| Basic Information | |
|---|---|
| Family ID | F028454 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 191 |
| Average Sequence Length | 43 residues |
| Representative Sequence | VDLNVSPLAPGQSKPFRLTFESISAQWNHEYPELQITDVTVK |
| Number of Associated Samples | 169 |
| Number of Associated Scaffolds | 191 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.53 % |
| % of genes near scaffold ends (potentially truncated) | 98.95 % |
| % of genes from short scaffolds (< 2000 bps) | 87.43 % |
| Associated GOLD sequencing projects | 160 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.23 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (98.429 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (14.136 % of family members) |
| Environment Ontology (ENVO) | Unclassified (28.272 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (51.309 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 14.29% β-sheet: 0.00% Coil/Unstructured: 85.71% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.23 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 191 Family Scaffolds |
|---|---|---|
| PF00586 | AIRS | 26.70 |
| PF02769 | AIRS_C | 17.28 |
| PF05960 | DUF885 | 5.76 |
| PF13302 | Acetyltransf_3 | 3.14 |
| PF14907 | NTP_transf_5 | 1.57 |
| PF01850 | PIN | 1.57 |
| PF00248 | Aldo_ket_red | 1.57 |
| PF13714 | PEP_mutase | 1.05 |
| PF12867 | DinB_2 | 1.05 |
| PF04191 | PEMT | 1.05 |
| PF00156 | Pribosyltran | 1.05 |
| PF09624 | DUF2393 | 0.52 |
| PF01553 | Acyltransferase | 0.52 |
| PF07607 | DUF1570 | 0.52 |
| PF02190 | LON_substr_bdg | 0.52 |
| PF02195 | ParBc | 0.52 |
| PF04337 | DUF480 | 0.52 |
| PF01566 | Nramp | 0.52 |
| PF14518 | Haem_oxygenas_2 | 0.52 |
| PF17137 | DUF5110 | 0.52 |
| PF13387 | DUF4105 | 0.52 |
| PF01522 | Polysacc_deac_1 | 0.52 |
| PF01738 | DLH | 0.52 |
| PF00892 | EamA | 0.52 |
| PF02545 | Maf | 0.52 |
| PF06480 | FtsH_ext | 0.52 |
| PF00232 | Glyco_hydro_1 | 0.52 |
| PF03652 | RuvX | 0.52 |
| COG ID | Name | Functional Category | % Frequency in 191 Family Scaffolds |
|---|---|---|---|
| COG4805 | Uncharacterized conserved protein, DUF885 family | Function unknown [S] | 5.76 |
| COG0424 | 7-methyl-GTP pyrophosphatase and related NTP pyrophosphatases, Maf/HAM1 superfamily | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.52 |
| COG0465 | ATP-dependent Zn proteases | Posttranslational modification, protein turnover, chaperones [O] | 0.52 |
| COG0726 | Peptidoglycan/xylan/chitin deacetylase, PgdA/NodB/CDA1 family | Cell wall/membrane/envelope biogenesis [M] | 0.52 |
| COG0816 | YqgF/RuvX protein, pre-16S rRNA maturation RNase/Holliday junction resolvase/anti-termination factor | Translation, ribosomal structure and biogenesis [J] | 0.52 |
| COG1914 | Mn2+ or Fe2+ transporter, NRAMP family | Inorganic ion transport and metabolism [P] | 0.52 |
| COG2723 | Beta-glucosidase/6-phospho-beta-glucosidase/beta-galactosidase | Carbohydrate transport and metabolism [G] | 0.52 |
| COG3132 | Uncharacterized conserved protein YceH, UPF0502 family | Function unknown [S] | 0.52 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 98.43 % |
| Unclassified | root | N/A | 1.57 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300002245|JGIcombinedJ26739_101743452 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 523 | Open in IMG/M |
| 3300003352|JGI26345J50200_1029863 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 592 | Open in IMG/M |
| 3300004092|Ga0062389_100617444 | All Organisms → cellular organisms → Bacteria | 1250 | Open in IMG/M |
| 3300004121|Ga0058882_1747997 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1095 | Open in IMG/M |
| 3300005186|Ga0066676_10301073 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1061 | Open in IMG/M |
| 3300005445|Ga0070708_100004762 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 10692 | Open in IMG/M |
| 3300005518|Ga0070699_101897283 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 545 | Open in IMG/M |
| 3300005542|Ga0070732_10770005 | All Organisms → cellular organisms → Bacteria | 587 | Open in IMG/M |
| 3300005553|Ga0066695_10529382 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 720 | Open in IMG/M |
| 3300005575|Ga0066702_10265021 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1047 | Open in IMG/M |
| 3300005602|Ga0070762_10975408 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 580 | Open in IMG/M |
| 3300005843|Ga0068860_101174695 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 787 | Open in IMG/M |
| 3300005890|Ga0075285_1003045 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1731 | Open in IMG/M |
| 3300006049|Ga0075417_10311091 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 766 | Open in IMG/M |
| 3300006059|Ga0075017_100044833 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2955 | Open in IMG/M |
| 3300006059|Ga0075017_100336188 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1122 | Open in IMG/M |
| 3300006162|Ga0075030_101407812 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 546 | Open in IMG/M |
| 3300006806|Ga0079220_10667367 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 756 | Open in IMG/M |
