Metagenome / Metatranscriptome Family F028504

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences

Select file to download:
Download

Overview

Basic Information
Family ID	F028504
Family Type	Metagenome / Metatranscriptome
Number of Sequences	191
Average Sequence Length	38 residues
Representative Sequence	MEIALVLFILLVGPLALLAGRDSRIDDVDRRRHYQG
Number of Associated Samples	142
Number of Associated Scaffolds	191

Quality Assessment
Transcriptomic Evidence	Yes
Most common taxonomic group	Bacteria
% of genes with valid RBS motifs	31.94 %
% of genes near scaffold ends (potentially truncated)	28.80 %
% of genes from short scaffolds (< 2000 bps)	87.43 %
Associated GOLD sequencing projects	132
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.40

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign

Most Common Taxonomy
Group	Bacteria (70.681 % of family members)
NCBI Taxonomy ID	2
Taxonomy	All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (18.325 % of family members)
Environment Ontology (ENVO)	Unclassified (36.126 % of family members)
Earth Microbiome Project Ontology (EMPO)	Host-associated → Plant → Plant rhizosphere (45.026 % of family members)

Multiple Sequence Alignments

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Select alignment to view:

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification:	Globular	Signal Peptide:	Yes	Secondary Structure distribution:	α-helix: 53.12% β-sheet: 0.00% Coil/Unstructured: 46.88%
Feature Viewer

Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.40
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.40
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

Gene Neighborhood

Neighboring Pfam domains

Pfam ID	Name	% Frequency in 191 Family Scaffolds
PF02737	3HCDH_N	30.37
PF03466	LysR_substrate	19.37
PF00126	HTH_1	17.80
PF02653	BPD_transp_2	17.80
PF02803	Thiolase_C	2.09
PF00999	Na_H_Exchanger	2.09
PF00171	Aldedh	0.52
PF00069	Pkinase	0.52
PF01613	Flavin_Reduct	0.52
PF03100	CcmE	0.52
PF00762	Ferrochelatase	0.52
PF03446	NAD_binding_2	0.52
PF00067	p450	0.52
PF13517	FG-GAP_3	0.52
PF00005	ABC_tran	0.52
PF00486	Trans_reg_C	0.52
PF00535	Glycos_transf_2	0.52
PF00156	Pribosyltran	0.52
PF00571	CBS	0.52

COG ID	Name	Functional Category	% Frequency in 191 Family Scaffolds
COG0240	Glycerol-3-phosphate dehydrogenase	Energy production and conversion [C]	30.37
COG0287	Prephenate dehydrogenase	Amino acid transport and metabolism [E]	30.37
COG2084	3-hydroxyisobutyrate dehydrogenase or related beta-hydroxyacid dehydrogenase	Lipid transport and metabolism [I]	30.37
COG1748	Saccharopine dehydrogenase, NADP-dependent	Amino acid transport and metabolism [E]	30.37
COG0677	UDP-N-acetyl-D-mannosaminuronate dehydrogenase	Cell wall/membrane/envelope biogenesis [M]	30.37
COG1004	UDP-glucose 6-dehydrogenase	Cell wall/membrane/envelope biogenesis [M]	30.37
COG1250	3-hydroxyacyl-CoA dehydrogenase	Lipid transport and metabolism [I]	30.37
COG0025	NhaP-type Na+/H+ or K+/H+ antiporter	Inorganic ion transport and metabolism [P]	2.09
COG4651	Predicted Kef-type K+ transport protein, K+/H+ antiporter domain	Inorganic ion transport and metabolism [P]	2.09
COG3263	NhaP-type Na+/H+ and K+/H+ antiporter with C-terminal TrkAC and CorC domains	Energy production and conversion [C]	2.09
COG3004	Na+/H+ antiporter NhaA	Energy production and conversion [C]	2.09
COG0515	Serine/threonine protein kinase	Signal transduction mechanisms [T]	2.09
COG0475	Kef-type K+ transport system, membrane component KefB	Inorganic ion transport and metabolism [P]	2.09
COG0183	Acetyl-CoA acetyltransferase	Lipid transport and metabolism [I]	2.09
COG1012	Acyl-CoA reductase or other NAD-dependent aldehyde dehydrogenase	Lipid transport and metabolism [I]	0.52
COG1853	FMN reductase RutF, DIM6/NTAB family	Energy production and conversion [C]	0.52
COG2124	Cytochrome P450	Defense mechanisms [V]	0.52
COG2332	Cytochrome c biogenesis protein CcmE	Posttranslational modification, protein turnover, chaperones [O]	0.52
COG0276	Protoheme ferro-lyase (ferrochelatase)	Coenzyme transport and metabolism [H]	0.52
COG4230	Delta 1-pyrroline-5-carboxylate dehydrogenase	Amino acid transport and metabolism [E]	0.52
COG0014	Gamma-glutamyl phosphate reductase	Amino acid transport and metabolism [E]	0.52

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
All Organisms	root	All Organisms	70.68 %
Unclassified	root	N/A	29.32 %

Name	Rank	Taxonomy	Distribution
cellular organisms	root	All Organisms → cellular organisms	70.68 %
Unclassified	root	N/A	29.32 %

Name	Rank	Taxonomy	Distribution
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	70.68 %
Unclassified	root	N/A	29.32 %

Name	Rank	Taxonomy	Distribution
Terrabacteria group	clade	All Organisms → cellular organisms → Bacteria → Terrabacteria group	40.31 %
Unclassified	root	N/A	29.32 %
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	1.05 %

