Tropical Forest SoilAGFDHQGTQVNVAVQTNVGVEIRAIAQRLIREFDHEPELKARIARTLMEVDNEPVA*
Ga0066903_10869440123300005764Tropical Forest SoilAAEIAERLIQKFDHQPQLKAQIAQALLEVDHEHSS*
Ga0070717_1143720913300006028Corn, Switchgrass And Miscanthus RhizosphereTLDSLSRLSGFDRQGTQINVAVQTNLKLEATQIAERLIAEFDHEPEMKARIAQALLEVDHEQAA*
Ga0070717_1168790913300006028Corn, Switchgrass And Miscanthus RhizosphereQVNVAVQTNVNVGAMQIAERLIQEFDHEPELKARIARALLEEDHEHTP*
Ga0066652_10094101813300006046SoilNQIAERVILKFDREPELKARIAQALLEVDHEQAA*
Ga0070712_10079308723300006175Corn, Switchgrass And Miscanthus RhizosphereLAGFDRQGTQINVAVQTNVNVEVRAVAQRLIREFDGEPELKARIARTLLEVGDEHDA*
Ga0075367_1078007123300006178Populus EndosphereVGATEIAERLIQKFDHQPQLKAQIAQALLEEDHECTS*
Ga0075521_1005537133300006642Arctic Peat SoilTNVNVDLKKITERLIKHFDHEPELKARIAQALVEIDNEPST*
Ga0075520_109214713300006795Arctic Peat SoilAGHTAGAQVNVAVQTNINVDLTQITERLIKHFDHEPELKARIAQALVEIDDEQCA*
Ga0075520_112309433300006795Arctic Peat SoilNVNMNVAQIADRLIKHFDHEPELKARIAQALAEIDNEPSA*
Ga0075520_117976313300006795Arctic Peat SoilNVAVQTNVNVDLTQIAERLIKHFDHEPELKARIAQALVEIDNEPST*
Ga0075430_10143501023300006846Populus RhizosphereLTRLAGYDRPAGAQVNVAVQTSVNLDLSSLAERLTKNFDHEPELKGRIAQALLEIDDEQSA*
Ga0075434_10111953813300006871Populus RhizosphereVAVQTNVNVDVSQIVERLIRHFDNDPQTKACIAQALVEMDNEPSA*
Ga0075528_1006149823300006949Arctic Peat SoilVQTNVNVDLTQIVERLIKHFDHEPELKARIAQALVEIDNEPST*
Ga0104325_11822013300007822SoilLAGHTAGAQVNVALQTNVNVDLTRIVERLIKHFDHEPELKARIAQALVEIDNEPSP*
Ga0103682_1053080413300009031GroundwaterDRAGNAQVNVAVQTNVSFDIGRIADRLIKYFDREPDLKARIAQALVEIDDEQAA*
Ga0111539_1159664113300009094Populus RhizosphereLQANVNVGAVQIAERLIEAFDHQPELKAQIARVLLEDSHEYPS*
Ga0066709_10130796313300009137Grasslands SoilLRQNAERVIVKFDHEPEIKARIAQALLEVDDEQAA*
Ga0105243_1076207613300009148Miscanthus RhizosphereQVNVAVQTNINFDLTQIAERVINKFDHEPELKARIARALLEIDNEQST*
Ga0105242_1134333113300009176Miscanthus RhizosphereRLAGFDRQGTQVNVAVETNVNFNLTQIAERLITKFDHEPELKARIAQALLEIDNEQSA*
Ga0105249_1316708823300009553Switchgrass RhizosphereVAIQNNLTLDLAGLAQRLIQHFDHEPELKGRIAQALLEVDDEPAA*
Ga0126374_1007028723300009792Tropical Forest SoilAVQTNVNVGAAEIAEQLIRKFDHEPELKARIAQALVEVDNDQCST*
Ga0126308_1068504913300010040Serpentine SoilGFERQGTQVNVAVQTNLNLDVRQVAERLILQFDREPELKARIAQALLEVDHEQAA*
Ga0126373_1122380513300010048Tropical Forest SoilVAVQTNVNLDLTQIAERVIKRFDHEPALKARIAQALLEVDHEQSA*