| 3300009143|Ga0099792_11038470 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 549 | Open in IMG/M |
| 3300009174|Ga0105241_11944182 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 578 | Open in IMG/M |
| 3300009518|Ga0116128_1035390 | All Organisms → cellular organisms → Bacteria | 1635 | Open in IMG/M |
| 3300009519|Ga0116108_1139137 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 723 | Open in IMG/M |
| 3300009616|Ga0116111_1140260 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 580 | Open in IMG/M |
| 3300009628|Ga0116125_1029506 | All Organisms → cellular organisms → Bacteria | 1368 | Open in IMG/M |
| 3300009633|Ga0116129_1067771 | All Organisms → cellular organisms → Bacteria | 1067 | Open in IMG/M |
| 3300009643|Ga0116110_1181371 | All Organisms → cellular organisms → Bacteria | 688 | Open in IMG/M |
| 3300009646|Ga0116132_1002581 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 10930 | Open in IMG/M |
| 3300009646|Ga0116132_1022753 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2202 | Open in IMG/M |
| 3300009759|Ga0116101_1078809 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 744 | Open in IMG/M |
| 3300009764|Ga0116134_1334695 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 520 | Open in IMG/M |
| 3300010043|Ga0126380_10475131 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 952 | Open in IMG/M |
| 3300010048|Ga0126373_10366866 | All Organisms → cellular organisms → Bacteria | 1456 | Open in IMG/M |
| 3300010048|Ga0126373_10569701 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1182 | Open in IMG/M |
| 3300010159|Ga0099796_10060380 | All Organisms → cellular organisms → Bacteria | 1342 | Open in IMG/M |
| 3300010339|Ga0074046_10121411 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1677 | Open in IMG/M |
| 3300010339|Ga0074046_10736412 | All Organisms → cellular organisms → Bacteria | 578 | Open in IMG/M |
| 3300010358|Ga0126370_11617853 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 620 | Open in IMG/M |
| 3300010358|Ga0126370_11927279 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 575 | Open in IMG/M |
| 3300010361|Ga0126378_10369355 | All Organisms → cellular organisms → Bacteria | 1545 | Open in IMG/M |
| 3300010376|Ga0126381_101681169 | Not Available | 917 | Open in IMG/M |
| 3300010376|Ga0126381_103693728 | All Organisms → cellular organisms → Bacteria | 599 | Open in IMG/M |
| 3300010379|Ga0136449_101754290 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 932 | Open in IMG/M |
| 3300010379|Ga0136449_102955008 | All Organisms → cellular organisms → Bacteria | 665 | Open in IMG/M |
| 3300010398|Ga0126383_10812150 | All Organisms → cellular organisms → Bacteria | 1018 | Open in IMG/M |
| 3300010880|Ga0126350_10500645 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 796 | Open in IMG/M |
| 3300011055|Ga0138550_101352 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 535 | Open in IMG/M |
| 3300011120|Ga0150983_14794400 | All Organisms → cellular organisms → Bacteria | 541 | Open in IMG/M |
| 3300011270|Ga0137391_10703959 | All Organisms → cellular organisms → Bacteria | 839 | Open in IMG/M |
| 3300011271|Ga0137393_11239442 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 633 | Open in IMG/M |
| 3300012207|Ga0137381_11448429 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 579 | Open in IMG/M |
| 3300012208|Ga0137376_11423602 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 584 | Open in IMG/M |
| 3300012362|Ga0137361_11236995 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 670 | Open in IMG/M |
| 3300012362|Ga0137361_11265337 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 662 | Open in IMG/M |
| 3300012683|Ga0137398_10596601 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 764 | Open in IMG/M |
| 3300012924|Ga0137413_11054496 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 640 | Open in IMG/M |
| 3300012930|Ga0137407_12099107 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 540 | Open in IMG/M |
| 3300012958|Ga0164299_10212824 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1127 | Open in IMG/M |
| 3300012989|Ga0164305_11263934 | All Organisms → cellular organisms → Bacteria | 643 | Open in IMG/M |
| 3300014162|Ga0181538_10224190 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1045 | Open in IMG/M |
| 3300014167|Ga0181528_10031850 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2990 | Open in IMG/M |
| 3300014489|Ga0182018_10488995 | Not Available | 652 | Open in IMG/M |
| 3300014498|Ga0182019_10031620 | All Organisms → cellular organisms → Bacteria | 2968 | Open in IMG/M |
| 3300014654|Ga0181525_10487008 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 682 | Open in IMG/M |
| 3300014658|Ga0181519_10298313 | All Organisms → cellular organisms → Bacteria | 1001 | Open in IMG/M |
| 3300015167|Ga0167661_1033673 | All Organisms → cellular organisms → Bacteria | 961 | Open in IMG/M |
| 3300015372|Ga0132256_101019262 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 943 | Open in IMG/M |
