| Basic Information | |
|---|---|
| Family ID | F028475 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 191 |
| Average Sequence Length | 43 residues |
| Representative Sequence | AVSHIRFPLTFSDQLYNLRSHIDIVRRKITSHVNAPGRVAAE |
| Number of Associated Samples | 108 |
| Number of Associated Scaffolds | 191 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 1.05 % |
| % of genes near scaffold ends (potentially truncated) | 98.43 % |
| % of genes from short scaffolds (< 2000 bps) | 91.10 % |
| Associated GOLD sequencing projects | 97 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.47 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (91.099 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (34.031 % of family members) |
| Environment Ontology (ENVO) | Unclassified (60.733 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (61.780 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 42.86% β-sheet: 0.00% Coil/Unstructured: 57.14% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.47 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 191 Family Scaffolds |
|---|---|---|
| PF04392 | ABC_sub_bind | 11.52 |
| PF12680 | SnoaL_2 | 3.14 |
| PF14067 | LssY_C | 2.09 |
| PF00211 | Guanylate_cyc | 2.09 |
| PF13458 | Peripla_BP_6 | 1.57 |
| PF00589 | Phage_integrase | 1.57 |
| PF13560 | HTH_31 | 1.57 |
| PF13751 | DDE_Tnp_1_6 | 1.57 |
| PF07690 | MFS_1 | 1.05 |
| PF00239 | Resolvase | 1.05 |
| PF00313 | CSD | 1.05 |
| PF02615 | Ldh_2 | 1.05 |
| PF00149 | Metallophos | 1.05 |
| PF01135 | PCMT | 0.52 |
| PF00226 | DnaJ | 0.52 |
| PF13185 | GAF_2 | 0.52 |
| PF06577 | EipA | 0.52 |
| PF00296 | Bac_luciferase | 0.52 |
| PF03358 | FMN_red | 0.52 |
| PF04828 | GFA | 0.52 |
| PF00999 | Na_H_Exchanger | 0.52 |
| PF09424 | YqeY | 0.52 |
| PF13531 | SBP_bac_11 | 0.52 |
| PF05231 | MASE1 | 0.52 |
| PF01972 | SDH_sah | 0.52 |
| PF12697 | Abhydrolase_6 | 0.52 |
| PF16864 | Dimerisation2 | 0.52 |
| PF03466 | LysR_substrate | 0.52 |
| PF00536 | SAM_1 | 0.52 |
| PF13419 | HAD_2 | 0.52 |
| PF13282 | DUF4070 | 0.52 |
| PF13817 | DDE_Tnp_IS66_C | 0.52 |
| PF00300 | His_Phos_1 | 0.52 |
| PF00561 | Abhydrolase_1 | 0.52 |
| PF06411 | HdeA | 0.52 |
| PF03401 | TctC | 0.52 |
| PF08238 | Sel1 | 0.52 |
| PF03976 | PPK2 | 0.52 |
| PF02211 | NHase_beta | 0.52 |
| PF00497 | SBP_bac_3 | 0.52 |
| PF05532 | CsbD | 0.52 |
| PF13426 | PAS_9 | 0.52 |
| PF03551 | PadR | 0.52 |
| PF14322 | SusD-like_3 | 0.52 |
| PF00078 | RVT_1 | 0.52 |
| PF06041 | DUF924 | 0.52 |
| PF00107 | ADH_zinc_N | 0.52 |
| PF05598 | DUF772 | 0.52 |
| PF13586 | DDE_Tnp_1_2 | 0.52 |
| PF00027 | cNMP_binding | 0.52 |
| PF16868 | NMT1_3 | 0.52 |
| PF14559 | TPR_19 | 0.52 |
| PF01717 | Meth_synt_2 | 0.52 |
| PF01740 | STAS | 0.52 |
| PF02630 | SCO1-SenC | 0.52 |
| COG ID | Name | Functional Category | % Frequency in 191 Family Scaffolds |
|---|---|---|---|
| COG2984 | ABC-type uncharacterized transport system, periplasmic component | General function prediction only [R] | 11.52 |
| COG2114 | Adenylate cyclase, class 3 | Signal transduction mechanisms [T] | 2.09 |
| COG0616 | Periplasmic serine protease, ClpP class | Posttranslational modification, protein turnover, chaperones [O] | 1.05 |
| COG2452 | Predicted site-specific integrase-resolvase | Mobilome: prophages, transposons [X] | 1.05 |
| COG2055 | Malate/lactate/ureidoglycolate dehydrogenase, LDH2 family | Energy production and conversion [C] | 1.05 |
| COG1961 | Site-specific DNA recombinase SpoIVCA/DNA invertase PinE | Replication, recombination and repair [L] | 1.05 |
| COG2519 | tRNA A58 N-methylase Trm61 | Translation, ribosomal structure and biogenesis [J] | 0.52 |
| COG2326 | Polyphosphate kinase 2, PPK2 family | Energy production and conversion [C] | 0.52 |
| COG3004 | Na+/H+ antiporter NhaA | Energy production and conversion [C] | 0.52 |
| COG3181 | Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctC | Energy production and conversion [C] | 0.52 |
| COG3237 | Uncharacterized conserved protein YjbJ, UPF0337 family | Function unknown [S] | 0.52 |
| COG3263 | NhaP-type Na+/H+ and K+/H+ antiporter with C-terminal TrkAC and CorC domains | Energy production and conversion [C] | 0.52 |
| COG3447 | Integral membrane sensor domain MASE1 | Signal transduction mechanisms [T] | 0.52 |
| COG3791 | Uncharacterized conserved protein | Function unknown [S] | 0.52 |
| COG3803 | Uncharacterized conserved protein, DUF924 family | Function unknown [S] | 0.52 |
| COG3851 | Signal transduction histidine kinase UhpB, glucose-6-phosphate specific | Signal transduction mechanisms [T] | 0.52 |
| COG4122 | tRNA 5-hydroxyU34 O-methylase TrmR/YrrM | Translation, ribosomal structure and biogenesis [J] | 0.52 |
| COG4651 | Predicted Kef-type K+ transport protein, K+/H+ antiporter domain | Inorganic ion transport and metabolism [P] | 0.52 |
| COG2518 | Protein-L-isoaspartate O-methyltransferase | Posttranslational modification, protein turnover, chaperones [O] | 0.52 |
| COG0025 | NhaP-type Na+/H+ or K+/H+ antiporter | Inorganic ion transport and metabolism [P] | 0.52 |
| COG2226 | Ubiquinone/menaquinone biosynthesis C-methylase UbiE/MenG | Coenzyme transport and metabolism [H] | 0.52 |
| COG2141 | Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase) | Coenzyme transport and metabolism [H] | 0.52 |
| COG1999 | Cytochrome oxidase Cu insertion factor, SCO1/SenC/PrrC family | Posttranslational modification, protein turnover, chaperones [O] | 0.52 |
| COG1846 | DNA-binding transcriptional regulator, MarR family | Transcription [K] | 0.52 |
| COG1733 | DNA-binding transcriptional regulator, HxlR family | Transcription [K] | 0.52 |
| COG1695 | DNA-binding transcriptional regulator, PadR family | Transcription [K] | 0.52 |
| COG1225 | Peroxiredoxin | Posttranslational modification, protein turnover, chaperones [O] | 0.52 |
| COG0642 | Signal transduction histidine kinase | Signal transduction mechanisms [T] | 0.52 |
| COG0620 | Methionine synthase II (cobalamin-independent) | Amino acid transport and metabolism [E] | 0.52 |
| COG0475 | Kef-type K+ transport system, membrane component KefB | Inorganic ion transport and metabolism [P] | 0.52 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 91.10 % |
| Unclassified | root | N/A | 8.90 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000597|AF_2010_repII_A1DRAFT_10055390 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1023 | Open in IMG/M |
| 3300005093|Ga0062594_101933624 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 627 | Open in IMG/M |
| 3300005332|Ga0066388_101889717 | All Organisms → cellular organisms → Bacteria | 1065 | Open in IMG/M |