Ga0126379_1108940323300010366Tropical Forest SoilHLQAAGTQVNVAVQTNVNVGAAQIAERLIEKFDHEPELKARIAQALVEVDHEHTS*
Ga0126379_1377248213300010366Tropical Forest SoilTNVNVDVGQIVERLITQFDNDPQTKARIAQALVEIDNEPSA*
Ga0105239_1065679323300010375Corn RhizosphereQTNVNVGAVQIAERLIKAFDHQPEIKAQIAQALLEECHETET*
Ga0137391_1014878343300011270Vadose Zone SoilVQTNVNVGAVQIAERLIQKFDDQPEFKAQIAQALLEDSYE*
Ga0157294_1027134113300012892SoilLSGFDRQGSQVNVAVQTNINFNLAQIVERVINKFDHEPELKARIAQALLEIDNEQSA*
Ga0126375_1029687613300012948Tropical Forest SoilAGTQVNVAVQTNVSVGAAEIAERLIQKFDHQPQLKAQIAQALLEVDHEHSS*
Ga0126369_1073478423300012971Tropical Forest SoilADVNVAVQANVKVDLSGIVERVIGRFDHEPEIKARIAQALLEVDHEPTA*
Ga0126369_1182668823300012971Tropical Forest SoilGTQVNVAVQTNVNVGAAEIAERLIPQFDHEPELKARIAQALVEVDHEHTS*
Ga0164309_1049730423300012984SoilSRLSGFDRQGTQVNVAVQTNVNLNLTQIAERVINRFDREPELKARIAQALLEIDNERTT*
Ga0164308_1216506623300012985SoilAVQNNVNVGATQIAGWLIQKFDGEPELKARIAQALLEVDHEHSS*
Ga0164307_1033813223300012987SoilVNVAVQNNVNVGATQIAGWLIQKFDGEPELKARIAQALLEVDHEHSS*
Ga0164307_1092867923300012987SoilTQIAERLINKFDHEPKLKAQIAQALLETDNEQSA*
Ga0157378_1191965313300013297Miscanthus RhizosphereGFDRQGSQVNVAVQTNVNVDLTLIAERLINKFDHEPELKARIAQALLEIDNERTT*
Ga0157375_1131505213300013308Miscanthus RhizosphereNVNLNLTQIAERVIGKFDREPELKARIAQALLEIDNERTT*
Ga0181523_1001887313300014165BogRHALDSQSRLAGYDRPAGPQVNVAVQTNVQLDLTQIAERVIKHFDHEPELKARIAQALLEIDNDQAA*
Ga0134079_1067305513300014166Grasslands SoilNVAVQNNINLDHTVIVERLIQAFDHEPELKGRIAQALLRLDQEAAHE*
Ga0132257_10411975423300015373Arabidopsis RhizosphereLKRVSSCGDNSINVAVQTNVNVDLAKIAERVINKFDQEPELKARIAQALLEIDNERTA*
Ga0132255_10237034423300015374Arabidopsis RhizosphereVNVAVQTNVNVGAVQIAERLIQAFDHEPELKARIAQALLEDHYEH*
Ga0182041_1007397013300016294SoilIRHTLDSLSRLSGIDRQGTQVNVAVQTNVSLDIRQIAERLILKFDREPELKGRIAQALLEVDHEQTA
Ga0182041_1113124523300016294SoilNAMRQTRASLSRLSGFDRQGTQVNVAVQTNVIVEVRAIAQRLIKEFDHEPELKARIARALLETDNERAS
Ga0182033_1167809913300016319SoilPAATQVNVAVQTNFNITATQIANRVIEKFDKEPELKARIAQALLEVDNDQCST
Ga0182035_1077934413300016341SoilRPIGSQVNVAVQTNVNFDLTQIAERVLKRFDHEPELKARIAQALLEVNGEQSE
Ga0182032_1188109713300016357SoilAIRHTLDSLSRLSGFDRQGTQINVAMQTNVNVEVRAIAQRLIQAFDREPELKARIAHVLLEQDNDHRA
Ga0182034_1006845633300016371SoilRQGTQVNVAVQTNVIVEVRAIAQRLIKEFDHEPELKARIARALLETDNERAS
Ga0182034_1029403213300016371SoilAVQTNVNVELTAIAERIIQKFDHEPELKARIAQALVEVDNEQAA