| 3300015373|Ga0132257_101519070 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 855 | Open in IMG/M |
| 3300016357|Ga0182032_10108834 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1974 | Open in IMG/M |
| 3300016387|Ga0182040_11425299 | All Organisms → cellular organisms → Bacteria | 587 | Open in IMG/M |
| 3300016404|Ga0182037_11043629 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 714 | Open in IMG/M |
| 3300017930|Ga0187825_10302674 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 596 | Open in IMG/M |
| 3300017943|Ga0187819_10059078 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2277 | Open in IMG/M |
| 3300017943|Ga0187819_10238638 | All Organisms → cellular organisms → Bacteria | 1066 | Open in IMG/M |
| 3300017955|Ga0187817_10760664 | All Organisms → cellular organisms → Bacteria | 618 | Open in IMG/M |
| 3300017970|Ga0187783_10423244 | All Organisms → cellular organisms → Bacteria | 967 | Open in IMG/M |
| 3300017972|Ga0187781_10407863 | All Organisms → cellular organisms → Bacteria | 970 | Open in IMG/M |
| 3300018006|Ga0187804_10373847 | All Organisms → cellular organisms → Bacteria | 628 | Open in IMG/M |
| 3300018009|Ga0187884_10334072 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 611 | Open in IMG/M |
| 3300018012|Ga0187810_10386929 | All Organisms → cellular organisms → Bacteria | 587 | Open in IMG/M |
| 3300018022|Ga0187864_10369943 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 623 | Open in IMG/M |
| 3300018034|Ga0187863_10403443 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 762 | Open in IMG/M |
| 3300018062|Ga0187784_11497133 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 534 | Open in IMG/M |
| 3300018086|Ga0187769_10011660 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 5636 | Open in IMG/M |
| 3300018433|Ga0066667_12007020 | All Organisms → cellular organisms → Bacteria | 532 | Open in IMG/M |
| 3300019787|Ga0182031_1507703 | All Organisms → cellular organisms → Bacteria | 1557 | Open in IMG/M |
| 3300019877|Ga0193722_1070150 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 870 | Open in IMG/M |
| 3300020579|Ga0210407_10010383 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 6949 | Open in IMG/M |
| 3300020580|Ga0210403_10043058 | All Organisms → cellular organisms → Bacteria | 3608 | Open in IMG/M |
| 3300020582|Ga0210395_10126955 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1896 | Open in IMG/M |
| 3300020583|Ga0210401_10265224 | All Organisms → cellular organisms → Bacteria | 1577 | Open in IMG/M |
| 3300021171|Ga0210405_10962431 | All Organisms → cellular organisms → Bacteria | 645 | Open in IMG/M |
| 3300021171|Ga0210405_11268925 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 542 | Open in IMG/M |
| 3300021181|Ga0210388_10364564 | All Organisms → cellular organisms → Bacteria | 1271 | Open in IMG/M |
| 3300021181|Ga0210388_10938254 | All Organisms → cellular organisms → Bacteria | 744 | Open in IMG/M |
| 3300021344|Ga0193719_10190265 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 878 | Open in IMG/M |
| 3300021401|Ga0210393_10426590 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1081 | Open in IMG/M |
| 3300021401|Ga0210393_10820304 | All Organisms → cellular organisms → Bacteria | 757 | Open in IMG/M |
| 3300021403|Ga0210397_11311659 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 562 | Open in IMG/M |
| 3300021404|Ga0210389_11391586 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 535 | Open in IMG/M |
| 3300021405|Ga0210387_11281419 | All Organisms → cellular organisms → Bacteria | 634 | Open in IMG/M |
| 3300021407|Ga0210383_11307584 | All Organisms → cellular organisms → Bacteria | 606 | Open in IMG/M |
| 3300021411|Ga0193709_1063987 | All Organisms → cellular organisms → Bacteria | 840 | Open in IMG/M |
| 3300021420|Ga0210394_10400565 | All Organisms → cellular organisms → Bacteria | 1207 | Open in IMG/M |
| 3300021420|Ga0210394_11457733 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 580 | Open in IMG/M |
| 3300021475|Ga0210392_10494767 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 900 | Open in IMG/M |
| 3300021479|Ga0210410_10296733 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1450 | Open in IMG/M |
| 3300021479|Ga0210410_11233963 | All Organisms → cellular organisms → Bacteria | 639 | Open in IMG/M |
| 3300022721|Ga0242666_1122406 | All Organisms → cellular organisms → Bacteria | 618 | Open in IMG/M |
| 3300022732|Ga0224569_102715 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1417 | Open in IMG/M |
| 3300024271|Ga0224564_1021640 | All Organisms → cellular organisms → Bacteria | 1169 | Open in IMG/M |
| 3300024271|Ga0224564_1024043 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1120 | Open in IMG/M |
| 3300024331|Ga0247668_1096069 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 600 | Open in IMG/M |
| 3300025878|Ga0209584_10417056 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 518 | Open in IMG/M |
| 3300025893|Ga0207682_10194063 | All Organisms → cellular organisms → Bacteria | 932 | Open in IMG/M |