Name	Rank	Taxonomy	Distribution
Actinobacteria	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	35.08 %
Unclassified	root	N/A	29.32 %
Firmicutes	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes	1.05 %
Alphaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	0.52 %
Chloroflexi	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	0.52 %
Gammaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	0.52 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	29.32 %
Actinomycetia	class	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia	16.75 %
Thermoleophilia	class	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia	1.57 %
Clostridia	class	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia	1.05 %
unclassified Chloroflexi	no rank	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi	0.52 %
Sphingomonadales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales	0.52 %
Gammaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	0.52 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	29.32 %
unclassified Actinomycetia	no rank	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia	16.23 %
Solirubrobacterales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales	1.57 %
Eubacteriales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales	1.05 %
Sphingomonadaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae	0.52 %
Actinomycetales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales	0.52 %
Chloroflexi bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	0.52 %
Gammaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	0.52 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	29.32 %
Actinomycetia bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	16.23 %
Solirubrobacterales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales	1.57 %
Novosphingobium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Novosphingobium	0.52 %
Peptococcaceae	family	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Peptococcaceae	0.52 %
Actinomycetales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales	0.52 %
Chloroflexi bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	0.52 %
Gammaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	0.52 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	29.32 %
Actinomycetia bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	16.23 %
Solirubrobacterales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales	1.57 %
Desulfotomaculum	genus	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Peptococcaceae → Desulfotomaculum	0.52 %
unclassified Novosphingobium	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Novosphingobium → unclassified Novosphingobium	0.52 %
Actinomycetales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales	0.52 %
Chloroflexi bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	0.52 %
Gammaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	0.52 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	29.32 %
Actinomycetia bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	16.23 %
Solirubrobacterales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales	1.57 %
Novosphingobium sp. Gsoil 351	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Novosphingobium → unclassified Novosphingobium → Novosphingobium sp. Gsoil 351	0.52 %
Desulfotomaculum	genus	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Peptococcaceae → Desulfotomaculum	0.52 %
Actinomycetales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales	0.52 %
Chloroflexi bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	0.52 %
Gammaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	0.52 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
3300000891\|JGI10214J12806_10702046	All Organisms → cellular organisms → Bacteria	1296	Open in IMG/M
3300000891\|JGI10214J12806_10736505	Not Available	645	Open in IMG/M
3300003992\|Ga0055470_10150605	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	611	Open in IMG/M
3300003999\|Ga0055469_10247500	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	568	Open in IMG/M
3300004779\|Ga0062380_10115477	All Organisms → cellular organisms → Bacteria	1014	Open in IMG/M
3300005328\|Ga0070676_10934470	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	648	Open in IMG/M
3300005329\|Ga0070683_100710751	All Organisms → cellular organisms → Bacteria	962	Open in IMG/M
3300005456\|Ga0070678_100106731	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	2183	Open in IMG/M
3300005458\|Ga0070681_10248009	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Peptococcaceae → Desulfotomaculum	1693	Open in IMG/M
3300005535\|Ga0070684_102314660	All Organisms → cellular organisms → Bacteria → Terrabacteria group	507	Open in IMG/M
3300005543\|Ga0070672_100005453	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales	8432	Open in IMG/M
3300005543\|Ga0070672_100101241	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	2337	Open in IMG/M
3300005548\|Ga0070665_100310682	All Organisms → cellular organisms → Bacteria	1580	Open in IMG/M
3300005558\|Ga0066698_10257124	Not Available	1206	Open in IMG/M
3300005563\|Ga0068855_101117763	All Organisms → cellular organisms → Bacteria	823	Open in IMG/M
3300005563\|Ga0068855_101440145	All Organisms → cellular organisms → Bacteria	709	Open in IMG/M
3300005563\|Ga0068855_101879846	Not Available	607	Open in IMG/M
3300005564\|Ga0070664_101144311	Not Available	733	Open in IMG/M
3300005564\|Ga0070664_101223825	All Organisms → cellular organisms → Bacteria	709	Open in IMG/M
3300005614\|Ga0068856_100120137	All Organisms → cellular organisms → Bacteria	2629	Open in IMG/M
3300005615\|Ga0070702_100403750	All Organisms → cellular organisms → Bacteria	978	Open in IMG/M
3300005617\|Ga0068859_102676391	Not Available	548	Open in IMG/M
3300005618\|Ga0068864_101453492	Not Available	688	Open in IMG/M
3300005718\|Ga0068866_10784781	All Organisms → cellular organisms → Bacteria	661	Open in IMG/M
3300005889\|Ga0075290_1041804	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	615	Open in IMG/M
3300005889\|Ga0075290_1053546	All Organisms → cellular organisms → Bacteria	560	Open in IMG/M
3300005937\|Ga0081455_10014205	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	7817	Open in IMG/M
3300005937\|Ga0081455_10259012	All Organisms → cellular organisms → Bacteria	1268	Open in IMG/M
3300005985\|Ga0081539_10000866	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	57957	Open in IMG/M
3300006574\|Ga0074056_11694454	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	1404	Open in IMG/M
3300006581\|Ga0074048_13281303	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales	846	Open in IMG/M
3300006847\|Ga0075431_101310648	Not Available	685	Open in IMG/M
3300006847\|Ga0075431_101585300	All Organisms → cellular organisms → Bacteria	613	Open in IMG/M
3300006876\|Ga0079217_10485189	Not Available	763	Open in IMG/M
3300006881\|Ga0068865_101819338	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	551	Open in IMG/M
3300006969\|Ga0075419_10670313	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	733	Open in IMG/M
3300007004\|Ga0079218_10564245	Not Available	1028	Open in IMG/M
3300009036\|Ga0105244_10293494	All Organisms → cellular organisms → Bacteria	753	Open in IMG/M
3300009094\|Ga0111539_10695226	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	1184	Open in IMG/M
3300009094\|Ga0111539_11244945	All Organisms → cellular organisms → Bacteria	864	Open in IMG/M
3300009094\|Ga0111539_11414271	Not Available	807	Open in IMG/M
3300009094\|Ga0111539_12371380	All Organisms → cellular organisms → Bacteria → Terrabacteria group	616	Open in IMG/M
3300009098\|Ga0105245_10040627	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	4145	Open in IMG/M
3300009146\|Ga0105091_10108222	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	1279	Open in IMG/M
3300009147\|Ga0114129_12243642	All Organisms → cellular organisms → Bacteria → Terrabacteria group	656	Open in IMG/M
3300009153\|Ga0105094_10800359	Not Available	554	Open in IMG/M
3300009156\|Ga0111538_11047306	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	1032	Open in IMG/M
3300009545\|Ga0105237_10699508	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	1020	Open in IMG/M
3300009553\|Ga0105249_12042942	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	646	Open in IMG/M
3300009553\|Ga0105249_13107777	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	533	Open in IMG/M
3300009840\|Ga0126313_10000492	All Organisms → cellular organisms → Bacteria	18868	Open in IMG/M
3300009873\|Ga0131077_10003744	All Organisms → cellular organisms → Bacteria	36132	Open in IMG/M
3300009873\|Ga0131077_10012884	All Organisms → cellular organisms → Bacteria	16007	Open in IMG/M
3300010041\|Ga0126312_10780420	Not Available	692	Open in IMG/M
3300010333\|Ga0134080_10421279	Not Available	621	Open in IMG/M
3300010371\|Ga0134125_10731621	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	1090	Open in IMG/M
3300010397\|Ga0134124_10158459	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales	2025	Open in IMG/M
3300010399\|Ga0134127_11453992	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	757	Open in IMG/M
3300011119\|Ga0105246_10339380	All Organisms → cellular organisms → Bacteria	1227	Open in IMG/M
3300012091\|Ga0136625_1264064	Not Available	581	Open in IMG/M
3300012093\|Ga0136632_10066260	All Organisms → cellular organisms → Bacteria	1668	Open in IMG/M
3300012093\|Ga0136632_10196563	Not Available	920	Open in IMG/M
3300012480\|Ga0157346_1016753	Not Available	600	Open in IMG/M
3300012897\|Ga0157285_10014992	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	1575	Open in IMG/M
3300012897\|Ga0157285_10178097	All Organisms → cellular organisms → Bacteria → Terrabacteria group	653	Open in IMG/M
3300012900\|Ga0157292_10058767	Not Available	1055	Open in IMG/M
3300012901\|Ga0157288_10005757	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	1827	Open in IMG/M
3300012904\|Ga0157282_10273027	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	583	Open in IMG/M
3300012907\|Ga0157283_10025840	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	1162	Open in IMG/M
3300012914\|Ga0157297_10026088	All Organisms → cellular organisms → Bacteria	1356	Open in IMG/M
3300012943\|Ga0164241_10080255	All Organisms → cellular organisms → Bacteria	2352	Open in IMG/M
3300012943\|Ga0164241_10167583	All Organisms → cellular organisms → Bacteria	1571	Open in IMG/M
3300012943\|Ga0164241_10333540	Not Available	1085	Open in IMG/M