| 3300005332|Ga0066388_108231475 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 520 | Open in IMG/M |
| 3300005355|Ga0070671_101437147 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 610 | Open in IMG/M |
| 3300005363|Ga0008090_14434099 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. ARR65 | 585 | Open in IMG/M |
| 3300005434|Ga0070709_11459713 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 555 | Open in IMG/M |
| 3300005438|Ga0070701_10637781 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 710 | Open in IMG/M |
| 3300005467|Ga0070706_100931666 | All Organisms → cellular organisms → Bacteria | 802 | Open in IMG/M |
| 3300005529|Ga0070741_10009380 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 19054 | Open in IMG/M |
| 3300005713|Ga0066905_100195355 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1507 | Open in IMG/M |
| 3300005713|Ga0066905_101352036 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 643 | Open in IMG/M |
| 3300005764|Ga0066903_100188687 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Alcaligenaceae | 3057 | Open in IMG/M |
| 3300005764|Ga0066903_102426917 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 1014 | Open in IMG/M |
| 3300005764|Ga0066903_104234943 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 767 | Open in IMG/M |
| 3300005764|Ga0066903_106250022 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 622 | Open in IMG/M |
| 3300005764|Ga0066903_107007926 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 584 | Open in IMG/M |
| 3300005764|Ga0066903_107207958 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 575 | Open in IMG/M |
| 3300005764|Ga0066903_108182119 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 535 | Open in IMG/M |
| 3300005764|Ga0066903_108365003 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 528 | Open in IMG/M |
| 3300005764|Ga0066903_109151063 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 500 | Open in IMG/M |
| 3300006086|Ga0075019_10433105 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 808 | Open in IMG/M |
| 3300006755|Ga0079222_10403078 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 953 | Open in IMG/M |
| 3300006806|Ga0079220_11155555 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 633 | Open in IMG/M |
| 3300006914|Ga0075436_100584830 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 821 | Open in IMG/M |
| 3300006954|Ga0079219_10277318 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 1019 | Open in IMG/M |
| 3300009092|Ga0105250_10418907 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 597 | Open in IMG/M |
| 3300009148|Ga0105243_11657044 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 668 | Open in IMG/M |
| 3300010043|Ga0126380_10500541 | All Organisms → cellular organisms → Bacteria | 932 | Open in IMG/M |
| 3300010048|Ga0126373_10467107 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1299 | Open in IMG/M |
| 3300010048|Ga0126373_13162143 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 513 | Open in IMG/M |
| 3300010358|Ga0126370_10312307 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1252 | Open in IMG/M |
| 3300010358|Ga0126370_10383266 | Not Available | 1149 | Open in IMG/M |
| 3300010358|Ga0126370_10587402 | All Organisms → cellular organisms → Bacteria | 959 | Open in IMG/M |
| 3300010358|Ga0126370_11996998 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 567 | Open in IMG/M |
| 3300010360|Ga0126372_13023291 | Not Available | 522 | Open in IMG/M |
| 3300010361|Ga0126378_10273907 | Not Available | 1786 | Open in IMG/M |
| 3300010361|Ga0126378_10533766 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1288 | Open in IMG/M |
| 3300010361|Ga0126378_11896047 | All Organisms → cellular organisms → Bacteria | 678 | Open in IMG/M |
| 3300010366|Ga0126379_11187405 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 869 | Open in IMG/M |
| 3300010376|Ga0126381_101617031 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 936 | Open in IMG/M |
| 3300010376|Ga0126381_103279837 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 639 | Open in IMG/M |
| 3300012948|Ga0126375_10182215 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1360 | Open in IMG/M |
| 3300012948|Ga0126375_10603966 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 838 | Open in IMG/M |
| 3300012948|Ga0126375_11541176 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 570 | Open in IMG/M |
| 3300012957|Ga0164303_10116153 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1356 | Open in IMG/M |
| 3300012971|Ga0126369_12423837 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 610 | Open in IMG/M |
| 3300012971|Ga0126369_13111559 | Not Available | 543 | Open in IMG/M |
| 3300012971|Ga0126369_13444709 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 518 | Open in IMG/M |
| 3300012988|Ga0164306_11122429 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 655 | Open in IMG/M |
| 3300015371|Ga0132258_11190732 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1926 | Open in IMG/M |
| 3300015371|Ga0132258_13162513 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1137 | Open in IMG/M |
| 3300015373|Ga0132257_100825891 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1158 | Open in IMG/M |
| 3300015373|Ga0132257_102244190 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 707 | Open in IMG/M |
| 3300016270|Ga0182036_10283430 | Not Available | 1253 | Open in IMG/M |
| 3300016294|Ga0182041_10297565 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1336 | Open in IMG/M |
| 3300016294|Ga0182041_10458664 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1097 | Open in IMG/M |
| 3300016294|Ga0182041_10539174 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1017 | Open in IMG/M |
| 3300016294|Ga0182041_10829959 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 827 | Open in IMG/M |
| 3300016294|Ga0182041_10838749 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 823 | Open in IMG/M |
| 3300016294|Ga0182041_10866235 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 810 | Open in IMG/M |
| 3300016294|Ga0182041_11076944 | All Organisms → cellular organisms → Bacteria | 729 | Open in IMG/M |
| 3300016294|Ga0182041_11211435 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 689 | Open in IMG/M |
| 3300016294|Ga0182041_11432624 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 635 | Open in IMG/M |
| 3300016294|Ga0182041_11833014 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 563 | Open in IMG/M |