| 3300025929|Ga0207664_10705720 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 907 | Open in IMG/M |
| 3300026335|Ga0209804_1222605 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 753 | Open in IMG/M |
| 3300026354|Ga0257180_1038659 | All Organisms → cellular organisms → Bacteria | 662 | Open in IMG/M |
| 3300026499|Ga0257181_1039969 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 758 | Open in IMG/M |
| 3300026529|Ga0209806_1273447 | All Organisms → cellular organisms → Bacteria | 568 | Open in IMG/M |
| 3300026921|Ga0207860_1022610 | All Organisms → cellular organisms → Bacteria | 752 | Open in IMG/M |
| 3300027297|Ga0208241_1037334 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 757 | Open in IMG/M |
| 3300027394|Ga0209904_1001895 | All Organisms → cellular organisms → Bacteria | 1676 | Open in IMG/M |
| 3300027516|Ga0207761_1004903 | All Organisms → cellular organisms → Bacteria | 3513 | Open in IMG/M |
| 3300027634|Ga0209905_1029623 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 810 | Open in IMG/M |
| 3300027641|Ga0208827_1198699 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 534 | Open in IMG/M |
| 3300027648|Ga0209420_1019410 | All Organisms → cellular organisms → Bacteria | 2219 | Open in IMG/M |
| 3300027651|Ga0209217_1108474 | All Organisms → cellular organisms → Bacteria | 789 | Open in IMG/M |
| 3300027660|Ga0209736_1063253 | All Organisms → cellular organisms → Bacteria | 1035 | Open in IMG/M |
| 3300027698|Ga0209446_1106526 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 720 | Open in IMG/M |
| 3300027729|Ga0209248_10101645 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 867 | Open in IMG/M |
| 3300027768|Ga0209772_10245972 | All Organisms → cellular organisms → Bacteria | 567 | Open in IMG/M |
| 3300027842|Ga0209580_10059639 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1793 | Open in IMG/M |
| 3300027842|Ga0209580_10481965 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 618 | Open in IMG/M |
| 3300027853|Ga0209274_10539135 | All Organisms → cellular organisms → Bacteria | 604 | Open in IMG/M |
| 3300027869|Ga0209579_10030128 | All Organisms → cellular organisms → Bacteria | 2965 | Open in IMG/M |
| 3300027879|Ga0209169_10163734 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1159 | Open in IMG/M |
| 3300027882|Ga0209590_10503087 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 782 | Open in IMG/M |
| 3300027884|Ga0209275_10913914 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 506 | Open in IMG/M |
| 3300027889|Ga0209380_10012572 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 4876 | Open in IMG/M |
| 3300027894|Ga0209068_10726129 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 583 | Open in IMG/M |
| 3300027908|Ga0209006_10354457 | All Organisms → cellular organisms → Bacteria | 1243 | Open in IMG/M |
| 3300028381|Ga0268264_10193192 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1857 | Open in IMG/M |
| 3300028536|Ga0137415_11490870 | All Organisms → cellular organisms → Bacteria | 502 | Open in IMG/M |
| 3300028566|Ga0302147_10103172 | All Organisms → cellular organisms → Bacteria | 977 | Open in IMG/M |
| 3300028798|Ga0302222_10193369 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 797 | Open in IMG/M |
| 3300028867|Ga0302146_10417541 | All Organisms → cellular organisms → Bacteria | 511 | Open in IMG/M |
| 3300029889|Ga0246001_1011244 | All Organisms → cellular organisms → Bacteria | 3119 | Open in IMG/M |
| 3300029913|Ga0311362_10093724 | All Organisms → cellular organisms → Bacteria | 4041 | Open in IMG/M |
| 3300029943|Ga0311340_10053524 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 4748 | Open in IMG/M |
| 3300029943|Ga0311340_11077691 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 655 | Open in IMG/M |
| 3300030007|Ga0311338_10964950 | All Organisms → cellular organisms → Bacteria | 831 | Open in IMG/M |
| 3300030007|Ga0311338_12023090 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 511 | Open in IMG/M |
| 3300030020|Ga0311344_10206349 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2011 | Open in IMG/M |
| 3300030041|Ga0302274_10253718 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 838 | Open in IMG/M |
| 3300030057|Ga0302176_10482412 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 501 | Open in IMG/M |
| 3300030399|Ga0311353_10102543 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2782 | Open in IMG/M |
| 3300030494|Ga0310037_10481144 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 505 | Open in IMG/M |
| 3300030503|Ga0311370_12237135 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 536 | Open in IMG/M |
| 3300030506|Ga0302194_10306380 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium | 630 | Open in IMG/M |
| 3300030508|Ga0302185_10338446 | All Organisms → cellular organisms → Bacteria | 505 | Open in IMG/M |
| 3300030518|Ga0302275_10524514 | All Organisms → cellular organisms → Bacteria | 589 | Open in IMG/M |
| 3300030520|Ga0311372_12742282 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 544 | Open in IMG/M |
| 3300030520|Ga0311372_12758578 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 541 | Open in IMG/M |