Ga0182034_1209087723300016371SoilAGHDRPQVNVAVQTNVNIDLSGIAERLIKAFDHQPDVKAQIAQSLMEMDNEPSP
Ga0182040_1166786513300016387SoilVNVAVQTNVNVDVGQIVERLITQFDNDPQTKARIAQALVEIDNEPSA
Ga0182040_1180255723300016387SoilSGFDRQGTQVNVAVQTNVRLDIRQIAERLIVKFDREPDLKGRIAQALLEVDHEPTA
Ga0187801_1040726723300017933Freshwater SedimentVSVDLSRIVERVLGCFDQEPEIKARIAQALLEIDHEPTA
Ga0187819_1084737623300017943Freshwater SedimentAGYDRPAGAQVNVAVQTNVQVDLARIAERVIKHFDHEPDIKARIAQALLGVANEQPA
Ga0187817_1051698113300017955Freshwater SedimentVQANVSVDLSRIVERVLGCFDQEPEIKARIAQALLEIDHEPTA
Ga0187817_1053949413300017955Freshwater SedimentVNVAVQTNVNVDVGQIAELLIKHFDHEPDLKARIAQALVEMDDAQSP
Ga0187815_1025494423300018001Freshwater SedimentGTAQVNVAVQTNVNVDLNRIAERLIMQFDREPEFKARIAQALLQMDNDQSADRASSNGDG
Ga0187872_1041864113300018017PeatlandPAGAQVNVAVQTNVQLDLTQIAERVIKRFDHEPELKARIAQALLEIDDEQSA
Ga0187883_1077160423300018037PeatlandRHTLDSLSRLAGFDRQGAQVNVAVQTNVHVDVAHLAKRLIEQFDHEPEVRARIAQALLGDDHDRGA
Ga0066662_1042101913300018468Grasslands SoilTQVNVAVQTNVNLDLKQIAARVIEKFDREPEMKARIAQALLEVDDDSIA
Ga0190270_1101814713300018469SoilLSRLSGFDRQGSQVNVAVQTNINLNLTQIAERVINKFDHEPELKARIARALLEIDDEQSA
Ga0190271_1006764213300018481SoilGFDRQGSQVNVAVQTNINLNLTQIAERVINKFDHEPELKARIARALLEIDNEQSA
Ga0066669_1059163113300018482Grasslands SoilDLRQMAERVINQFDNEPELKARIARALLEVDDEQA
Ga0210407_1035400123300020579SoilVAVQNNVQVDVTEIAERVIQKFDHEPELKARIAQALLEVDNEQAT
Ga0210395_1073571713300020582SoilSTSISHIAERVIQRFDHEPELKARIAQALMEVDDEHSA
Ga0210400_1038495913300021170SoilNNVNIDVSNLVERLIAKFDREPELKGRIAEALMEVDHDLAA
Ga0210405_1004083743300021171SoilVQTNVNIQLTGLVERIIKHFDHEPELKARIAQALLEIDNERAA
Ga0210386_1031523423300021406SoilVQANVNVDVSQIVERLIAHFDHEPETKARIAQALVEIDLEQSP
Ga0210386_1091615023300021406SoilSMSRLAGFDRQGTQVNVAVQTNVRLDLAQIAERVIQKFDHEPELKARIAQALLEVDNEQA
Ga0210383_1031594023300021407SoilDSLSRLSGFDRQGTHINVAVQTNINVEIRAIAQRLIQAFDREPELKARIAHILEQDNDDL
Ga0210394_1015416013300021420SoilDRQGTQVNVAVQTNVNFDLRQIAERVIRQFDHEPEMKARIAQALMEVDDEQAA
Ga0210394_1083144423300021420SoilAGFDRQGTQVNVAVQTNVNFDLRQIAERVIRQFDHEPKLKARIAQALLEVDDEQAA
Ga0210391_1094758913300021433SoilNFDLRQIAERVIRQFDHEPEMKARIAQALMEVDDEQAA
Ga0210390_1162327523300021474SoilDHQGTQVNVAVQTNVNVEFTAFAERIIQKFDHEPDLKARIAQALLEVDNEQAA
Ga0210410_1073854123300021479SoilLDSLTRLAGFDRQGAQVNVAVQTNVNLDLRQIAERLIKKFDREPELKARIAQALLEVDNEHAA
Ga0210410_1124501423300021479SoilQVNVAVQTNVNIQLTGLVERIIKHFDHEPELKARIAQALLEVDNERAA