| 3300016319|Ga0182033_10865907 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 799 | Open in IMG/M |
| 3300016319|Ga0182033_11259054 | All Organisms → cellular organisms → Bacteria | 664 | Open in IMG/M |
| 3300016341|Ga0182035_10956804 | All Organisms → cellular organisms → Bacteria | 757 | Open in IMG/M |
| 3300016341|Ga0182035_10960289 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 756 | Open in IMG/M |
| 3300016341|Ga0182035_11030455 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 730 | Open in IMG/M |
| 3300016341|Ga0182035_11415191 | All Organisms → cellular organisms → Bacteria | 624 | Open in IMG/M |
| 3300016341|Ga0182035_11437573 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 620 | Open in IMG/M |
| 3300016357|Ga0182032_10225567 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1442 | Open in IMG/M |
| 3300016357|Ga0182032_10491122 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1008 | Open in IMG/M |
| 3300016357|Ga0182032_10844913 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 776 | Open in IMG/M |
| 3300016371|Ga0182034_10003347 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 8295 | Open in IMG/M |
| 3300016371|Ga0182034_10024031 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 3695 | Open in IMG/M |
| 3300016371|Ga0182034_10318325 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1253 | Open in IMG/M |
| 3300016387|Ga0182040_10619936 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 877 | Open in IMG/M |
| 3300016387|Ga0182040_11422421 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 588 | Open in IMG/M |
| 3300016404|Ga0182037_11270280 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 648 | Open in IMG/M |
| 3300016422|Ga0182039_10719525 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 881 | Open in IMG/M |
| 3300016422|Ga0182039_10962826 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 764 | Open in IMG/M |
| 3300016422|Ga0182039_11389421 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 638 | Open in IMG/M |
| 3300016422|Ga0182039_11648829 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 586 | Open in IMG/M |
| 3300016422|Ga0182039_12261042 | Not Available | 502 | Open in IMG/M |
| 3300016445|Ga0182038_11231086 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 668 | Open in IMG/M |
| 3300016445|Ga0182038_11958682 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. UFLA 03-321 | 530 | Open in IMG/M |
| 3300017947|Ga0187785_10094200 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1189 | Open in IMG/M |
| 3300017970|Ga0187783_10068842 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 2607 | Open in IMG/M |
| 3300018029|Ga0187787_10006863 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 2746 | Open in IMG/M |
| 3300018090|Ga0187770_10908424 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 707 | Open in IMG/M |
| 3300018468|Ga0066662_10414441 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1190 | Open in IMG/M |
| 3300021479|Ga0210410_11745667 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 516 | Open in IMG/M |
| 3300021560|Ga0126371_10039847 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 4447 | Open in IMG/M |
| 3300021560|Ga0126371_11971947 | All Organisms → cellular organisms → Bacteria | 702 | Open in IMG/M |
| 3300025916|Ga0207663_10221781 | Not Available | 1376 | Open in IMG/M |
| 3300025928|Ga0207700_11960682 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 512 | Open in IMG/M |
| 3300025933|Ga0207706_10439912 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Sphingobacteriia → Sphingobacteriales → Sphingobacteriaceae → Pedobacter → Pedobacter westerhofensis | 1129 | Open in IMG/M |
| 3300025939|Ga0207665_11333275 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 572 | Open in IMG/M |
| 3300026809|Ga0207820_106458 | All Organisms → cellular organisms → Bacteria | 960 | Open in IMG/M |
| 3300026953|Ga0207835_1019927 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 861 | Open in IMG/M |
| 3300027775|Ga0209177_10075163 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1019 | Open in IMG/M |
| 3300031231|Ga0170824_118473728 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 788 | Open in IMG/M |
| 3300031546|Ga0318538_10188994 | Not Available | 1098 | Open in IMG/M |
| 3300031546|Ga0318538_10329141 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. UFLA 03-321 | 824 | Open in IMG/M |
| 3300031546|Ga0318538_10649602 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 572 | Open in IMG/M |
| 3300031561|Ga0318528_10607517 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 586 | Open in IMG/M |
| 3300031573|Ga0310915_10076207 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 2220 | Open in IMG/M |
| 3300031573|Ga0310915_10914778 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 614 | Open in IMG/M |
| 3300031681|Ga0318572_10529460 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 702 | Open in IMG/M |
| 3300031682|Ga0318560_10086446 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1605 | Open in IMG/M |
| 3300031719|Ga0306917_10180103 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1588 | Open in IMG/M |
| 3300031719|Ga0306917_10421399 | Not Available | 1044 | Open in IMG/M |
| 3300031719|Ga0306917_10676069 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 811 | Open in IMG/M |
| 3300031719|Ga0306917_11177505 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. UFLA 03-321 | 595 | Open in IMG/M |
| 3300031719|Ga0306917_11469052 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 525 | Open in IMG/M |
| 3300031744|Ga0306918_10137304 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1792 | Open in IMG/M |
| 3300031747|Ga0318502_10403073 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 813 | Open in IMG/M |
| 3300031754|Ga0307475_10194042 | All Organisms → cellular organisms → Bacteria | 1622 | Open in IMG/M |
| 3300031765|Ga0318554_10334637 | All Organisms → cellular organisms → Bacteria | 861 | Open in IMG/M |
| 3300031770|Ga0318521_10848919 | All Organisms → cellular organisms → Bacteria | 557 | Open in IMG/M |
| 3300031771|Ga0318546_11276572 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. NAS80.1 | 516 | Open in IMG/M |
| 3300031777|Ga0318543_10215061 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 854 | Open in IMG/M |
| 3300031795|Ga0318557_10409535 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 623 | Open in IMG/M |
| 3300031798|Ga0318523_10097272 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1441 | Open in IMG/M |