| 3300030707|Ga0310038_10477710 | All Organisms → cellular organisms → Bacteria | 530 | Open in IMG/M |
| 3300030737|Ga0302310_10203779 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1155 | Open in IMG/M |
| 3300031446|Ga0170820_13873226 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 734 | Open in IMG/M |
| 3300031474|Ga0170818_112914474 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 567 | Open in IMG/M |
| 3300031524|Ga0302320_10855038 | All Organisms → cellular organisms → Bacteria | 995 | Open in IMG/M |
| 3300031708|Ga0310686_107905110 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 691 | Open in IMG/M |
| 3300031708|Ga0310686_108299924 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 661 | Open in IMG/M |
| 3300031718|Ga0307474_10110948 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2055 | Open in IMG/M |
| 3300031720|Ga0307469_10715733 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 909 | Open in IMG/M |
| 3300031754|Ga0307475_10228819 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1489 | Open in IMG/M |
| 3300031770|Ga0318521_10123509 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1449 | Open in IMG/M |
| 3300031771|Ga0318546_10442083 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 910 | Open in IMG/M |
| 3300031823|Ga0307478_11752625 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 511 | Open in IMG/M |
| 3300031833|Ga0310917_10018180 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 3999 | Open in IMG/M |
| 3300031837|Ga0302315_10607051 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 583 | Open in IMG/M |
| 3300031962|Ga0307479_10194037 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1999 | Open in IMG/M |
| 3300031962|Ga0307479_11568479 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 614 | Open in IMG/M |
| 3300032001|Ga0306922_10163141 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 2386 | Open in IMG/M |
| 3300032174|Ga0307470_10149163 | All Organisms → cellular organisms → Bacteria | 1427 | Open in IMG/M |
| 3300032205|Ga0307472_100868070 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 832 | Open in IMG/M |
| 3300032770|Ga0335085_10423870 | All Organisms → cellular organisms → Bacteria | 1538 | Open in IMG/M |
| 3300032783|Ga0335079_10117227 | All Organisms → cellular organisms → Bacteria | 3007 | Open in IMG/M |
| 3300032805|Ga0335078_11411693 | All Organisms → cellular organisms → Bacteria | 785 | Open in IMG/M |
| 3300032892|Ga0335081_12205362 | All Organisms → cellular organisms → Bacteria | 580 | Open in IMG/M |
| 3300032892|Ga0335081_12690677 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 508 | Open in IMG/M |
| 3300033289|Ga0310914_10381579 | All Organisms → cellular organisms → Bacteria | 1275 | Open in IMG/M |
| 3300033755|Ga0371489_0098655 | All Organisms → cellular organisms → Bacteria | 1714 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 14.14% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 6.81% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 6.28% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 5.24% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 4.19% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 4.19% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 4.71% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 4.71% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 4.71% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 3.14% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 3.14% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 2.62% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 2.62% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 2.62% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 2.62% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 2.62% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 2.09% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 2.09% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.09% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 2.09% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 1.57% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.05% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 1.05% |
| Thawing Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Thawing Permafrost | 1.05% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.05% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.05% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.05% |
| Glacier Forefield Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil | 0.52% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.52% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 0.52% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.52% |
| Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 0.52% |
| Fen | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Fen | 0.52% |
| Bog | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Bog | 0.52% |
| Palsa | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa | 0.52% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.52% |