Ga0126371_1145559723300021560Tropical Forest SoilMMWADVDVAVQANVKVDLSGIVERVIGRFDHEPEIKARIAQALLEVDHEPTA
Ga0213853_1112526413300021861WatershedsVQTNVNVDLRQIAERLILKFDREPELKARIAQALLEVDNERAS
Ga0212123_1048598723300022557Iron-Sulfur Acid SpringNVAVQTNVQFDLALIAERVIQKFDGEPEMKARIAQALLEVDDEQAA
Ga0247787_104616313300022893SoilVGATEIAERLIQKFDHQPQLKAQIAQALLEEDHEPTS
Ga0247744_102335513300023073SoilVAVQTNVNVGATEIAERLIQKFDHQPQLKAQIAQALLEEDHECTS
Ga0207697_1005695513300025315Corn, Switchgrass And Miscanthus RhizosphereVGATEIAERLIQKFDHQPQLKAQIAQALLEEDHECTS
Ga0209385_105765523300025650Arctic Peat SoilVQTNVNVGLTQITERLIKHFDHEPELKARIAQALVEIDDEQSA
Ga0207933_100812753300025679Arctic Peat SoilVQTNVNVGVSLIANRLIKHFDHEPDLKARIAQALAEIDDEKSA
Ga0207642_1093902013300025899Miscanthus RhizosphereTQVNVAVQTNVNLGLTSIVERVIQKFDDEPELKARIACALLEIDNEQSA
Ga0207671_1005386453300025914Corn RhizosphereTNVNVGATEIAERLIQKFDHQPQLKAQIAQALLEEDHECTS
Ga0207686_1114829213300025934Miscanthus RhizosphereVQTNVNLNLTQIAERVIGKFDREPELKARIAQALLEIDNEQSA
Ga0207709_1071391313300025935Miscanthus RhizosphereQVNVAVQTNINFDLTQIAERVINKFDHEPELKARIARALLEIDNEQST
Ga0207704_1079044523300025938Miscanthus RhizosphereVQTNINVDLTKIAERLINKFDQEPELKARIAQALLEIDNEQSA
Ga0207711_1001164783300025941Switchgrass RhizosphereNVGATEIAERLIQKFDHQPQLKAQIAQALLEEDHECTS
Ga0207703_1083200713300026035Switchgrass RhizosphereVAVQTNVNVGATEIAERLIQKFDHQPQLKAQIAQALLEEDHEPTS
Ga0207678_1031246533300026067Corn RhizosphereLNSIRQTLDSLSRLSGFDRQGTQVNVAVQTNINIDLMKIAERVINKFDQEPELKARIARALLEIDNEQST
Ga0209647_103255313300026319Grasslands SoilVNVAVHTNVNVGAVQIAERLIQKFDDQPEFKAQIAQALLEDSYE
Ga0207838_10340933300026852Tropical Forest SoilLDQTRIAERLIQHFDHEPELKARIAQALMELDDEQSS
Ga0207475_100488113300026867SoilPAGTQVNVAVQTNVNVGATEIAERLIQKFDHQPQLKAQIAQALLEEDHECTS
Ga0207455_100531513300026884SoilQPAGTQVNVAVQTNVNVGATEIAERLIQKFDHQPQLKAQIAQALLEEDHECTS
Ga0207444_100532713300026900SoilAVQTNVNVGATEIAERLIQKFDHQPQLKAQIAQALLEEDHECTS
Ga0207784_103428723300026997Tropical Forest SoilPSTQVNVAVQTNVNLDQTRIAERLIQHFDHEPELKARIAQALMELDDEQSS
Ga0208982_113858413300027574Forest SoilAVQTNVHVDLAQITECLIQKFDHEPELKARIAQALLEVDDEQAA
Ga0209067_1074627213300027898WatershedsVNFDLRQIAERVIRQFDHEPKLKARIAQALLEVDDEQAA
Ga0307323_1023851613300028787SoilFDLSSLAERLIKKFDNEPELKARIAQALLEIDDEQQAA
Ga0311362_1116753913300029913BogDLDRIAQRLVMKFDHEPELKARIAQALLEIDDDEQPA