3300012943\|Ga0164241_10356207	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	1048	Open in IMG/M
3300012943\|Ga0164241_11097176	All Organisms → cellular organisms → Bacteria	586	Open in IMG/M
3300012943\|Ga0164241_11286643	Not Available	540	Open in IMG/M
3300012957\|Ga0164303_10036295	All Organisms → cellular organisms → Bacteria	2074	Open in IMG/M
3300012957\|Ga0164303_10494671	Not Available	781	Open in IMG/M
3300012958\|Ga0164299_10128219	Not Available	1369	Open in IMG/M
3300012960\|Ga0164301_10554415	All Organisms → cellular organisms → Bacteria	840	Open in IMG/M
3300012989\|Ga0164305_11493334	All Organisms → cellular organisms → Bacteria	599	Open in IMG/M
3300012989\|Ga0164305_12015947	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	527	Open in IMG/M
3300013100\|Ga0157373_10908307	Not Available	654	Open in IMG/M
3300013102\|Ga0157371_10231784	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	1327	Open in IMG/M
3300013296\|Ga0157374_11441848	Not Available	711	Open in IMG/M
3300013306\|Ga0163162_11905031	All Organisms → cellular organisms → Bacteria	680	Open in IMG/M
3300014263\|Ga0075324_1074846	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	695	Open in IMG/M
3300014270\|Ga0075325_1034325	All Organisms → cellular organisms → Bacteria	1020	Open in IMG/M
3300014301\|Ga0075323_1003983	All Organisms → cellular organisms → Bacteria	2222	Open in IMG/M
3300014310\|Ga0075331_1011692	All Organisms → cellular organisms → Bacteria	1952	Open in IMG/M
3300014326\|Ga0157380_10199558	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	1774	Open in IMG/M
3300014745\|Ga0157377_11768879	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	501	Open in IMG/M
3300014968\|Ga0157379_11784341	All Organisms → cellular organisms → Bacteria → Terrabacteria group	604	Open in IMG/M
3300015374\|Ga0132255_100989321	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	1261	Open in IMG/M
3300017695\|Ga0180121_10252111	Not Available	663	Open in IMG/M
3300017787\|Ga0183260_10001806	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	17799	Open in IMG/M
3300017787\|Ga0183260_10085355	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	2300	Open in IMG/M
3300017787\|Ga0183260_10167996	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	1556	Open in IMG/M
3300017787\|Ga0183260_10846487	Not Available	570	Open in IMG/M
3300017789\|Ga0136617_11176312	Not Available	577	Open in IMG/M
3300017965\|Ga0190266_10052524	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	1450	Open in IMG/M
3300017965\|Ga0190266_10129805	Not Available	1095	Open in IMG/M
3300018432\|Ga0190275_10706025	Not Available	1066	Open in IMG/M
3300018466\|Ga0190268_10145816	Not Available	1199	Open in IMG/M
3300018466\|Ga0190268_10378283	Not Available	898	Open in IMG/M
3300018469\|Ga0190270_10030004	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	3520	Open in IMG/M
3300018481\|Ga0190271_10691486	Not Available	1142	Open in IMG/M
3300018481\|Ga0190271_11226340	Not Available	872	Open in IMG/M
3300018481\|Ga0190271_11989955	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	690	Open in IMG/M
3300019356\|Ga0173481_10001236	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	6090	Open in IMG/M
3300019356\|Ga0173481_10144307	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	975	Open in IMG/M
3300019356\|Ga0173481_10173763	All Organisms → cellular organisms → Bacteria	911	Open in IMG/M
3300019356\|Ga0173481_10567048	Not Available	591	Open in IMG/M
3300019361\|Ga0173482_10270420	All Organisms → cellular organisms → Bacteria	733	Open in IMG/M
3300019361\|Ga0173482_10351808	All Organisms → cellular organisms → Bacteria → Terrabacteria group	668	Open in IMG/M
3300022880\|Ga0247792_1006936	All Organisms → cellular organisms → Bacteria	1670	Open in IMG/M
3300022883\|Ga0247786_1002028	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	3797	Open in IMG/M
3300022883\|Ga0247786_1055382	All Organisms → cellular organisms → Bacteria	808	Open in IMG/M
3300022898\|Ga0247745_1011709	All Organisms → cellular organisms → Bacteria	1189	Open in IMG/M
3300022915\|Ga0247790_10042342	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	1033	Open in IMG/M
3300022915\|Ga0247790_10136706	Not Available	624	Open in IMG/M
3300023066\|Ga0247793_1076819	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	564	Open in IMG/M
3300023070\|Ga0247755_1079294	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	691	Open in IMG/M
3300023083\|Ga0247734_1164480	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	585	Open in IMG/M
3300025313\|Ga0209431_10397280	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	1065	Open in IMG/M
3300025315\|Ga0207697_10496516	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Novosphingobium → unclassified Novosphingobium → Novosphingobium sp. Gsoil 351	539	Open in IMG/M
3300025321\|Ga0207656_10101641	All Organisms → cellular organisms → Bacteria	1318	Open in IMG/M
3300025552\|Ga0210142_1000082	All Organisms → cellular organisms → Bacteria	21340	Open in IMG/M
3300025559\|Ga0210087_1008641	All Organisms → cellular organisms → Bacteria	2200	Open in IMG/M
3300025567\|Ga0210076_1087032	Not Available	683	Open in IMG/M
3300025567\|Ga0210076_1098598	All Organisms → cellular organisms → Bacteria	640	Open in IMG/M
3300025893\|Ga0207682_10231683	All Organisms → cellular organisms → Bacteria	856	Open in IMG/M
3300025899\|Ga0207642_10100544	All Organisms → cellular organisms → Bacteria	1450	Open in IMG/M
3300025899\|Ga0207642_10610032	Not Available	680	Open in IMG/M
3300025900\|Ga0207710_10053521	All Organisms → cellular organisms → Bacteria	1816	Open in IMG/M
3300025903\|Ga0207680_10429467	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	936	Open in IMG/M
3300025904\|Ga0207647_10521256	Not Available	661	Open in IMG/M
3300025909\|Ga0207705_10050522	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	2993	Open in IMG/M
3300025909\|Ga0207705_10837683	All Organisms → cellular organisms → Bacteria	713	Open in IMG/M
3300025919\|Ga0207657_10931440	Not Available	668	Open in IMG/M
3300025921\|Ga0207652_10647046	All Organisms → cellular organisms → Bacteria	945	Open in IMG/M
3300025924\|Ga0207694_10524713	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	993	Open in IMG/M
3300025925\|Ga0207650_10540359	All Organisms → cellular organisms → Bacteria	976	Open in IMG/M
3300025926\|Ga0207659_11654838	Not Available	546	Open in IMG/M
3300025937\|Ga0207669_10196714	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	1459	Open in IMG/M
3300025938\|Ga0207704_11542748	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	570	Open in IMG/M
3300025949\|Ga0207667_10398338	Not Available	1402	Open in IMG/M
3300025958\|Ga0210069_1007300	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	1458	Open in IMG/M
3300025959\|Ga0210116_1053749	All Organisms → cellular organisms → Bacteria	773	Open in IMG/M
3300025960\|Ga0207651_11244872	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	668	Open in IMG/M
3300025961\|Ga0207712_10760545	All Organisms → cellular organisms → Bacteria	849	Open in IMG/M
3300026035\|Ga0207703_10124009	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales	2221	Open in IMG/M
3300026035\|Ga0207703_11305922	Not Available	698	Open in IMG/M
3300026041\|Ga0207639_10438763	All Organisms → cellular organisms → Bacteria	1183	Open in IMG/M
3300026051\|Ga0208911_1007699	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	980	Open in IMG/M
3300026078\|Ga0207702_10459088	All Organisms → cellular organisms → Bacteria	1237	Open in IMG/M
3300026088\|Ga0207641_10570071	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	1106	Open in IMG/M
3300026095\|Ga0207676_10803670	All Organisms → cellular organisms → Bacteria	918	Open in IMG/M
3300026116\|Ga0207674_10827811	Not Available	893	Open in IMG/M
3300026116\|Ga0207674_11935904	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	555	Open in IMG/M
3300026118\|Ga0207675_101637538	Not Available	664	Open in IMG/M
3300027675\|Ga0209077_1138249	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	679	Open in IMG/M
3300027886\|Ga0209486_10123554	Not Available	1399	Open in IMG/M
3300027894\|Ga0209068_10243448	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	998	Open in IMG/M
3300028379\|Ga0268266_10857343	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	878	Open in IMG/M
3300028380\|Ga0268265_12266100	All Organisms → cellular organisms → Bacteria → Terrabacteria group	550	Open in IMG/M
3300028587\|Ga0247828_10221272	All Organisms → cellular organisms → Bacteria	999	Open in IMG/M
3300028587\|Ga0247828_10491892	Not Available	727	Open in IMG/M
3300028587\|Ga0247828_10901519	Not Available	569	Open in IMG/M
3300028590\|Ga0247823_10669553	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	781	Open in IMG/M
3300028590\|Ga0247823_11109357	Not Available	593	Open in IMG/M
3300028592\|Ga0247822_11832209	Not Available	518	Open in IMG/M
3300028802\|Ga0307503_10152924	All Organisms → cellular organisms → Bacteria	1049	Open in IMG/M
3300028812\|Ga0247825_10608056	All Organisms → cellular organisms → Bacteria	783	Open in IMG/M
3300028812\|Ga0247825_10613609	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	779	Open in IMG/M
3300028812\|Ga0247825_10832498	Not Available	667	Open in IMG/M
3300030336\|Ga0247826_10089245	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	1880	Open in IMG/M
3300030336\|Ga0247826_10479830	All Organisms → cellular organisms → Bacteria	935	Open in IMG/M
3300031547\|Ga0310887_10836966	Not Available	580	Open in IMG/M
3300031562\|Ga0310886_10724999	Not Available	621	Open in IMG/M
3300031824\|Ga0307413_10679485	Not Available	853	Open in IMG/M
3300031858\|Ga0310892_10556059	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	772	Open in IMG/M
3300031858\|Ga0310892_10644018	Not Available	722	Open in IMG/M
3300031901\|Ga0307406_11089539	All Organisms → cellular organisms → Bacteria	689	Open in IMG/M
3300031938\|Ga0308175_100919884	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	963	Open in IMG/M
3300031944\|Ga0310884_10143572	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	1224	Open in IMG/M
3300032075\|Ga0310890_10737642	Not Available	775	Open in IMG/M
3300032122\|Ga0310895_10245221	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	825	Open in IMG/M
3300033550\|Ga0247829_10091991	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales	2260	Open in IMG/M
3300033550\|Ga0247829_10905341	Not Available	734	Open in IMG/M
3300033550\|Ga0247829_11173293	Not Available	637	Open in IMG/M