| Peat | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat | 0.52% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.52% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.52% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.52% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.52% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.52% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.52% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.52% |
| Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 0.52% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300003352 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM1 | Environmental | Open in IMG/M |
| 3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300004121 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF109 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005186 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 | Environmental | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
| 3300005542 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 | Environmental | Open in IMG/M |
| 3300005553 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 | Environmental | Open in IMG/M |
| 3300005575 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 | Environmental | Open in IMG/M |
| 3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
| 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
| 3300005890 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_0N_104 | Environmental | Open in IMG/M |
| 3300006049 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 | Host-Associated | Open in IMG/M |
| 3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
| 3300006162 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 | Environmental | Open in IMG/M |
| 3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
| 3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
| 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Host-Associated | Open in IMG/M |
| 3300009518 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_150 | Environmental | Open in IMG/M |
| 3300009519 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_150 | Environmental | Open in IMG/M |
| 3300009616 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_8_100 | Environmental | Open in IMG/M |
| 3300009628 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_10 | Environmental | Open in IMG/M |
| 3300009633 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_17_10 | Environmental | Open in IMG/M |
| 3300009643 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_8_40 | Environmental | Open in IMG/M |
| 3300009646 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_17_150 | Environmental | Open in IMG/M |
| 3300009759 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_4_10 | Environmental | Open in IMG/M |
| 3300009764 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_19_40 | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Environmental | Open in IMG/M |
| 3300010339 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM3 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300010880 | Boreal forest soil eukaryotic communities from Alaska, USA - C5-1 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300011055 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 31 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
| 3300012924 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012958 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MG | Environmental | Open in IMG/M |
| 3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
| 3300014162 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_30_metaG | Environmental | Open in IMG/M |
| 3300014167 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin10_10_metaG | Environmental | Open in IMG/M |
| 3300014489 | Permafrost microbial communities from Stordalen Mire, Sweden - 812P2M metaG | Environmental | Open in IMG/M |
| 3300014498 | Permafrost microbial communities from Stordalen Mire, Sweden - 812E2M metaG | Environmental | Open in IMG/M |
| 3300014654 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_10_metaG | Environmental | Open in IMG/M |
| 3300014658 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_10_metaG | Environmental | Open in IMG/M |
| 3300015167 | Arctic soil microbial communities from a glacier forefield, Storglaci?ren, Tarfala, Sweden (Sample st-11b, vegetated hydrological feature) | Environmental | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
| 3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300017930 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_5 | Environmental | Open in IMG/M |
| 3300017943 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4 | Environmental | Open in IMG/M |
| 3300017955 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2 | Environmental | Open in IMG/M |
| 3300017970 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300017972 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300018006 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_4 | Environmental | Open in IMG/M |