| 3300031819|Ga0318568_10358890 | Not Available | 907 | Open in IMG/M |
| 3300031831|Ga0318564_10538290 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 506 | Open in IMG/M |
| 3300031833|Ga0310917_11085038 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 535 | Open in IMG/M |
| 3300031835|Ga0318517_10197419 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 906 | Open in IMG/M |
| 3300031845|Ga0318511_10284901 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 745 | Open in IMG/M |
| 3300031846|Ga0318512_10008690 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 3826 | Open in IMG/M |
| 3300031879|Ga0306919_10324563 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1172 | Open in IMG/M |
| 3300031879|Ga0306919_11062740 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 618 | Open in IMG/M |
| 3300031890|Ga0306925_11033921 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 835 | Open in IMG/M |
| 3300031890|Ga0306925_11220819 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 752 | Open in IMG/M |
| 3300031890|Ga0306925_11933512 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 559 | Open in IMG/M |
| 3300031896|Ga0318551_10007031 | Not Available | 4650 | Open in IMG/M |
| 3300031897|Ga0318520_10530285 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 729 | Open in IMG/M |
| 3300031910|Ga0306923_10019338 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 7170 | Open in IMG/M |
| 3300031912|Ga0306921_11120091 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 881 | Open in IMG/M |
| 3300031912|Ga0306921_11545327 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 723 | Open in IMG/M |
| 3300031941|Ga0310912_10209336 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1492 | Open in IMG/M |
| 3300031941|Ga0310912_11466468 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 514 | Open in IMG/M |
| 3300031944|Ga0310884_10075955 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1585 | Open in IMG/M |
| 3300031945|Ga0310913_11313501 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. ARR65 | 501 | Open in IMG/M |
| 3300031946|Ga0310910_10149978 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1782 | Open in IMG/M |
| 3300031946|Ga0310910_10438833 | All Organisms → cellular organisms → Bacteria | 1035 | Open in IMG/M |
| 3300031947|Ga0310909_10003889 | All Organisms → cellular organisms → Bacteria | 9476 | Open in IMG/M |
| 3300031947|Ga0310909_10295265 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Brucellaceae | 1357 | Open in IMG/M |
| 3300031947|Ga0310909_10393015 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1164 | Open in IMG/M |
| 3300031947|Ga0310909_10578683 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 939 | Open in IMG/M |
| 3300031954|Ga0306926_10201517 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2469 | Open in IMG/M |
| 3300031954|Ga0306926_10730109 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1199 | Open in IMG/M |
| 3300031954|Ga0306926_11303408 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 848 | Open in IMG/M |
| 3300031959|Ga0318530_10306394 | Not Available | 656 | Open in IMG/M |
| 3300031981|Ga0318531_10515380 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 542 | Open in IMG/M |
| 3300032001|Ga0306922_10462177 | All Organisms → cellular organisms → Bacteria | 1355 | Open in IMG/M |
| 3300032025|Ga0318507_10048245 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1663 | Open in IMG/M |
| 3300032035|Ga0310911_10054568 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 2091 | Open in IMG/M |
| 3300032035|Ga0310911_10375771 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 821 | Open in IMG/M |
| 3300032035|Ga0310911_10426728 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 767 | Open in IMG/M |
| 3300032035|Ga0310911_10448654 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 747 | Open in IMG/M |
| 3300032041|Ga0318549_10068187 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1505 | Open in IMG/M |
| 3300032043|Ga0318556_10677491 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 537 | Open in IMG/M |
| 3300032051|Ga0318532_10239034 | Not Available | 645 | Open in IMG/M |
| 3300032054|Ga0318570_10421044 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 609 | Open in IMG/M |
| 3300032063|Ga0318504_10482317 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 593 | Open in IMG/M |
| 3300032067|Ga0318524_10062691 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1793 | Open in IMG/M |
| 3300032076|Ga0306924_10664529 | Not Available | 1173 | Open in IMG/M |
| 3300032076|Ga0306924_10752423 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1090 | Open in IMG/M |
| 3300032076|Ga0306924_11291333 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 784 | Open in IMG/M |
| 3300032076|Ga0306924_11430520 | Not Available | 736 | Open in IMG/M |
| 3300032076|Ga0306924_11452240 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 729 | Open in IMG/M |
| 3300032076|Ga0306924_11814559 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. ARR65 | 635 | Open in IMG/M |
| 3300032076|Ga0306924_12207630 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 561 | Open in IMG/M |
| 3300032076|Ga0306924_12322226 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 543 | Open in IMG/M |
| 3300032091|Ga0318577_10091489 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1416 | Open in IMG/M |
| 3300032094|Ga0318540_10064168 | Not Available | 1675 | Open in IMG/M |
| 3300032205|Ga0307472_101232428 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 716 | Open in IMG/M |
| 3300032261|Ga0306920_100172825 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3221 | Open in IMG/M |
| 3300032261|Ga0306920_100538951 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1730 | Open in IMG/M |
| 3300032261|Ga0306920_101549610 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 944 | Open in IMG/M |
| 3300032261|Ga0306920_103001379 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Caballeronia → Caballeronia mineralivorans → Caballeronia mineralivorans PML1(12) | 637 | Open in IMG/M |
| 3300032261|Ga0306920_104363890 | All Organisms → cellular organisms → Bacteria | 507 | Open in IMG/M |
| 3300032770|Ga0335085_10043129 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462 | 6165 | Open in IMG/M |
| 3300032897|Ga0335071_10200804 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1947 | Open in IMG/M |
| 3300033289|Ga0310914_10522211 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1073 | Open in IMG/M |