Ga0311339_1057026913300029999PalsaFDRQGTQVNVAVQTNVNVDVAHIAKRLLEQFDHEPELKARIAQALLGDDHEPGA
Ga0311370_1096770123300030503PalsaSQSRLAGFDRQGTQVNVAVQTNVNVDVAHIAKRLLEQFDHEPELKARIAQALLGDDHEPG
Ga0170834_10372052513300031057Forest SoilVQTNINVGAIQIAERLIQKFDREPELKAQIAQALVEVDDEQGP
Ga0302324_10257210113300031236PalsaAGFDRQGTQVNVAVQTNVNVDVAHIAKRLLEQFDHEPELKARIAQALLGDDHEPGA
Ga0170820_1413443823300031446Forest SoilAAQIAERLIQEFDHQPEIKAQIAHALLEVDHEHTS
Ga0170818_10413126423300031474Forest SoilVQTNVNVGAAQIAERLILKFDHQPEIKAQIAHALLEVDHEHSS
Ga0170818_10529196513300031474Forest SoilINVGAVQIAERLIQKFDHQPEIKAQIAQALLEVDDEHHS
Ga0318541_1027070823300031545SoilGSQVNVAVQTNVNLDLSNLAERLSKKFDHEPELKGRIAQALLEVDDEQPA
Ga0318538_1083769323300031546SoilQRRKSRLSGFDRQGTQVNVAVQTNVTVGVRAVAERLIREFDHEPELKARIARTLMELDNEHVA
Ga0318515_1065999123300031572SoilAVQTDVNVELTAIAERIIQKFDHEPELKARIAQALVEVDNEQAA
Ga0318542_1042207713300031668SoilPIGAQVNVAVQTNVNLDLTQITERLIKQFDDEPELKARIAQALLGVDDEQSA
Ga0318560_1048774223300031682SoilTNVNIDLSRITERLIQHFDHEPELKARIAQALLEIDDEKSA
Ga0307474_1019770213300031718Hardwood Forest SoilSIRQTLDSLSRLAGFDRQGTQVNVAVQTNVNFDLRQIAERVIRQFDDEPELKARIAQALLEVDDEQAA
Ga0307474_1034440733300031718Hardwood Forest SoilSLSRLAGFDRQGAQVNVAVQTNVNLDLAHIAERVIQRFDHEPELKARIAQALMEVDDEHS
Ga0307474_1043179813300031718Hardwood Forest SoilLSRLSGFDRQGTQINVAVQTNLKLEATQIAERLIAKFDHEPEMKARIAQALLEVDHEQAA
Ga0306917_1140446523300031719SoilLTQIAERVLKRFDHEPELKARIAQALLEVNGEQSE
Ga0318493_1067432423300031723SoilVQANVKVDLSGIVERVIGRFDHEPEIKARIAQALLEVDHEPSV
Ga0306918_1061392233300031744SoilVELTAIAERIIQKFDHEPELKARIAQALVEVDNEQAA
Ga0318509_1059843213300031768SoilVNVGAAQIAERLIQQFDREPELKARIAQALLEADHEHTS
Ga0318548_1038610913300031793SoilSRLSGFDRQGTQINVAVQTNITVEVRAIAERLIKEFDHEPELKARIARTLLETNNEHAS
Ga0307478_1130754813300031823Hardwood Forest SoilSLSRLSGFDRQGTQVNVAVQTNVKIELTALAERIIQKFDHEPDLKARIAQALLEVDNEQA
Ga0306919_1082074813300031879SoilVQTNVNLDLTQITERLIKQFDDEPELKARIAQALLGVDDEQSA
Ga0318544_1031324823300031880SoilLDSLMRLAGYDRPIGSQVNVAVQTNVNIDLSRITERLIQHFDNEPELKARIAQALLEIDDDQAA
Ga0306925_1120793713300031890SoilNFAVQTNVNVEVAALAERIIEKFDAEPELKARIARALVEVDDEHAA
Ga0318520_1004158333300031897SoilLSRLSGFDRQETEVNVAVQTNVNVDVRAIAERLIKEFDHEPELKARIARTLLETDNEYAS
Ga0306923_1083399013300031910SoilVNVAVQTNVNVGAAQIAERLIQQFDREPELKARIAQALLEADHEHTS
Ga0306923_1150429023300031910SoilSGFDRQGTQVNFAVQTNVNVEVAALAERIIEKFDAEPELKARIARALVEVDDEHAA