| 3300018009 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_40 | Environmental | Open in IMG/M |
| 3300018012 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_5 | Environmental | Open in IMG/M |
| 3300018022 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_40 | Environmental | Open in IMG/M |
| 3300018034 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_10 | Environmental | Open in IMG/M |
| 3300018062 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018086 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MG | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300019787 | Permafrost microbial communities from Stordalen Mire, Sweden - 812S3M metaG (PacBio error correction) | Environmental | Open in IMG/M |
| 3300019877 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2m1 | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
| 3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
| 3300021344 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2a2 | Environmental | Open in IMG/M |
| 3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
| 3300021403 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O | Environmental | Open in IMG/M |
| 3300021404 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O | Environmental | Open in IMG/M |
| 3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
| 3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
| 3300021411 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H3c2 | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021475 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-O | Environmental | Open in IMG/M |
| 3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
| 3300022721 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-4-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022732 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic ? CZU1 | Host-Associated | Open in IMG/M |
| 3300024271 | Soil microbial communities from Bohemian Forest, Czech Republic ? CSU5 | Environmental | Open in IMG/M |
| 3300024331 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK09 | Environmental | Open in IMG/M |
| 3300025878 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostAB12-D (SPAdes) | Environmental | Open in IMG/M |
| 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 (SPAdes) | Environmental | Open in IMG/M |
| 3300026354 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NR-04-B | Environmental | Open in IMG/M |
| 3300026499 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NR-06-B | Environmental | Open in IMG/M |
| 3300026529 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 (SPAdes) | Environmental | Open in IMG/M |
| 3300026921 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 28 (SPAdes) | Environmental | Open in IMG/M |
| 3300027297 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF047 (SPAdes) | Environmental | Open in IMG/M |
| 3300027394 | Thawing permafrost microbial communities from the Arctic, studying carbon transformations - Permafrost 712P3D | Environmental | Open in IMG/M |
| 3300027516 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 34 (SPAdes) | Environmental | Open in IMG/M |
| 3300027634 | Thawing permafrost microbial communities from the Arctic, studying carbon transformations - Permafrost 812S1M | Environmental | Open in IMG/M |
| 3300027641 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_8_FC metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027648 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027651 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027660 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027698 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027729 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027768 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027842 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027853 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027869 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027879 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 (SPAdes) | Environmental | Open in IMG/M |
| 3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027884 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027889 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes) | Environmental | Open in IMG/M |
| 3300027894 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300027908 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027911 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300028566 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_E3_2 | Environmental | Open in IMG/M |
| 3300028798 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E2_2 | Environmental | Open in IMG/M |
| 3300028867 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_E3_3 | Environmental | Open in IMG/M |
| 3300029889 | Peat microbial communities from Marcell Experimental Forest bog in Minnesota, USA - MG_T3F_30cm | Environmental | Open in IMG/M |
| 3300029913 | III_Bog_N3 coassembly | Environmental | Open in IMG/M |
| 3300029943 | I_Palsa_N3 coassembly | Environmental | Open in IMG/M |