| 3300033289|Ga0310914_10872647 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 799 | Open in IMG/M |
| 3300033289|Ga0310914_11350267 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 615 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 34.03% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 27.23% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 11.52% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 7.85% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.14% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 2.09% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 2.09% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 2.09% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.05% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.05% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.05% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.05% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.52% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.52% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.52% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.52% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.52% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.52% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.52% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.52% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.52% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.52% |
| Tropical Rainforest Soil | Environmental → Terrestrial → Soil → Unclassified → Tropical Rainforest → Tropical Rainforest Soil | 0.52% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000597 | Forest soil microbial communities from Amazon forest - 2010 replicate II A1 | Environmental | Open in IMG/M |
| 3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005363 | Tropical rainforest soil microbial communities from the Amazon Forest, Brazil, analyzing deforestation - Metatranscriptome F II A100 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
| 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Environmental | Open in IMG/M |
| 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
| 3300005529 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1 | Environmental | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300006086 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 | Environmental | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
| 3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
| 3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
| 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300012988 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MG | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
| 3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
| 3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
| 3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
| 3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
| 3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
| 3300017947 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_4_20_MG | Environmental | Open in IMG/M |
| 3300017970 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300018029 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_BV01_MP06_20_MG | Environmental | Open in IMG/M |
| 3300018090 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026809 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 47 (SPAdes) | Environmental | Open in IMG/M |
| 3300026953 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 8 (SPAdes) | Environmental | Open in IMG/M |
| 3300027775 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control (SPAdes) | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031546 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23 | Environmental | Open in IMG/M |
| 3300031561 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26 | Environmental | Open in IMG/M |
| 3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
| 3300031681 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20 | Environmental | Open in IMG/M |
| 3300031682 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f22 | Environmental | Open in IMG/M |
| 3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
| 3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
| 3300031747 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22 | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031765 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22 | Environmental | Open in IMG/M |
| 3300031770 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17 | Environmental | Open in IMG/M |
| 3300031771 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19 | Environmental | Open in IMG/M |
| 3300031777 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f24 | Environmental | Open in IMG/M |
| 3300031795 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f19 | Environmental | Open in IMG/M |
| 3300031798 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f19 | Environmental | Open in IMG/M |
| 3300031819 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f21 | Environmental | Open in IMG/M |
| 3300031831 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f20 | Environmental | Open in IMG/M |
| 3300031833 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178 | Environmental | Open in IMG/M |
| 3300031835 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f21 | Environmental | Open in IMG/M |
| 3300031845 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f18 | Environmental | Open in IMG/M |
| 3300031846 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f19 | Environmental | Open in IMG/M |
| 3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031896 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f19 | Environmental | Open in IMG/M |
| 3300031897 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16 | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
| 3300031944 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D1 | Environmental | Open in IMG/M |
| 3300031945 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082 | Environmental | Open in IMG/M |
| 3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
| 3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300031959 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f24 | Environmental | Open in IMG/M |
| 3300031981 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f25 | Environmental | Open in IMG/M |
| 3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
| 3300032025 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f20 | Environmental | Open in IMG/M |