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:

Habitat	Taxonomy	Distribution
Environmental	Environmental	60.21%
Host-Associated	Host-Associated	38.74%
Engineered	Engineered	1.05%

Habitat	Taxonomy	Distribution
Terrestrial	Environmental → Terrestrial	48.69%
Plants	Host-Associated → Plants	38.74%
Aquatic	Environmental → Aquatic	11.52%
Wastewater	Engineered → Wastewater	1.05%

Habitat	Taxonomy	Distribution
Soil	Environmental → Terrestrial → Soil	47.64%
Rhizosphere	Host-Associated → Plants → Rhizosphere	21.99%
Rhizoplane	Host-Associated → Plants → Rhizoplane	16.75%
Freshwater	Environmental → Aquatic → Freshwater	6.81%
Marine	Environmental → Aquatic → Marine	4.19%
Plant Litter	Environmental → Terrestrial → Plant Litter	1.05%
Activated Sludge	Engineered → Wastewater → Activated Sludge	1.05%
Sediment	Environmental → Aquatic → Sediment	0.52%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified	40.84%
Epiphytes	Host-Associated → Plants → Rhizoplane → Epiphytes	15.71%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified	13.61%
Soil	Host-Associated → Plants → Rhizosphere → Soil	8.38%
Wetlands	Environmental → Aquatic → Marine → Wetlands	4.19%
Ice	Environmental → Aquatic → Freshwater → Ice	4.71%
Wetlands	Environmental → Terrestrial → Soil → Wetlands	3.66%
Loam	Environmental → Terrestrial → Soil → Loam	3.14%
Sediment	Environmental → Aquatic → Freshwater → Sediment	1.57%
Unclassified	Environmental → Terrestrial → Plant Litter → Unclassified	1.05%
Unclassified	Engineered → Wastewater → Activated Sludge → Unclassified	1.05%
Wetlands	Environmental → Aquatic → Freshwater → Wetlands	0.52%
Unclassified	Environmental → Aquatic → Sediment → Unclassified	0.52%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified	0.52%
Soil	Host-Associated → Plants → Rhizoplane → Soil	0.52%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified → Unclassified	22.51%
Unclassified	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified	15.71%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified	13.61%
Agricultural	Environmental → Terrestrial → Soil → Unclassified → Agricultural	11.52%
Unclassified	Host-Associated → Plants → Rhizosphere → Soil → Unclassified	8.38%
Agricultural Land	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land	5.24%
Unclassified	Environmental → Aquatic → Marine → Wetlands → Unclassified	4.19%
Unclassified	Environmental → Aquatic → Freshwater → Ice → Unclassified	4.71%
Unclassified	Environmental → Terrestrial → Soil → Wetlands → Unclassified	3.66%
Agricultural Soil	Environmental → Terrestrial → Soil → Loam → Agricultural Soil	2.62%
Unclassified	Environmental → Aquatic → Freshwater → Sediment → Unclassified	1.57%
Grasslands	Environmental → Terrestrial → Soil → Unclassified → Grasslands	1.57%
Unclassified	Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified	1.05%
Unclassified	Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified	1.05%
Unclassified	Environmental → Aquatic → Freshwater → Wetlands → Unclassified	0.52%
Unclassified	Environmental → Aquatic → Sediment → Unclassified → Unclassified	0.52%
Unclassified	Environmental → Terrestrial → Soil → Loam → Unclassified	0.52%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified	0.52%
Unclassified	Host-Associated → Plants → Rhizoplane → Soil → Unclassified	0.52%

Habitat	Taxonomy	Distribution
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	18.32%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil	11.52%
Corn Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere	5.76%
Natural And Restored Wetlands	Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands	4.19%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere	4.19%
Polar Desert Sand	Environmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand	4.71%
Populus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere	4.71%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil	3.66%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere	3.14%
Natural And Restored Wetlands	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands	2.62%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere	2.62%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere	2.62%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere	2.62%
Corn Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere	2.09%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere	2.09%
Freshwater Sediment	Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment	1.57%
Terrestrial Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil	1.57%
Agricultural Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil	1.57%
Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil	1.57%
Tabebuia Heterophylla Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere	1.57%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	1.57%
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	1.05%
Serpentine Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil	1.05%
Rice Paddy Soil	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil	1.05%
Plant Litter	Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter	1.05%
Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere	1.05%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere	1.05%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere	1.05%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	1.05%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere	1.05%
Wastewater	Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Wastewater	1.05%
Wetland Sediment	Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Wetland Sediment	0.52%
Watersheds	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds	0.52%
Grasslands Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil	0.52%
Corn, Switchgrass And Miscanthus Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere	0.52%
Soil	Environmental → Terrestrial → Soil → Loam → Unclassified → Soil	0.52%
Arabidopsis Rhizosphere	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere	0.52%
Arabidopsis Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere	0.52%
Corn, Switchgrass And Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere	0.52%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere	0.52%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere	0.52%