Ga0306921_1226765413300031912SoilVNFDLTQIAERVLKRFDHEPELKARIAQALLEVNGEQSE
Ga0310912_1129279913300031941SoilMKSWPKQRRKSRLSGFDRQGTQVNVAVQTNVTVGVRAVAERLIREFDHEPELKARIARTLMELDNEHVA
Ga0310916_1101837423300031942SoilQGTQVNVAVQTNVTVGVRAVAQRLIREFDHEPELKARIARTLMELDNEHVA
Ga0310913_1037238923300031945SoilRQGTQINVAVQTNVHVEIRAIAQRLIREFDHEPELKARIARTLMEVDNEPVA
Ga0310910_1003371013300031946SoilVNVAVQTNVNIDLSRITERLIQHFDNEPELKARIAQALLEIDDDQAA
Ga0306926_1020687313300031954SoilQTNVNFDLTQIAERVLKRFDHEPELKARIAQALLEVNGEQSE
Ga0306926_1027288533300031954SoilGPQVNVAVQANVNIELTALAERIIQKFDHEPELKARIAQALVEVDDEQAA
Ga0306926_1257428713300031954SoilLEVTQIAERLIAKFDREPELKARIAQALLEVDHEQAA
Ga0308176_1031095633300031996SoilTEVNVAVQTNLNLEMSRIADRVIEKFDREPELKARIAQALLEVDHEQAA
Ga0306922_1105880723300032001SoilNLNINLAQIGERLIRKFDHEPEIKAQIAQALVEMDDEDQQPSS
Ga0306922_1112179913300032001SoilRHTLDSLSRLSGFDRQGPQINVAVQTNVNVEVKAIAQRLIAEFDREPELKARIARTLLEKDNDPLD
Ga0306922_1138481423300032001SoilDSLSRLSGFDRQGTQINVAVQTNLKLEVTQIAERLIAKFDREPELKARIAQALLEVDHEQAAMKLPIGSIR
Ga0310911_1048931613300032035SoilHTLDSLMRLAGYDRPIGAQVNVAVQTNVNLDLTQITERLIKQFDDEPELKARIAQALLGVDDEQSA
Ga0318575_1030140013300032055SoilVNVAVQTNVNLDLSNLAERLSKKFDHEPELKGRIAQALLEVDDEQPA
Ga0318504_1057769513300032063SoilNVNIDLSRITERLIQHFDNEPELKARIAQALLEIDDDQAA
Ga0310890_1148703913300032075SoilVQTNVSVGAVQIAERLIKAFDHQPEIKAQIAHALMEECHATET
Ga0306924_1113323613300032076SoilQVNVAVQTNLTVNVTQIAESLIKQFDNEPDVKGRIAQALLEMDHERVA
Ga0306924_1129928323300032076SoilLAGHDGADVNIAVQANVKVDLSCIVERVIGCCDHEPEIKARIAQALLEMDHEPTA
Ga0318518_1070571323300032090SoilLNSIRHTLDSLMRLAGYDRPIGAQVNVAVQTNVNLDLTQITERLIKQFDDEPELKARIAQALLGVDDEQSA
Ga0318577_1036784123300032091SoilLSGFDRQGTQVNVAVQTNVIVEVRAIAQRLIKEFDHEPELKARIARALLETDNERAS
Ga0306920_10149942113300032261SoilDRQGTQINVAVQTNLKLEVTQIAERLIAKFDREPELKARIAQALLEVDHEQAA
Ga0306920_10249474923300032261SoilGHYQAPSTQVNVAVQTNVNLDQTRIAERLIQHFDHEPELKARIAQALMELDDEQSS
Ga0306920_10330242013300032261SoilMKSWPKQRRKSRLSGFDRQGTQVNVAVQTNVTVGVRAVAQRLIREFDHEPELKARIARTLMELDNEHVA
Ga0326726_1058933513300033433Peat SoilVQTNVNVDLAQIAERIIKRFDHEPELKARIAQALVEVDDEQSA
Ga0326723_0312506_44_1873300034090Peat SoilVNVAVQTKVNVGAMQIAERLIQKFDHEPELKARIAQALLEVDDEHIS
Ga0326723_0402976_3_1823300034090Peat SoilSRLSGFDRQGAQVNVAVQTNLNVDLRQIVERVIKKFDREPELKARIAQALLEVDDEHAA


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.