| 3300032035 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF170 | Environmental | Open in IMG/M |
| 3300032041 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f22 | Environmental | Open in IMG/M |
| 3300032043 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f24 | Environmental | Open in IMG/M |
| 3300032051 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f26 | Environmental | Open in IMG/M |
| 3300032054 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f23 | Environmental | Open in IMG/M |
| 3300032063 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f17 | Environmental | Open in IMG/M |
| 3300032067 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f22 | Environmental | Open in IMG/M |
| 3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
| 3300032091 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f25 | Environmental | Open in IMG/M |
| 3300032094 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f25 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
| 3300032897 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.5 | Environmental | Open in IMG/M |
| 3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| AF_2010_repII_A1DRAFT_100553901 | 3300000597 | Forest Soil | DRIEDALSHIRFPLAFSDQVYNLRSHIEIVRRKIVTRAHALARVPAE* |
| Ga0062594_1019336242 | 3300005093 | Soil | VSHIRFPLTFSDQLYNLRSHIDIVRRKITSQTNAPGRVAAE* |
| Ga0066388_1018897173 | 3300005332 | Tropical Forest Soil | IEDAVSHISFPLTFSDQLYNLRSHIEIVRRKISSHENAPGRVAAE* |
| Ga0066388_1082314752 | 3300005332 | Tropical Forest Soil | VSHIQFPLTFSDQVYNLRSHIDIVRHKIASLGKAPGADSG* |
| Ga0070671_1014371471 | 3300005355 | Switchgrass Rhizosphere | DAVSHIRFPLAFSDQVYNLRSHIEIVGRKIVSRTQTLGRAPAE* |
| Ga0008090_144340991 | 3300005363 | Tropical Rainforest Soil | SIEEALSKISFPLTFSDQVYNLRSHIDFVRRKIASRLRYSRQIAAE* |
| Ga0070709_114597132 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | RIEDAVSHIRFPLAFSDQVYNLRSHIEIVRRKIVARTHALGRAPAE* |
| Ga0070701_106377811 | 3300005438 | Corn, Switchgrass And Miscanthus Rhizosphere | SHIRFPLAFSDQVYNLRSHIEIVRRKIISRTQTLGRAPAE* |
| Ga0070706_1009316662 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | QTEIERIEDAVSHIQFPLTFSDQVYNLRSHIDIVRQKIASHVNAPGADSG* |
| Ga0070741_100093803 | 3300005529 | Surface Soil | VSRIRFPLTFTDQLYELRSHIDIVRRRIAARDNAAGRIAAE* |
| Ga0066905_1001953551 | 3300005713 | Tropical Forest Soil | IERIEEAVSHIRFPLTFSDQLYNLRSHIDIVRRKITSHVNAPGRVAAE* |
| Ga0066905_1013520362 | 3300005713 | Tropical Forest Soil | RIEEAVSHIRFPLTFSDQLYNLRSHIDIVRRKISSNVNAPGRLAAE* |
| Ga0066903_1001886875 | 3300005764 | Tropical Forest Soil | DAVSHIRFPLTFTDQLYNLRSHIDIVRRKIASRANTPGSMAAE* |
| Ga0066903_1024269173 | 3300005764 | Tropical Forest Soil | IEHDLSKIHFPLTFSDQVYNLRHHIDLVRRKIASRLGSLGRVAA* |
| Ga0066903_1042349432 | 3300005764 | Tropical Forest Soil | SFPLTFSDQLYNLRSHIEIVRRKIAAHGNAPGRVAAE* |
| Ga0066903_1062500223 | 3300005764 | Tropical Forest Soil | RIEDAVSHIHFPLTFSDQLYNLRSHIEIVRRKITSQGNAPGRVAAE* |
| Ga0066903_1070079262 | 3300005764 | Tropical Forest Soil | AVSHIRFPLSFTDQLYNLRSHIDIVRRKIASRANAPGRMAAE* |
| Ga0066903_1072079582 | 3300005764 | Tropical Forest Soil | PLTFSDQLYNLRSHIEIVRRKISSHENAPGRVAAE* |
| Ga0066903_1081821191 | 3300005764 | Tropical Forest Soil | SHISFPLTFSDQLYNLRSHIEIVRRKIASHGNAPGRVAAE* |
| Ga0066903_1083650031 | 3300005764 | Tropical Forest Soil | AVSHIRFPLTFSDQLYNLRSHIDIVRRKITSHVNAPGRVAAE* |
| Ga0066903_1091510632 | 3300005764 | Tropical Forest Soil | VSHISFPLTFSDQLYNLRSHIEIVRRKIASHGNAPGRVAAE* |
| Ga0075019_104331052 | 3300006086 | Watersheds | VAKQAEIENIEEALSKIHFPLTFSDQIYNLRSHIDFVRRKIASRLRYSGQVAAE* |
| Ga0079222_104030781 | 3300006755 | Agricultural Soil | LGKIHFPLTFADQVYTLRGHIDIVRQKIASRLRYSGQVAA* |
| Ga0079220_111555552 | 3300006806 | Agricultural Soil | IEESLGKIHFPLTFADQVYTLRGHIDIVRQKIASRLRYSGQVAA* |
| Ga0075436_1005848301 | 3300006914 | Populus Rhizosphere | DAVSHIRFPLAFSDQVYNLRSHIEIVRRKIVSRTQTLGRAPAE* |
| Ga0079219_102773182 | 3300006954 | Agricultural Soil | EDAVSHIRFPLTFSDQLYNLRSHIDIVRRKIAARAQAMGRVPAE* |
| Ga0105250_104189071 | 3300009092 | Switchgrass Rhizosphere | AVSHIRFPLAFSDQVYNLRSHIEIVRRKIVSRTQTLGRAPAE* |
| Ga0105243_116570442 | 3300009148 | Miscanthus Rhizosphere | EAVSHIRFPLTFSDQLYNLRSHIDIVRRKVASRTNASGRIAAE* |
| Ga0126380_105005412 | 3300010043 | Tropical Forest Soil | VSHIRFPLTFSDQLYNLRSHIDIVRRKIGSHVNASGRLAAE* |
| Ga0126373_104671072 | 3300010048 | Tropical Forest Soil | EHAVSHISIPLTFSDQVYNLRSHIDIVRRKIASRNDAPGRVAAE* |
| Ga0126373_131621433 | 3300010048 | Tropical Forest Soil | IRFPLTFSDQLYNLRSHIDIVRRKITSHVNAPGRIAAE* |
| Ga0126370_103123071 | 3300010358 | Tropical Forest Soil | ERIEEAVSHIRFPLTFSDQLYNLRSHIDIVRRKVTSQVDAQRRMATE* |
| Ga0126370_103832661 | 3300010358 | Tropical Forest Soil | PLTFSDQVYNLRSYIDIVRQKIASHVNAPRGGIAAE* |
| Ga0126370_105874022 | 3300010358 | Tropical Forest Soil | EDAVSHIQFPLTFTDQLYNLRSHIDIVRRKIASRANTPGSMAAE* |
| Ga0126370_119969981 | 3300010358 | Tropical Forest Soil | EDAVSHIRFPLTFTDQLYNLRSHIDIVRRKIVSRANTPGSMAAE* |
| Ga0126372_130232911 | 3300010360 | Tropical Forest Soil | ERIEQAVSHISFPLTFSDQLYNLRSHIDIVRRKITSHGNAPGRVAAE* |
| Ga0126378_102739071 | 3300010361 | Tropical Forest Soil | IDFPLAFSDQVYNLRSHIDIVRQKIASHLRSSGRVAA* |
| Ga0126378_105337661 | 3300010361 | Tropical Forest Soil | AVSHIHFPLTFSDQLYNLRSHIEIVRRKITSHGNAPGRVAAE* |
| Ga0126378_118960471 | 3300010361 | Tropical Forest Soil | VSEIDFPLAFSDQVYNLRSHIDIVRQKIASQLRSSGRAAA* |
| Ga0126379_111874053 | 3300010366 | Tropical Forest Soil | VRETGIERIEEAFSHIRFPLTFSDQLYNLRSHIDIVRRKITSHVNAPGR |
| Ga0126381_1016170311 | 3300010376 | Tropical Forest Soil | AEIERIEEAVSHISFPLTFSDQLYNLRSHIEIVRRKIASHTNTPEQMAAE* |
| Ga0126381_1032798372 | 3300010376 | Tropical Forest Soil | EIERIEDAVSEIDFPLAFSDQVYNLRSHIDIVRQKIASHLRSSGRVAA* |
| Ga0126375_101822152 | 3300012948 | Tropical Forest Soil | DRIEDAVSHIRFPLTFADQVYNLRGHIEIVRRKIASRIQTLGQAPAE* |
| Ga0126375_106039661 | 3300012948 | Tropical Forest Soil | EDAVSHISFPLTFSDQLYNLRSHIEIVRRKISSHENAPGRVAAE* |
| Ga0126375_115411761 | 3300012948 | Tropical Forest Soil | RIEDDLRKIHFPLTFSDQVYNLRHHIDLVRRKIASRLRSFGRVAA* |
| Ga0164303_101161533 | 3300012957 | Soil | ERIEEAVSHIRFPLTFSDQLYNLRSHIEIVRRKITSQGNAPGRVAAE* |
| Ga0126369_124238372 | 3300012971 | Tropical Forest Soil | PLTFSDQLYNLRSHIDIVRRKITSHVNAPGRVAAE* |
| Ga0126369_131115591 | 3300012971 | Tropical Forest Soil | SEIDFPLAFSGQVYNLRSHIDIVRQKIASQLRSSGRVAA* |
| Ga0126369_134447091 | 3300012971 | Tropical Forest Soil | AVSHIRIPLTFSDQVYNLRSHIDIVRRKIASRNNISDRIAAE* |
| Ga0164306_111224291 | 3300012988 | Soil | LAEKQAEIDRIEDALSHIRFPLAFSDQVYNLRSHIEIVRRKIVARTHALGRAPAE* |