Visualization

Powered by ApexCharts

Associated Samples

Taxon OID	Sample Name	Habitat Type	IMG/M Link
3300000891	Soil microbial communities from Great Prairies - Wisconsin, Continuous corn soil	Environmental	Open in IMG/M
3300003992	Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleB_D1	Environmental	Open in IMG/M
3300003999	Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleA_D2	Environmental	Open in IMG/M
3300004779	Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T0Bare3Fresh	Environmental	Open in IMG/M
3300005328	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG	Host-Associated	Open in IMG/M
3300005329	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG	Environmental	Open in IMG/M
3300005456	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG	Host-Associated	Open in IMG/M
3300005458	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG	Environmental	Open in IMG/M
3300005535	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG	Environmental	Open in IMG/M
3300005543	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG	Host-Associated	Open in IMG/M
3300005548	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG	Host-Associated	Open in IMG/M
3300005558	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147	Environmental	Open in IMG/M
3300005563	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2	Host-Associated	Open in IMG/M
3300005564	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG	Host-Associated	Open in IMG/M
3300005614	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2	Host-Associated	Open in IMG/M
3300005615	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG	Environmental	Open in IMG/M
3300005617	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2	Host-Associated	Open in IMG/M
3300005618	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2	Host-Associated	Open in IMG/M
3300005718	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2	Host-Associated	Open in IMG/M
3300005889	Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_80N_201	Environmental	Open in IMG/M
3300005937	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1	Host-Associated	Open in IMG/M
3300005985	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2	Host-Associated	Open in IMG/M
3300006574	Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHAA (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300006581	Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLPB (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300006847	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5	Host-Associated	Open in IMG/M
3300006876	Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS200	Environmental	Open in IMG/M
3300006881	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2	Host-Associated	Open in IMG/M
3300006969	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3	Host-Associated	Open in IMG/M
3300007004	Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost	Environmental	Open in IMG/M
3300009036	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG	Host-Associated	Open in IMG/M
3300009094	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2)	Host-Associated	Open in IMG/M
3300009098	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG	Host-Associated	Open in IMG/M
3300009146	Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm March2015	Environmental	Open in IMG/M
3300009147	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2)	Host-Associated	Open in IMG/M
3300009153	Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (3) Depth 10-12cm March2015	Environmental	Open in IMG/M
3300009156	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2)	Host-Associated	Open in IMG/M
3300009545	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG	Host-Associated	Open in IMG/M
3300009553	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG	Host-Associated	Open in IMG/M
3300009840	Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105A	Environmental	Open in IMG/M
3300009873	Activated sludge microbial diversity in wastewater treatment plant from Taiwan - Wenshan plant	Engineered	Open in IMG/M
3300010041	Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot104A	Environmental	Open in IMG/M
3300010333	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_2_24_1 metaG	Environmental	Open in IMG/M
3300010371	Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1	Environmental	Open in IMG/M
3300010397	Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4	Environmental	Open in IMG/M
3300010399	Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3	Environmental	Open in IMG/M
3300011119	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG	Host-Associated	Open in IMG/M
3300012091	Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ483 (23.06)	Environmental	Open in IMG/M
3300012093	Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ611 (21.06)	Environmental	Open in IMG/M
3300012480	Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.5.yng.040610	Host-Associated	Open in IMG/M
3300012897	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S074-202C-1	Environmental	Open in IMG/M
3300012900	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S179-409R-1	Environmental	Open in IMG/M
3300012901	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S119-311C-1	Environmental	Open in IMG/M
3300012904	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S029-104C-1	Environmental	Open in IMG/M
3300012907	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S044-104R-1	Environmental	Open in IMG/M
3300012914	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S028-104C-2	Environmental	Open in IMG/M
3300012943	Backyard soil microbial communities from Emeryville, California, USA - Original compost - Back yard soil (BY)	Environmental	Open in IMG/M
3300012957	Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG	Environmental	Open in IMG/M
3300012958	Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MG	Environmental	Open in IMG/M
3300012960	Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG	Environmental	Open in IMG/M
3300012989	Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG	Environmental	Open in IMG/M
3300013100	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG	Host-Associated	Open in IMG/M
3300013102	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG	Host-Associated	Open in IMG/M
3300013296	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG	Host-Associated	Open in IMG/M
3300013306	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG	Host-Associated	Open in IMG/M
3300014263	Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleC_D1	Environmental	Open in IMG/M
3300014270	Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberrySE_CattailA_D1	Environmental	Open in IMG/M
3300014301	Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleA_D1	Environmental	Open in IMG/M
3300014310	Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberrySE_TuleA_D1	Environmental	Open in IMG/M
3300014326	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG	Host-Associated	Open in IMG/M
3300014745	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG	Host-Associated	Open in IMG/M
3300014968	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG	Host-Associated	Open in IMG/M
3300015374	Col-0 rhizosphere combined assembly	Host-Associated	Open in IMG/M
3300017695	Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ540 (21.06) (version 2)	Environmental	Open in IMG/M
3300017787	Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ497 (22.06) (version 2)	Environmental	Open in IMG/M
3300017789	Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ322 (21.06)	Environmental	Open in IMG/M
3300017965	Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 220 T	Environmental	Open in IMG/M
3300018432	Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 550 T	Environmental	Open in IMG/M
3300018466	Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 T	Environmental	Open in IMG/M
3300018469	Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T	Environmental	Open in IMG/M
3300018481	Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 356 T	Environmental	Open in IMG/M
3300019356	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S073-202C-2 (version 2)	Environmental	Open in IMG/M
3300019361	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2 (version 2)	Environmental	Open in IMG/M
3300022880	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S106-311C-6	Environmental	Open in IMG/M
3300022883	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S066-202C-4	Environmental	Open in IMG/M
3300022898	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S109-311C-5	Environmental	Open in IMG/M
3300022915	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S171-409R-4	Environmental	Open in IMG/M
3300023066	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S223-509R-6	Environmental	Open in IMG/M
3300023070	Plant litter microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-L096-311B-4	Environmental	Open in IMG/M
3300023083	Plant litter microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-L103-311B-2	Environmental	Open in IMG/M
3300025313	Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 13_3 (SPAdes)	Environmental	Open in IMG/M
3300025315	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes)	Host-Associated	Open in IMG/M
3300025321	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes)	Host-Associated	Open in IMG/M
3300025552	Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Goodyear_PhragC_D2 (SPAdes)	Environmental	Open in IMG/M
3300025559	Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailB_D2 (SPAdes)	Environmental	Open in IMG/M
3300025567	Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailA_D2 (SPAdes)	Environmental	Open in IMG/M
3300025893	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025899	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes)	Host-Associated	Open in IMG/M
3300025900	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025903	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025904	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes)	Host-Associated	Open in IMG/M
3300025909	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025919	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025921	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes)	Environmental	Open in IMG/M
3300025924	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025925	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025926	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025937	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025938	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes)	Host-Associated	Open in IMG/M
3300025949	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes)	Host-Associated	Open in IMG/M
3300025958	Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushSE_TuleB_D2 (SPAdes)	Environmental	Open in IMG/M
3300025959	Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushOxbow_ThreeSqB_D2 (SPAdes)	Environmental	Open in IMG/M
3300025960	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025961	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300026035	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes)	Host-Associated	Open in IMG/M
3300026041	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes)	Host-Associated	Open in IMG/M
3300026051	Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberrySE_CattailA_D1 (SPAdes)	Environmental	Open in IMG/M
3300026078	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes)	Host-Associated	Open in IMG/M
3300026088	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes)	Host-Associated	Open in IMG/M
3300026095	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes)	Host-Associated	Open in IMG/M
3300026116	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes)	Host-Associated	Open in IMG/M
3300026118	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes)	Host-Associated	Open in IMG/M
3300027675	Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm March2015 (SPAdes)	Environmental	Open in IMG/M
3300027886	Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost (SPAdes)	Environmental	Open in IMG/M
3300027894	Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 (SPAdes)	Environmental	Open in IMG/M
3300028379	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300028380	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes)	Host-Associated	Open in IMG/M
3300028587	Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day3	Environmental	Open in IMG/M
3300028590	Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_PalmiticAcid_Day30	Environmental	Open in IMG/M
3300028592	Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Cellulose_Day30	Environmental	Open in IMG/M
3300028802	Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 17_S	Environmental	Open in IMG/M
3300028812	Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Vanillin_Day48	Environmental	Open in IMG/M
3300030336	Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day1	Environmental	Open in IMG/M
3300031547	Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D4	Environmental	Open in IMG/M
3300031562	Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D3	Environmental	Open in IMG/M
3300031824	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2	Host-Associated	Open in IMG/M
3300031858	Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D2	Environmental	Open in IMG/M
3300031901	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2	Host-Associated	Open in IMG/M
3300031938	Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1	Environmental	Open in IMG/M
3300031944	Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D1	Environmental	Open in IMG/M
3300032075	Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D3	Environmental	Open in IMG/M
3300032122	Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D4	Environmental	Open in IMG/M
3300033550	Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day4	Environmental	Open in IMG/M

Geographical Distribution

Zoom:	Powered by OpenStreetMap

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
JGI10214J12806_107020462	3300000891	Soil	VEIAIVLFILLVGPLALLAGRDSRIDDVARRRRELG*
JGI10214J12806_107365051	3300000891	Soil	MELAFVIFLLVVGPLAVLAGRDSRIDDVERRRNYQ
Ga0055470_101506052	3300003992	Natural And Restored Wetlands	HTTDMAIAFLVLILLVGPLALLYGRDSRIDDSARRRRYRG*
Ga0055469_102475001	3300003999	Natural And Restored Wetlands	HSAMEIAVLVFLLVVGPLAVLAGRDSRIDDVDRRRHYRG*
Ga0062380_101154773	3300004779	Wetland Sediment	MIQSLHHVDMEIAFVLFLLLVGPLALLRGRDSRIDETNRQRRYLG*
Ga0070676_109344701	3300005328	Miscanthus Rhizosphere	VPARHNDHMELVLVIFLLVVGPLALLYGRDSRIDDVQRRRDYQG*
Ga0070683_1007107512	3300005329	Corn Rhizosphere	FALIVPARHTAVMAIALVLFILLVGPLALLAGRDSRIDDVARRRRELG*
Ga0070678_1001067311	3300005456	Miscanthus Rhizosphere	RQNAGMAIALLVFVLVIGPLAVLAGCDSRIDDVDRRRRYHG*
Ga0070681_102480093	3300005458	Corn Rhizosphere	YLHSQTMGMEIALVLFILLVGPLALLAGRDSRIDDTARRRRHLG*
Ga0070684_1023146602	3300005535	Corn Rhizosphere	HSHTTGMEIAIVLFILLVGPLALLAGRDSRIDDTARRRRHLG*
Ga0070672_1000054533	3300005543	Miscanthus Rhizosphere	MELAFVIFLLVVGPLALLAGRDSRIDDVERRRTYRG*
Ga0070672_1001012412	3300005543	Miscanthus Rhizosphere	MELVLVIFLLVVGPLALLYGRDSRIDDVQRRRDYQG*
Ga0070665_1003106822	3300005548	Switchgrass Rhizosphere	MAIALIVFVVVIGPLAVLAGCDSRIDDVDRRRRYHG*
Ga0066698_102571242	3300005558	Soil	MAFAILLFILLVGPLALLAGSDSRIDEAARRRRRQHGGY*
Ga0068855_1011177632	3300005563	Corn Rhizosphere	MEIALVLFILLVGPLALLAGRDSRIDDVARRRRELG*
Ga0068855_1014401452	3300005563	Corn Rhizosphere	MEIALVLFVVVVGPLALLAGRDSRIDDEARRRRYLG*
Ga0068855_1018798462	3300005563	Corn Rhizosphere	MEIALVIFMLVVGPLALIGGRDSRVDDVDRRRHYNG*
Ga0070664_1011443112	3300005564	Corn Rhizosphere	MELAFVIFLLVVGPLALLAGRDSRIDDVERRRTYQG*
Ga0070664_1012238252	3300005564	Corn Rhizosphere	MELAFVIFLLVIGPLALLAGRDSRIDDVERRRTYRG*
Ga0068856_1001201373	3300005614	Corn Rhizosphere	MGMEIALVLFILLVGPLALLAGRDSRIDDTARRRRHLG*
Ga0070702_1004037502	3300005615	Corn, Switchgrass And Miscanthus Rhizosphere	YLHSHTTGMEIAIVLFILLVGPLALLAGRDSRIDDTARRRRHLG*
Ga0068859_1026763911	3300005617	Switchgrass Rhizosphere	HTTGMEIAIVLFILLVGPLALLAGRDSRIDDTARRRRHLG*
Ga0068864_1014534922	3300005618	Switchgrass Rhizosphere	MEIAIVLFILLVGPLALLAGRDSRIDDTARRRRHLG*
Ga0068866_107847812	3300005718	Miscanthus Rhizosphere	MAMEIAIVLFIVLVGPLALLYGRDSRIDDTARRRRHQG*
Ga0075290_10418042	3300005889	Rice Paddy Soil	MAIAFLVLILLVGPLSLLYGRDSRIDDSARRRRYRG*
Ga0075290_10535462	3300005889	Rice Paddy Soil	MEIAIVLFLLLVGPLALFAGRDSRIDDTARRRRHLG*
Ga0081455_100142057	3300005937	Tabebuia Heterophylla Rhizosphere	MEIAIILFVLLVGPLALIAGRDSRIDDEARRRRYLG*
Ga0081455_102590122	3300005937	Tabebuia Heterophylla Rhizosphere	MEIALVLFVLVVGPLALLAGRDSRIDDEARRRRYLG*
Ga0081539_1000086625	3300005985	Tabebuia Heterophylla Rhizosphere	MEFVVIAFILLVGPLALLVGRDSRLDDAARRHRYQG*
Ga0074056_116944542	3300006574	Soil	MAIALLVFVLVIGPLAVLAGCDSRIDDVDRRRRYHG*
Ga0074048_132813032	3300006581	Soil	MAIAVLVFVLVIGPLAVLAGCDSRIDDVDRRRRYHG*
Ga0075431_1013106482	3300006847	Populus Rhizosphere	MEIAVVLFLLLVGPLALLAGRDSRIDEVNRRRSYEG*
Ga0075431_1015853002	3300006847	Populus Rhizosphere	MEIAVVLFILLVGPLALLAGRDSRIDDVARRRRELG*
Ga0079217_104851892	3300006876	Agricultural Soil	MEIAVIVFLLLVGPLALLAGRDSRIDDRDRRRHYQG*
Ga0068865_1018193382	3300006881	Miscanthus Rhizosphere	MELALVIFLLVVGPLAVLAGRDSRIDDVERRRNYQG*
Ga0075419_106703131	3300006969	Populus Rhizosphere	RFALMVPARHNDHMELVLVIFLLVVGPLALLYGRDSRIDDVQRRRDYQG*
Ga0079218_105642452	3300007004	Agricultural Soil	MEIAVIVFLLLVGPLALLAGRDSRIDDRDRRRHYRG*
Ga0105244_102934941	3300009036	Miscanthus Rhizosphere	PMEIALVLFVVVVGPLALLAGRDSRIDDEARRRRYLG*
Ga0111539_106952262	3300009094	Populus Rhizosphere	MELALVIFLLVVGPLAVLAGRDSRIDDVERRRDYQG*
Ga0111539_112449452	3300009094	Populus Rhizosphere	MEIALVLFVVVVGPFALLAGRDSRIDDEARRRRYLG*
Ga0111539_114142712	3300009094	Populus Rhizosphere	MEIAIVLFILLVGPLALLAGRDSRIDDVARRRRELG*
Ga0111539_123713802	3300009094	Populus Rhizosphere	VAVRHTAVMEIALVLFILLVGPLALLAGRDSRIDDVARRRRELG*
Ga0105245_100406272	3300009098	Miscanthus Rhizosphere	MELAFVIFLLVVGPLAVLAGRDSRIDDVERRRNYQG*
Ga0105091_101082223	3300009146	Freshwater Sediment	MEIALLLFLLVVGPLALLGGRDSRIDEKDRRRTYLG*
Ga0114129_122436421	3300009147	Populus Rhizosphere	MEIALVLFILLVGPLALLAGRDSRIDDEARRRRYLG*
Ga0105094_108003591	3300009153	Freshwater Sediment	MEIALLLFILLVGPAALLAGRDSRIDESDRRRHYLG*
Ga0111538_110473063	3300009156	Populus Rhizosphere	MAIALIVFVLLVGPLALLAGRDSRIDDVDRRRHYQG*
Ga0105237_106995081	3300009545	Corn Rhizosphere	HNDHMELVLVIFLLVVGPLALLYGRDSRIDDVQRRRDYKG*
Ga0105249_120429422	3300009553	Switchgrass Rhizosphere	MVPARHNDHMELVLVIFLLVVGPLALLYGRDSRIDDVQRRRDYQG*
Ga0105249_131077771	3300009553	Switchgrass Rhizosphere	STAMELAFVIFLLVVGPLALLAGRDSRIDDVERRRTYQG*
Ga0126313_1000049215	3300009840	Serpentine Soil	MAVLVLVFILVIGPLAVLYGRDSRIDREAERRRFASSL*
Ga0131077_100037444	3300009873	Wastewater	MGMELAFVIFLLVVGPLALLAGRDSRVDDVERRRHYQG*
Ga0131077_100128843	3300009873	Wastewater	MELAFVIFLVAIALLSVVGGRDSRIDDVERRRHYQG*
Ga0126312_107804202	3300010041	Serpentine Soil	MEIALLIVLLLIGPLALLGGRDSRIDEGSRRHRYVGEPPRHPRARGRRA*
Ga0134080_104212792	3300010333	Grasslands Soil	MAFAILLFILLVGPLALVAGSDSRIDEAARRRRRQHGGY*
Ga0134125_107316212	3300010371	Terrestrial Soil	MELAFVIFLLVVGPVALLAGRDSRIDDVERRRTYRG*
Ga0134124_101584593	3300010397	Terrestrial Soil	LAFVIFLLVVGPLALLAGRDSRIDDVERRRTYQG*
Ga0134127_114539921	3300010399	Terrestrial Soil	AMELALVIFLLVVGPLAVLAGRDSRIDDVERRRNYQG*
Ga0105246_103393803	3300011119	Miscanthus Rhizosphere	MAIALVLFILLVGPLALLAGRDSRIDDVARRRRELG*
Ga0136625_12640641	3300012091	Polar Desert Sand	MEIVLVLFFVLVGPLALLAGRDSRIDEVDRRRRFQG*
Ga0136632_100662603	3300012093	Polar Desert Sand	VVLIGELIMILFIVLVGPLALLYGVDSRDDDRRR*