| Ga0132258_111907321 | 3300015371 | Arabidopsis Rhizosphere | IEDAVSHIRIPLTFSDQVYNLRSHIDIVRRKMASRNNAPGRFAAE* |
| Ga0132258_131625133 | 3300015371 | Arabidopsis Rhizosphere | AAVERIEDDVSQIHFPLTFTDQVYNLRSHIDIVRRKITARTQVQGRMAAE* |
| Ga0132257_1008258912 | 3300015373 | Arabidopsis Rhizosphere | ERIEEAVSHIRFPLTFSDQLYNLRSHIDIVRRKITSHANTAGRVAAE* |
| Ga0132257_1022441901 | 3300015373 | Arabidopsis Rhizosphere | SHIQFPLTFTDQLYNLRSHIDIVRRKIASRANTPGSRAAE* |
| Ga0182036_102834301 | 3300016270 | Soil | ISIPLTFSDQVYNLRSYIDIVRRKIASRNSAQGRLAAE |
| Ga0182041_102975651 | 3300016294 | Soil | EIERIEEAVSHIRFPLTFSDQLYNLRSHIDIVRRKITSHVNAPRRVAAE |
| Ga0182041_104586641 | 3300016294 | Soil | RAEIERIEDAVSHIHIPLTFSDQVYNLRSHIDIVRRKIASRNNAQGRIAAE |
| Ga0182041_105391741 | 3300016294 | Soil | IEDAVSHIRIPLTFSDQVYNLRSHIDIVRRKIASRNNVPGRISAE |
| Ga0182041_108299591 | 3300016294 | Soil | VSHIRFPLTFSDQLYNLRSHIEIVRRKIASHANTPGQMAAE |
| Ga0182041_108387492 | 3300016294 | Soil | EIERIEEAVSHIRFPLTFSDQLYNLRSHIDIVRRKITSHVNPPGRVAAE |
| Ga0182041_108662352 | 3300016294 | Soil | KKAEIERIEEAVSHISFPLTFSDQLYNLRSHIEIVRRKIRSHANTPGQMAAE |
| Ga0182041_110769441 | 3300016294 | Soil | SHIQFPLTFTDQLYNLRSHIDIVRRKVASRANTPGSMAAE |
| Ga0182041_112114352 | 3300016294 | Soil | AVSHIQFPLTFSDQVYNLRSHIDIVRHKIASFGKAPGTDRG |
| Ga0182041_114326241 | 3300016294 | Soil | RAEIERIEDAVSHIHIPLTFSDQVYNLRSHIDIVRRKIASHNNAQGRIAAE |
| Ga0182041_118330142 | 3300016294 | Soil | AVSHIRFPLTFSDQLYNLRSHIDIVRRKITSHVNAPGRAAAE |
| Ga0182033_108659071 | 3300016319 | Soil | IEEAVSHISFPLTFSDQLYNLRSHIEIVRRKIASHGNTPEQMAAE |
| Ga0182033_112590542 | 3300016319 | Soil | EAVSHIHFPLTFSDQLYNLRSHIEIVRRKISSHENAPGRVAAE |
| Ga0182035_109568041 | 3300016341 | Soil | PLTFSDQVYNLRSHIDIVRRKIASRNNVQARISAE |
| Ga0182035_109602891 | 3300016341 | Soil | IRFPLTFSDQLYNLRSHIDIVRRKITSHVNAPGRAAAE |
| Ga0182035_110304552 | 3300016341 | Soil | HFPLTFADQVYTLRGHIDIVRQKIAARLRYSGQVAA |
| Ga0182035_114151912 | 3300016341 | Soil | EDAVSEIDFPLAFSDQVYNLRSHIDIVRQKIASHLRSSGRVAA |
| Ga0182035_114375733 | 3300016341 | Soil | EDAVSHIHIPLTFSDQVYNLRSHIDIVRRKIASRNNAQGRIAAE |
| Ga0182032_102255672 | 3300016357 | Soil | VSHISFPLTFSDQLYNLRSHIEIVRHKIACHANTPERMAAE |
| Ga0182032_104911221 | 3300016357 | Soil | HISFPLTFSDQLYNLRSHIEIVRRKIASHANTPEQMAAE |
| Ga0182032_108449131 | 3300016357 | Soil | IERIEDAVSEIDFPLAFSDQVYNLRSHIDIVRQKIASHLRSSGRVAA |
| Ga0182034_100033479 | 3300016371 | Soil | RIEEAVSHISFPLTFSDQLYNLRSHIEIVRRKIACHANTPERMAAE |
| Ga0182034_1002403111 | 3300016371 | Soil | ADTRAEIERIEDAVSHIHIPLTFSDQVYNLRSHIDIVRRKIASHNNAQGRIAAE |
| Ga0182034_103183251 | 3300016371 | Soil | IQFPLSFTDQLYNLRSHIDIVRRKIASRANTPGSMATE |
| Ga0182040_106199362 | 3300016387 | Soil | AVSHIHFPLTFSDQLYNLRSHIEIVRRKITSQGNAPGRVAAE |
| Ga0182040_114224211 | 3300016387 | Soil | IQFPLTFTDQLYNLRSHIDIVRRKIASRANTPGSMAAE |
| Ga0182037_112702801 | 3300016404 | Soil | AVSHIRFPLTFSDQLYNLRSHIDIVRRKITSHVNAPGRVAAE |
| Ga0182039_107195251 | 3300016422 | Soil | RIEDAVSEIHFPLRFSDQVYNLRSHIDIVRRKIAARIPSYGQVAAE |
| Ga0182039_109628262 | 3300016422 | Soil | EEAVSHIRFPLTFSDQLYNLRSHIDIVRRKITSHVNAPGRAAAE |
| Ga0182039_113894211 | 3300016422 | Soil | HIQFPLSFTDQLYNLRSHIDIVRRKIASRANTPGSMAAE |
| Ga0182039_116488291 | 3300016422 | Soil | AEIERIEEAVSHIRFPLTFSDQLYNLRSHIDIVRRKITSHVNAPGRVAAE |
| Ga0182039_122610422 | 3300016422 | Soil | VSHIHFPLTFSDQLYNLRSHIEIVRRKITSHGNAPGRVAAE |
| Ga0182038_112310861 | 3300016445 | Soil | FPLTFSDQLYNLRSHIEIVRRKIAAHGNAPGRVAAE |
| Ga0182038_119586821 | 3300016445 | Soil | IPLTFSDQVYNLRSHIDIVRRKIASHNNAQGRIAAE |
| Ga0187785_100942001 | 3300017947 | Tropical Peatland | LAEKQAKIEQIDDAVSHIRIPLTFSDQVYNLRSHIDIVRRKISSRNGTPGRIAAE |
| Ga0187783_100688421 | 3300017970 | Tropical Peatland | IEQIEDAVSHIRIPLTFSDQVYNLRSHIDIVRRKIASRNNAPGRIAAE |
| Ga0187787_100068631 | 3300018029 | Tropical Peatland | DSVSHIRFPLTFSDQLYELRSHIDVVRRKIESRSNSPRRIAAE |
| Ga0187770_109084241 | 3300018090 | Tropical Peatland | IHFPLTFPDQLYNLRSHIEIVQRKIATRRNTPQHMAAE |
| Ga0066662_104144411 | 3300018468 | Grasslands Soil | VSHIRFPLSFTDQLYNLRSHIDIVRRKIASRANAPGRMAAE |
| Ga0210410_117456671 | 3300021479 | Soil | EDAVSHIQFPLTFSDQVYNLRSHIDIVRHKIVSHGKAPGADIG |
| Ga0126371_100398479 | 3300021560 | Tropical Forest Soil | SHISFPLTFSDQLYNLRSHIEIVRRKIVSHGNAPGRVAAE |
| Ga0126371_119719472 | 3300021560 | Tropical Forest Soil | FPLTFSDQLYNLRSHIEIVRRKIASHANTQEQMAAE |
| Ga0207663_102217811 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | EDALSHIRFPLAFSDQVYNLRSHIEIVRRKIVARTHALGRAPAE |
| Ga0207700_119606821 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | SLSKIHFPLTFADQVYTLRGHIDIVRQKITARLRYSSQAAA |
| Ga0207706_104399123 | 3300025933 | Corn Rhizosphere | FPLTFTDQVYNLRSHIDIVRRKITARTQVQGRMAAE |
| Ga0207665_113332751 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | EAVSHIRFPLTFSDQLYNLRSHIDIVRRKITSHGNAPGRVAAE |
| Ga0207820_1064582 | 3300026809 | Tropical Forest Soil | SHIHFPLTFSDQLYNLRSHIDIVRRKITSHGNAPGRVAAE |
| Ga0207835_10199271 | 3300026953 | Tropical Forest Soil | AEIECIEEAVSKMHFPLTFSDQVYNLRSHIDMVRRKIASRLRYSGRVAA |
| Ga0209177_100751632 | 3300027775 | Agricultural Soil | EDAVSHIRFPLTFSDQLYNLRSHIDIVRRKIAARAQAMGRVPAE |
| Ga0170824_1184737281 | 3300031231 | Forest Soil | IENIEEALSKIHFPLTFSDQIYNLRSHIDFVRRKIASRLRYSGQVAAE |
| Ga0318538_101889941 | 3300031546 | Soil | PLTFSDQLYNLRSHIEIVRRKITSQGNAPGRVAAE |
| Ga0318538_103291413 | 3300031546 | Soil | AVSHIHIPLTFSDQVYNLRSHIDIVRRKIASHNNAQGRIAAE |
| Ga0318538_106496022 | 3300031546 | Soil | KKIEIERIEDAVSHIRLPLTFADQLYNLRSHIDIVRRKITSRTPGAMAAE |
| Ga0318528_106075171 | 3300031561 | Soil | IEDAVSHIQFPLSFTDQLYNLRSHIDIVRRKIASRANTPGSVAAE |
| Ga0310915_100762073 | 3300031573 | Soil | ERIEEAVSHIRFPLTFSDQLYNLRSHIDIVRRKITSHVNAPGRAAAE |
| Ga0310915_109147783 | 3300031573 | Soil | ERIEDAVSHIHIPLTFSDQVYNLRSHIDIVRRKIASRNNAQGRIAAE |
| Ga0318572_105294601 | 3300031681 | Soil | EIDRIEDALSHIRFPLAFSDQVYNLRSHIEIVRRKIVARAHALARAPAE |
| Ga0318560_100864465 | 3300031682 | Soil | IPLTFSDQVYNLRSHIDIVRRKIASRNNAQGRIAAE |
| Ga0306917_101801031 | 3300031719 | Soil | ERIEEAVSHIRFPLTFSDQLYNLRSHIDIVRRKITSHVNAPRRVAAE |
| Ga0306917_104213991 | 3300031719 | Soil | SHIHIPLTFSDQVYNLRSHIDIVRRKIASRNNAQGRIAAE |
| Ga0306917_106760691 | 3300031719 | Soil | EAVSHIRFPLTFSDQLYNLRSHIDIVRRKITSHVNPPGRVAAE |
| Ga0306917_111775051 | 3300031719 | Soil | IHIPLTFSDQVYNLRSHIDIVRRKIASRNNAQGRIAAE |
| Ga0306917_114690522 | 3300031719 | Soil | EIERIEEAVSHISFPLTFSDQLYNLRSHIEIVRRKIASHANTPEQMAAE |
| Ga0306918_101373044 | 3300031744 | Soil | ERIEEAVSHISFPLTFSDQLYNLRSHIEIVRRKIASHANTPEQMAAE |
| Ga0318502_104030732 | 3300031747 | Soil | RIEEAVSHIRFPLTFSDQLYNLRSHIDIVRRKITSHVNPPGRVAAE |