Ga0136632_101965632	3300012093	Polar Desert Sand	MELVVLAFLLLVGPLALLAGRDSRIDDVDRRRRYGG*
Ga0157346_10167532	3300012480	Arabidopsis Rhizosphere	MEIALVLFVVVVGPLALLAGRDSRIDDEAHRRRYLG*
Ga0157285_100149922	3300012897	Soil	MELALVIFLLVVGPLAVLVGRDSRIDDVERRRNYQG*
Ga0157285_101780971	3300012897	Soil	PRLALIVAVRHTAVMEIALVLFILLVGPLALLAGRDSRIDDVARRRRELG*
Ga0157292_100587672	3300012900	Soil	MEIALVLFILLVGPLALLAGRDSRIDDVDRRRHYQG*
Ga0157288_100057571	3300012901	Soil	IALVLFILLVGPLALLAGRDSRIDDVARRRRELG*
Ga0157282_102730271	3300012904	Soil	GDMELVLVIFLLVVGPLALLYGRDSRIDDVQRRRDYQG*
Ga0157283_100258403	3300012907	Soil	PRLALIIPARHSTAMELALVIFLLVVGPLAVLVGRDSRIDDVERRRNYQG*
Ga0157297_100260882	3300012914	Soil	MEIALILFILLVGPLALLAGRDSRIDDVARRRRELG*
Ga0164241_100802552	3300012943	Soil	MEIAIVLFLLLVGPLALLAGRDSRIDDEARRRHYLG*
Ga0164241_101675832	3300012943	Soil	MEIAIVLFLLLVGPLALLVGRDSRIDDTARRRRHLG*
Ga0164241_103335402	3300012943	Soil	MEIAIVLFVLLVGPLALLLGRDSRIDDKARRRHYLG*
Ga0164241_103562072	3300012943	Soil	MAMEIAIVLFIVLVGPLALLYGRDSRIDDTARRRRHLG*
Ga0164241_110971762	3300012943	Soil	MEIAFVIFLLVVGPLALLYGRDSRIDDVDRRRRHQG*
Ga0164241_112866431	3300012943	Soil	MEIALIIFVLLVGPLALFAGRDSRIDDVDRRRHYQG*
Ga0164303_100362951	3300012957	Soil	MMRAMELALVIFLLVVGPLALLAGRDSRVDDVERRRHYKG*
Ga0164303_104946711	3300012957	Soil	MELAFVIFLLVVGPLALLAGRDSRIADVERSRTYRG*
Ga0164299_101282191	3300012958	Soil	MELAFVIFLLVVGPLALLAGRDARIDDVERRRTYRG*
Ga0164301_105544152	3300012960	Soil	MAMEIAIVLFIVLVGPLALLYGQDSRIDDTARRRRHQG*
Ga0164305_114933342	3300012989	Soil	MMKAMELALVIFLLVVGPLALIAGRDSRVDDVERRRHYKG*
Ga0164305_120159471	3300012989	Soil	MELVLLIFLLVVGPLALLYGRDSRIDDVQRRRDYQG*
Ga0157373_109083071	3300013100	Corn Rhizosphere	LHSQTMGMEIALVLFILLVGPLALLAGRDSRIDDTARRRRHLG*
Ga0157371_102317842	3300013102	Corn Rhizosphere	MELAFVIFLLVVGPLALLAGRDSRIDDVERRRNYQG*
Ga0157374_114418481	3300013296	Miscanthus Rhizosphere	MELVLVIFLLVVGPLALLYGRDSRIDGVDRRRRHQG*
Ga0163162_119050312	3300013306	Switchgrass Rhizosphere	MEIALVLFVVVIGPLALLAGRDSRIDDEARRRRYLG*
Ga0075324_10748462	3300014263	Natural And Restored Wetlands	GDHSAMEIAVLVFLLVVGPLAVLAGRDSRIDDVDRRRHYQG*
Ga0075325_10343252	3300014270	Natural And Restored Wetlands	MEIAVLVFLLVVGPLAVLAGRDSRIDDVDRRRHYRG*
Ga0075323_10039833	3300014301	Natural And Restored Wetlands	MAIAFLVLILLVGPLALLYGRDSRIDDSARRRRYRG*
Ga0075331_10116923	3300014310	Natural And Restored Wetlands	MEIAVLVFLLVVGPLAVLAGRDSRIDDVDRRRHYQG*
Ga0157380_101995583	3300014326	Switchgrass Rhizosphere	AIALLVFVLVIGPLAVLAGCDSRIDDVDRRRRYHG*
Ga0157377_117688791	3300014745	Miscanthus Rhizosphere	LVLIVPPRQNAGMAIALLVFVLVIGPLAVLAGCDSRIDDVDRRRRYHG*
Ga0157379_117843412	3300014968	Switchgrass Rhizosphere	YPLRHTADMEIALVLFILLVGPLALLAGRDSRIDDVARRRRELG*
Ga0132255_1009893211	3300015374	Arabidopsis Rhizosphere	IPARHNVAMEIALVIFMLVVGPLALIGGRDSRIDDVARRRHFHG*
Ga0180121_102521111	3300017695	Polar Desert Sand	MEIVLILFFVLVGPLALLAGRDSRIDEVDRRRRFQG
Ga0183260_100018062	3300017787	Polar Desert Sand	MEIAVLLFVLLVGPLALLAGRDSRVDDAARRRRYQG
Ga0183260_100853552	3300017787	Polar Desert Sand	MELVVLAFLLLVGPLALLAGRDSRIDEVDRRRRFRG
Ga0183260_101679962	3300017787	Polar Desert Sand	MEIVLVLFFVLVGPLALLAGRDSRIDEVDRRRRFQG
Ga0183260_108464872	3300017787	Polar Desert Sand	MELVVLAFLLLVGPLALLAGRDSRIDDVDRRRRYGG
Ga0136617_111763122	3300017789	Polar Desert Sand	MEIAVLLFILLVGPLALLAGRDSRVDDASRRRRYQG
Ga0190266_100525243	3300017965	Soil	MEIAVLLFLLLVGPLALLAGRDSRIDERDRRRHYQG
Ga0190266_101298052	3300017965	Soil	MEIALIIFVLLVGPLALFAGRDSRIDDVDRRRHYQG
Ga0190275_107060252	3300018432	Soil	MEIALLLFLLLVGPLALLGGRDSRIDERDSRRRYHG
Ga0190268_101458162	3300018466	Soil	MEIAVVLFLLLVGPLAVLAGRDSRIDEVNRRRSYEG
Ga0190268_103782832	3300018466	Soil	MAIALIIFVLLVGPLALFAGRDSRIDDVDRRRHYQG
Ga0190270_100300043	3300018469	Soil	MEIALLLFLLLVGPLALLGGRDSRIDERDSRRRYRG
Ga0190271_106914862	3300018481	Soil	MEIALIIFVLLIGPLALFAGRDSRIDDVDRRRHYQG
Ga0190271_112263402	3300018481	Soil	MEIAVVLFLLLVGPLALLAGRDSRVDEVNRRRSYEG
Ga0190271_119899552	3300018481	Soil	MEIALIVFLLLVGPLALLAGRDSRIDEKGRHRPYQD
Ga0173481_100012365	3300019356	Soil	MEIALVIFMLVVGPLALIGGRDSRVDDVDRRRHYNG
Ga0173481_101443072	3300019356	Soil	MVPARHNDHMELVLVIFLLVVGPLALLYGRDSRIDDVQRRRDYQG
Ga0173481_101737632	3300019356	Soil	MEIVVVLFLLLVGPLALVFGADSRFDEVARRRGLGR
Ga0173481_105670482	3300019356	Soil	MEIALVLFILLVGPLALLAGRDSRIDDVARRRRELG
Ga0173482_102704202	3300019361	Soil	MELVLVIFLLVVGPLALLYGRDSRIDDVQRRRDYQG
Ga0173482_103518081	3300019361	Soil	YLHSQTMGMEIALVLFILLVGPLALLAGRDSRIDDTARRRRHLG
Ga0247792_10069362	3300022880	Soil	MELAFVIFLLVVGPLAVLAGRDSRIDDVERRRNYQG
Ga0247786_10020282	3300022883	Soil	MELALVIFLLVVGPLAVLVGRDSRIDDVERRRNYQG
Ga0247786_10553822	3300022883	Soil	MEIALVLFVVVVGPLALLAGRDSRIDDEARRRRYLG
Ga0247745_10117093	3300022898	Soil	ARQNDHMELVLVIFLLVVGPLALLYGRDSRIDDVQRRRDYQG
Ga0247790_100423422	3300022915	Soil	MELALVIFLLLVGPLAVLVGRDSRIDDVERRRNYQG
Ga0247790_101367062	3300022915	Soil	MAIAVVLFLLLVGPLALLAGRDSRIDEVNRRRSYEG
Ga0247793_10768191	3300023066	Soil	DNEAMEIALVIFMLVVGPLALIGGRDSRVDDVDRRRHYNG
Ga0247755_10792942	3300023070	Plant Litter	MELVLVIFLLVVGPLALLFGRDSRIDDVERRRNYHG
Ga0247734_11644802	3300023083	Plant Litter	NDHMELVLVIFLLVVGPLALLYGRDSRIDDVQRRRDYQG
Ga0209431_103972802	3300025313	Soil	MELVIALLILLVGPLALLAGRDSRIDDIERRRRFLG
Ga0207697_104965162	3300025315	Corn, Switchgrass And Miscanthus Rhizosphere	MELALVIFLLVVGPLAVLAGRDSRIDDVERRRNYQG
Ga0207656_101016412	3300025321	Corn Rhizosphere	MELAFVIFLLVVGPLALLAGRDSRIDDVERRRTYRG
Ga0210142_10000827	3300025552	Natural And Restored Wetlands	MAIAFLVLILLVGPLALLYGRDSRIDDSARRRRYRG
Ga0210087_10086412	3300025559	Natural And Restored Wetlands	MAIAFLVLILLVGPLSLLYGRDSRIDDSARRRRYRG
Ga0210076_10870322	3300025567	Natural And Restored Wetlands	MEIAVLVFLLVVGPLAVLAGRDSRIDDVDRRRHYQG