| Ga0307475_101940424 | 3300031754 | Hardwood Forest Soil | SHIRFPLTFSDQLYNLRSHIEIVRRKITSQGNAPGRVAAE |
| Ga0318554_103346372 | 3300031765 | Soil | SIEDAVSKTHFPLTFSDQVYNLRSHIDFVRRKIASRLRYPAQIAAE |
| Ga0318521_108489191 | 3300031770 | Soil | HIPLTFSDQVYNLRSHIDIVRRKIASRNNVRGRISAE |
| Ga0318546_112765721 | 3300031771 | Soil | VERIEDAVSEIDFPLAFSDQVYNLRSHIDIVRQKIASQLRSSGRVAA |
| Ga0318543_102150611 | 3300031777 | Soil | KIHFPLTFSDQVYNLRHHIDLVRRKIASRLGSLGRVAA |
| Ga0318557_104095351 | 3300031795 | Soil | IHFPLTFSDQLYNLRSHIDIVRRKVTSYANAPGRGAAE |
| Ga0318523_100972723 | 3300031798 | Soil | EEAVSHIHFPLTFSDQLYNLRSHIEIVRRKIRSHANTPGQMAAE |
| Ga0318568_103588901 | 3300031819 | Soil | HFPLTFSDQLYNLRSHIEIVRRKITSQGNAPGRVAAE |
| Ga0318564_105382902 | 3300031831 | Soil | AEIERIEEAVSHIRFPLTFSDQLYNLRSHIDIVRRKITSHVNPPGRVAAE |
| Ga0310917_110850381 | 3300031833 | Soil | ERIEEAVSHISFPLTFSDQLYNLRSHIEIVRRKIASHADTPERMAAE |
| Ga0318517_101974192 | 3300031835 | Soil | RIEHDLSRIHFPLTFSDQVYNLRHHIDLVRRKIASRLGSLGRVAA |
| Ga0318511_102849012 | 3300031845 | Soil | HIQFPLTFTDQLYNLRSHIDIVRRKIASRANTPGSMAAE |
| Ga0318511_105100001 | 3300031845 | Soil | GPMAKHLSEKKAEIERIEEAVSHIRFPLTFSDQLYNLRSHIDIVRRKITSHVNAPGRAAA |
| Ga0318512_100086901 | 3300031846 | Soil | AEIERIEEAVSHIHFPLTFSDQLYNLRSHIEIVRRKIRSHANTPGQMAAE |
| Ga0306919_103245633 | 3300031879 | Soil | IQFPLTFTDQLYNLRSHIDIVRRKIASRANTPGPMAAE |
| Ga0306919_110627401 | 3300031879 | Soil | FPLTFTDQLYNLRSHIDIVRRKVASRTNTPGSMAAE |
| Ga0306925_110339212 | 3300031890 | Soil | RIEQAVSHISFPLTFSDQLYNLRSHIEIVRRKIASHGNAPGRVAAE |
| Ga0306925_112208191 | 3300031890 | Soil | EIERIEEAVSHISFPLTFSDQLYNLRSHIEIVRRKIAAHGNAPGRVAAE |
| Ga0306925_119335121 | 3300031890 | Soil | EDAVSHIQFPLTFTDQLYNLRSHIDIVRRKVASRANTPGSMAAE |
| Ga0318551_100070311 | 3300031896 | Soil | EEALSKISFPLTFSDQVYNLRSHIDFVRRKIASRLRYSRQIAAE |
| Ga0318520_105302853 | 3300031897 | Soil | FPLTFTDQLYNLRSHIDIVRRKIASRANTPGSMAAE |
| Ga0306923_1001933812 | 3300031910 | Soil | IERIEEAVSHIRFPLTFSDQLYNLRSHIDIVRRKITSHVNAPRRVAAE |
| Ga0306921_111200912 | 3300031912 | Soil | EDAVSHIRFPLTFTDQLYNLRSHIDIVRRKIVSRANTPGLMAVE |
| Ga0306921_115453271 | 3300031912 | Soil | IERIEEAVSHIRFPLTFSDQLYNLRSHIDIVRRKITSHVNAPGRAAAE |
| Ga0310912_102093361 | 3300031941 | Soil | AEIERIEEAVSHIRFPLTFSDQLYNLRSHIDIVRRKITSHVNAPGRAAAE |
| Ga0310912_114664681 | 3300031941 | Soil | PLTFSDQLYNLRSHIEIVRRKIASHANTPERVAAE |
| Ga0310884_100759553 | 3300031944 | Soil | SHIRFPLTFSDQLYNLRSHIDIVRRKVASRTNASGRIAAE |
| Ga0310913_113135011 | 3300031945 | Soil | LSEKQSEIERIEEAVSHIHFPLTFSDQLYNLRSHIEIVRRKITSHGNAPGRVAAE |
| Ga0310910_101499781 | 3300031946 | Soil | EDAVSHIQFPLSFTDQLYNLRSHIDIVRRKIASRANTPGSVAAE |
| Ga0310910_104388332 | 3300031946 | Soil | VSHISFPLTFSDQLYNLRSHIEIVRRKIASHANTPERMAAE |
| Ga0310909_100038891 | 3300031947 | Soil | EEAVSHISFPLTFSDQLYNLRSHIEIVRRKIACHANTPERMAAE |
| Ga0310909_102952652 | 3300031947 | Soil | IEDAVSEIDFPLAFSDQVYNLRSHIDIVRQKIASHLRSSGRVAA |
| Ga0310909_103930152 | 3300031947 | Soil | KAQAEVERIEEAVSHIHFPLTFSDQLYNLRSHIDIVRRKITSHGNAPGRVAAE |
| Ga0310909_105786832 | 3300031947 | Soil | IERIEEAVSHISFPLTFSDQLYNLRSHIEIVRRKIASHANTPERVAAE |
| Ga0306926_102015171 | 3300031954 | Soil | HISFPLTFSDQLYNLRSHIEIVRRKISSHENAPGRVAAE |
| Ga0306926_107301092 | 3300031954 | Soil | EDAVSHIHIPLTFSDQVYNLRSHIDIVRRKIASRNNAQARISAE |
| Ga0306926_113034082 | 3300031954 | Soil | IEEAVSHISIPLTFSDQVYNLRSHIDIVRRKIASRDNAPPRRIAAE |
| Ga0318530_103063941 | 3300031959 | Soil | AVSHIHIPLTFSDQVYNLRSHIDIVRRKIASRNNAQGRIAAE |
| Ga0318531_105153802 | 3300031981 | Soil | AVSHIQFPLTFSDQVYNLRSHIDIVRHKIASQVNVPGRIAAE |
| Ga0306922_104621773 | 3300032001 | Soil | IEDAVSKIHFPLAFSDQVYNLRSHIDIVRQKIASRLRSSGRVAA |
| Ga0318507_100482451 | 3300032025 | Soil | AEIERIEEAVSHIRFPLTFSDQLYNLRSHIDIVRRKITSHVNAPRRVAAE |
| Ga0310911_100545682 | 3300032035 | Soil | EDDLSKIHFPLTFSDQVYNLRHHIDLVRRKIASRLRAFGRVAA |
| Ga0310911_103757711 | 3300032035 | Soil | IHFPLTFSDQVYNLRHHIDLVRRKIASRLGSLGRVAA |
| Ga0310911_104267282 | 3300032035 | Soil | SHIRFPLTFSDQLYNLRSHIDIVRRKITSHVNAPGRAAAE |
| Ga0310911_104486542 | 3300032035 | Soil | RIEDSLGKIHFPLTFADQVYTLRGHIDIVRQKIAARLRYSGQVAA |
| Ga0318549_100681871 | 3300032041 | Soil | LSEKQAEIERIEEAVSHIHFPLTLSDQLYNLRSHIEIVRRKIRSHANTPGQMAAE |
| Ga0318556_106774912 | 3300032043 | Soil | SHIRIPLTFSDQVYNLRSHIDFVRRKIASRLRYPAQIAAE |
| Ga0318532_102390341 | 3300032051 | Soil | FPLTFSDQLYNLRSHIDIVRRKITSHGNAPGRVAAE |
| Ga0318570_104210442 | 3300032054 | Soil | AEVEQIDDAVSRIRFPLALADQLYNLRSHIDIVRRRLTPRVRAAAE |
| Ga0318504_104823171 | 3300032063 | Soil | RIEEAVSHISFPLTFSDQLYNLRSHIEIVRRKIRSHANTPGQMAAE |
| Ga0318524_100626913 | 3300032067 | Soil | AEIERIEEAVSHIHFPLTFSDQLYNLRSHIDIVRRKVTSYAKAPGRGAAE |
| Ga0306924_106645291 | 3300032076 | Soil | SFPLTFSDQLYQLRSHIDIVRRKITSHVNAPGRVAAE |
| Ga0306924_107524232 | 3300032076 | Soil | DIHSADTRAEIERIEDAVSHIHIPLTFSDQVYNLRSHIDIVRRKIASRNNVQARISAE |
| Ga0306924_112913331 | 3300032076 | Soil | RIEEAVSHIRFPLTFSDQLYNLRSHIDIVRRKITSHVNAPGRAAAE |
| Ga0306924_114305202 | 3300032076 | Soil | RFPLTFTDQLYNLRSHIDIVRRKIASRANTPGSMAAE |
| Ga0306924_114522402 | 3300032076 | Soil | DAVSHIQFPLTFPDQLYNLRSHIDIVRRKIASRANTPGSMAAE |
| Ga0306924_118145591 | 3300032076 | Soil | DKQAEIEGIEEAVSKMHFPLTFSDQVYNLRSHIDMVRRKIASRLRYSGRVAA |
| Ga0306924_122076302 | 3300032076 | Soil | EEAVSHVRFPLTFTDQLYNLRSHIDIVRRKIASRANTPGSMAAE |
| Ga0306924_123222261 | 3300032076 | Soil | EEAVSHIRFPLTFSDQLYNLRSHIDIVRRKITSHVNAPGRIAAE |
| Ga0318577_100914891 | 3300032091 | Soil | IEDAVSHIQFPLTFTDQLYNLRSHIDIVRRKIASRANTPGSMAAE |
| Ga0318540_100641682 | 3300032094 | Soil | IHFPLTFSDQLYNLRSHIDIVRRKITSHGNAPGRVAAE |
| Ga0307472_1012324282 | 3300032205 | Hardwood Forest Soil | VSHIRFPLTFSDQLYNLRSHIDIVRRKITSHVNAPGRVAAE |
| Ga0306920_1001728251 | 3300032261 | Soil | PLTFTDQLYNLRSHIDIVRRKIASRANTPGSMATE |
| Ga0306920_1005389514 | 3300032261 | Soil | FPLTFSDQLYNLRSHIEIVRRKIASHANTPERMAAE |
| Ga0306920_1015496101 | 3300032261 | Soil | QAEVERIEDAVSHIHFPLTFSDQLYNLRSHIEIVRRKIASQGNAPGRVAAE |
| Ga0306920_1030013791 | 3300032261 | Soil | AVSHISIPLTFSDQVYNLRSHIDIVRRKIASRDNAPPGRIAAE |
| Ga0306920_1043638902 | 3300032261 | Soil | VSHIHFPLTFSDQLYNLRSHIEIVRRKITSHGNAPGRAAAE |
| Ga0335085_100431299 | 3300032770 | Soil | IRFPLTFTDQLYDLRSHIDIVRRKIAARANALGRIAAE |
| Ga0335071_102008042 | 3300032897 | Soil | ANPMDTHSVDTRAEIERIEDAVSHIHIPLTFSAQVYNLRSHIDIVRRKIASRNNAQGRISAE |
| Ga0310914_105222111 | 3300033289 | Soil | PLTFSDQLYNLRSHIEIVRRKIAAHGNAPGRVAAE |
| Ga0310914_108726472 | 3300033289 | Soil | RIEDAVSEIHFPLRFSDQVYNLRSHIDIVRRKLASRIPSYGQVAAE |
| Ga0310914_113502672 | 3300033289 | Soil | VNQHLAKAQAEVERIEDAVSHIHFPLTFSDQLYNLRSHIEIVRRKIASQGNAPGRVAAE |
| ⦗Top⦘ |