Ga0210076_10985982	3300025567	Natural And Restored Wetlands	MEIAIVLFLLLVGPLALFAGRDSRIDDTARRRRHLG
Ga0207682_102316832	3300025893	Miscanthus Rhizosphere	MELAFVIFLLVVGPLALLAGRDSRIDDVERRRTYQG
Ga0207642_101005442	3300025899	Miscanthus Rhizosphere	MELVLLIFLLVVGPLALLSGRDSRIDDVQRRRDYQG
Ga0207642_106100322	3300025899	Miscanthus Rhizosphere	MELAFVIFILVVGPLALLAGRDSRIDDVERRRTYRG
Ga0207710_100535211	3300025900	Switchgrass Rhizosphere	MELAFVIFLLVIGPLALLAGRDSRIDDVERRRTYRG
Ga0207680_104294672	3300025903	Switchgrass Rhizosphere	MELVLLIFLLVVGPLALLYGRDSRIDDVQRRRDYQG
Ga0207647_105212561	3300025904	Corn Rhizosphere	MAIALVLFILLVGPLALLAGRDSRIDDVARRRRELG
Ga0207705_100505225	3300025909	Corn Rhizosphere	FALMVPARHNDHMELVLVIFLLVVGPLALLYGRDSRIDDVQRRRDYQG
Ga0207705_108376831	3300025909	Corn Rhizosphere	SQTMGMEIALVLFILLVGPLALLAGRDSRIDDTARRRRHLG
Ga0207657_109314402	3300025919	Corn Rhizosphere	MGMEIALVLFILLVGPLALLAGRDSRIDDTARRRRHLG
Ga0207652_106470461	3300025921	Corn Rhizosphere	LHSQTMGMEIALVLFILLVGPLALLAGRDSRIDDTARRRRHLG
Ga0207694_105247132	3300025924	Corn Rhizosphere	MAIALLVFVLVIGPLAVLAGCDSRIDDVDRRRRYHG
Ga0207650_105403591	3300025925	Switchgrass Rhizosphere	MGMEIALVLFILLVGPLALLAGRDSRIDDVARRRRELG
Ga0207659_116548382	3300025926	Miscanthus Rhizosphere	MVMEIALVLFILLVGPLALLAGRDSRIDDTARRRRHLG
Ga0207669_101967141	3300025937	Miscanthus Rhizosphere	RSNDSAMAIALIVFVLLVGPLALLAGRDSRIDDVDRRRHYQG
Ga0207704_115427482	3300025938	Miscanthus Rhizosphere	LALIVPARQSRAMELALVIFLLVVGPLAVLAGRDSRIDDVERRRNYQG
Ga0207667_103983382	3300025949	Corn Rhizosphere	MELALVIFLLVVGPLALLAGRDSRIDDVERRRTYRG
Ga0210069_10073002	3300025958	Natural And Restored Wetlands	MEIVLLLFVLLIGPLALIGGRDSRIDEASRRRRYLG
Ga0210116_10537492	3300025959	Natural And Restored Wetlands	MAIALLIFLLVVGPLALLAGQDSRIDDVDRRRRDSQA
Ga0207651_112448721	3300025960	Switchgrass Rhizosphere	ARQNAGMAIALLVFVLVIGPLAVLAGCDSRIDDVDRRRRYHG
Ga0207712_107605452	3300025961	Switchgrass Rhizosphere	MEIALVLFVVVIGPLALLAGRDSRIDDEARRRRYLG
Ga0207703_101240093	3300026035	Switchgrass Rhizosphere	ELAFVIFLLVIGPLALLAGRDSRIDDVERRRTYRG
Ga0207703_113059222	3300026035	Switchgrass Rhizosphere	AMEIAIVLFIVLVGPLALLYGRDSRIEDTARRRRHQG
Ga0207639_104387631	3300026041	Corn Rhizosphere	LHSQTMVMEIALVLFILLVGPLALLAGRDSRIDDTARRRRHLG
Ga0208911_10076992	3300026051	Natural And Restored Wetlands	AMEIAVIVFLLVVGPLALLAGRDSRVDDVDRRRHYQG
Ga0207702_104590881	3300026078	Corn Rhizosphere	TGMEIAIVLFILLVGPLALLAGRDSRIDDTARRRRHLG
Ga0207641_105700712	3300026088	Switchgrass Rhizosphere	MAIALIVFVVVIGPLAVLAVCDSRIDDVDRRRRYHG
Ga0207676_108036701	3300026095	Switchgrass Rhizosphere	VMAIALVLFILLVGPLALLAGRDSRIDDVARRRRELG
Ga0207674_108278112	3300026116	Corn Rhizosphere	MEIALVLFVVVVGPLALLAGRDSRIDDEARRRRYL
Ga0207674_119359041	3300026116	Corn Rhizosphere	EAMEIALVIFMLVVGPLALIGGRDSRVDDVDRRRHYNG
Ga0207675_1016375382	3300026118	Switchgrass Rhizosphere	SAMEIALIVFVLLVGPLALFAGRDSRIDDVDRRRHYQG
Ga0209077_11382493	3300027675	Freshwater Sediment	MEIALLLFLLVVGPLALLGGRDSRIDEKDRRRTYLG
Ga0209486_101235542	3300027886	Agricultural Soil	MEIAVIVFLLLVGPLALLAGRDSRIDDRDRRRHYRG
Ga0209068_102434481	3300027894	Watersheds	VLIVPARHTVVMAFALIIFIVLVGLGAVLGGRDSRIDDVARRRRYLG
Ga0268266_108573432	3300028379	Switchgrass Rhizosphere	MAIALIVFVVVIGPLAVLAGCDSRIDDVDRRRRYHG
Ga0268265_122661002	3300028380	Switchgrass Rhizosphere	SETAPMEIALVLFVVVIGPLALLAGRDSRIDDEARRRRYLG
Ga0247828_102212722	3300028587	Soil	MELAFVIFLLVFGPLALLAGRDSRIDDVERRRTYQG
Ga0247828_104918922	3300028587	Soil	MAMEIAIVLFIVLVGPLALLYGRDSRIDDTARRRRHQG
Ga0247828_109015191	3300028587	Soil	MEIAIVLFILLVGPLALLAGRDSRIDDVARRRRELG
Ga0247823_106695532	3300028590	Soil	ARQSTGMELAFVIFLLVVGPLALLAGRDSRIDDVERRRTYRG
Ga0247823_111093572	3300028590	Soil	MEIAVVLFLLLVGPLALLAGRDSRIDEVNRRRSYEG
Ga0247822_118322091	3300028592	Soil	MEIAVVLFLLLVGPLALLAGRDSRIDEVNRRRSYE
Ga0307503_101529242	3300028802	Soil	MAIAVLVFVLVIGPLAVLAGCDSRIDDVDRRRRYHG
Ga0247825_106080562	3300028812	Soil	MAMEIAIVVFIVLVGPLALLYGRDSRIDDTARRRRHQG
Ga0247825_106136092	3300028812	Soil	MEIAVVLFILLVGPLALLAGRDSRIDEVRRRRSYEG
Ga0247825_108324983	3300028812	Soil	MEIAVVLFLLLVGPLALLAGRDSRIDEVSRRRSYEG
Ga0247826_100892453	3300030336	Soil	MEIAVVLFILLVGPLALLAGRDSRIDEVSRRRSYEE
Ga0247826_104798301	3300030336	Soil	LLSHTGDMEIAIVLFILLVGPLALLAGRDSRIDDVARRRRELG
Ga0310887_108369663	3300031547	Soil	MDLELIIFLLLVGPLALFAGRDSRIDDVDRRRHYQG
Ga0310886_107249991	3300031562	Soil	MTIALIVFVLLVGPLALFAGRDSRIDDVDRRRHYQG
Ga0307413_106794852	3300031824	Rhizosphere	MEIAVLVFVLLVGPLALLGGRDSRIDDVDRRRRYQGSAPR
Ga0310892_105560592	3300031858	Soil	PRLVLIVPAQQNAGMAIALIVFVVVIGPLAVLAGCDSRIDDVDRRRRYHG
Ga0310892_106440183	3300031858	Soil	MAIALIVFVLLVGPLALLAGRDSRIDDVDRRRHYQG
Ga0307406_110895392	3300031901	Rhizosphere	MEIALVLFILLVGPLALLAGRDSRIDDVERRRRELG
Ga0308175_1009198841	3300031938	Soil	MELVLVIFLVLVGPLALLYGSDSRIDDVERRRTYRG
Ga0310884_101435722	3300031944	Soil	MEVAFVIFLLVVGPLALLAGRDSRIDDVERRRTYQG
Ga0310890_107376422	3300032075	Soil	MEIAVVLFILLVGPLALLAGRDSRIDEVNRRRSYEG
Ga0310895_102452212	3300032122	Soil	RLVLIVPARQSTGMELAFVIFLLVVGPLALLAGRDSRIDDVERRRTYRG
Ga0247829_100919913	3300033550	Soil	LIVPGGHTMAMEIAIVLFIVLVGPLALLYGRDSRIDDTARRRRHQG
Ga0247829_109053412	3300033550	Soil	MEIALIVFVLLVGPLALFAGRDSRIDDVDRRRHYQG
Ga0247829_111732932	3300033550	Soil	MEIAVVLFLLLIGPLALLAGRDSRIDEVNRRRSYEG

Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

Metagenome / Metatranscriptome Family F028504

Overview

Multiple Sequence Alignments

Structure & Topology

Predicted Secondary Structure and Topology

Predicted 3D Structure

Low Quality Model:

Gene Neighborhood

Neighboring Pfam domains

Neighboring Clusters of Orthologous Genes (COGs)

Phylogeny

NCBI Taxonomy

Associated Scaffolds

Environmental Properties

Associated Habitat Types

Associated Samples

Family Sequences