| 3300030007 | I_Palsa_E1 coassembly | Environmental | Open in IMG/M |
| 3300030020 | II_Bog_N1 coassembly | Environmental | Open in IMG/M |
| 3300030041 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_N2_1 | Environmental | Open in IMG/M |
| 3300030057 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E1_1 | Environmental | Open in IMG/M |
| 3300030399 | II_Palsa_E2 coassembly | Environmental | Open in IMG/M |
| 3300030494 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG (v2) | Environmental | Open in IMG/M |
| 3300030503 | III_Palsa_E3 coassembly | Environmental | Open in IMG/M |
| 3300030506 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_N1_1 | Environmental | Open in IMG/M |
| 3300030508 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_E1_2 | Environmental | Open in IMG/M |
| 3300030518 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_N2_2 | Environmental | Open in IMG/M |
| 3300030520 | III_Palsa_N2 coassembly | Environmental | Open in IMG/M |
| 3300030707 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG (v2) | Environmental | Open in IMG/M |
| 3300030737 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N1_2 | Environmental | Open in IMG/M |
| 3300031446 | Fir Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031474 | Fir Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031524 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Bog_T0_3 | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031770 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17 | Environmental | Open in IMG/M |
| 3300031771 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19 | Environmental | Open in IMG/M |
| 3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
| 3300031833 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178 | Environmental | Open in IMG/M |
| 3300031837 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N3_1 | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
| 3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
| 3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
| 3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
| 3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
| 3300033755 | Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB26FY SIP fraction | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGIcombinedJ26739_1017434522 | 3300002245 | Forest Soil | DLTLSPLAPGQSKPFRLTFENISAQWNHAYPELQITQVNTR* |
| JGI26345J50200_10298631 | 3300003352 | Bog Forest Soil | TTGPYPEAVDFSVSPLGRGQSKTFRLTFESISAQWNRQYPEIQVTDVAVN* |
| Ga0062389_1006174444 | 3300004092 | Bog Forest Soil | EEIPLQVLKTDGPYPEAVDFRVAPLGPGQSKAFRLTFEGISAQWNHQFPEIQVTDVTVK* |
| Ga0058882_17479971 | 3300004121 | Forest Soil | GPYPEAVDFSVSPLAPGQSKPFRLTFESISAQWNHQYPNIQITDVAVK* |
| Ga0066676_103010731 | 3300005186 | Soil | LNVSPLAPGQSKPFRLTFESISAQWNHEYPELQITDVTVK* |
| Ga0070708_1000047621 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | VDLNVSPLAPGQSKPFRLTFESISAQWNHEYPELQITDVTVK* |
| Ga0070699_1018972831 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | VDLNLSPLAPGESKPFRLTFESISAQWNHAYPEMQITQVTVR* |
| Ga0070732_107700051 | 3300005542 | Surface Soil | PLRVLQTSGPYPEAVDLTVSPLGAGQSKPFRLTFEGISAQWNHEYPELKVTDVTVK* |
| Ga0066695_105293821 | 3300005553 | Soil | LSPLAPGETKPFRLTFESISAQWNHAYPDMRISDVRTR* |
| Ga0066702_102650211 | 3300005575 | Soil | NVSPLGPGQTQPFRLTFDSISAQWNHEYPEIRVTDVALK* |
| Ga0070762_109754082 | 3300005602 | Soil | LAPGQSEPFRLTFENISAQWNHAYPDLQITQVTVK* |
| Ga0068860_1011746952 | 3300005843 | Switchgrass Rhizosphere | LAPGQTKPFRLTFESLSAQWNHQYPDMRVTDVVVR* |
| Ga0075285_10030453 | 3300005890 | Rice Paddy Soil | ASPLAPGQSASFRLTFDSISSQWNHQYPAITITDVVTK* |
| Ga0075417_103110912 | 3300006049 | Populus Rhizosphere | NVPLHVLQTGGPYPDAVDLSTSPLGAGQSKPCRLTFESISAQWNHAYPELQVTDVTVK* |
| Ga0075017_1000448331 | 3300006059 | Watersheds | LNVAPLSPGQTQPFRLTLDSISTQWNRQYPEIRVTDLSVK* |
| Ga0075017_1003361883 | 3300006059 | Watersheds | LRSAPLGPGQSRTFRLTFESISAQWNRQYPEIKISDVSVK* |
| Ga0075030_1014078122 | 3300006162 | Watersheds | RTGGPYDEAVDLNLSPLAPGQSRPFRLTFENISAQWNHAYPDLQITQITVK* |
| Ga0079220_106673672 | 3300006806 | Agricultural Soil | NVVPLIPGKSEPFRLTFDSISAQWNHQYPDIHITDVTVK* |
| Ga0099792_110384701 | 3300009143 | Vadose Zone Soil | LPPGQSQPFLLTFEGISTQWNHQYPEIAIADVVAK* |
| Ga0105241_119441822 | 3300009174 | Corn Rhizosphere | LAPGKSEYFRLTFDSISAQWNHQYPDITITDVTVK* |
| Ga0116128_10353901 | 3300009518 | Peatland | LAPGQSKPFRLTFENISAQWNHVYPDLQITQVSTK* |
| Ga0116108_11391372 | 3300009519 | Peatland | REELPLQILKISGPYPEAVPFSTSPLEPGQNKLFRLTFESISAQWNHSYPDIQITDLSLK |
| Ga0116111_11402601 | 3300009616 | Peatland | IRVLRTGGPYDEAVDLNLSPLPPGQSKPFRLTFENISAQWNHAYPDLQITQVTVK* |
| Ga0116125_10295061 | 3300009628 | Peatland | GPGESKPFRLTFENISAQWNHAYPDLQVTQVTVK* |
| Ga0116129_10677712 | 3300009633 | Peatland | AVDFSLAPLGPGQSATFRLTFEGISAQWNHQVPEIQITDVSVK* |
| Ga0116110_11813712 | 3300009643 | Peatland | YDEAVDLNLSPLAPGQSKPFRLTFENISAQWNHAYPDLQITQITVK* |
| Ga0116132_10025811 | 3300009646 | Peatland | YDEAVDLNLSPLAPGQSKPFRLTFENISAQWNHAYPDLQITQVAVK* |
| Ga0116132_10227531 | 3300009646 | Peatland | PPGQSKPFRLTFENISAQWNHAYPDLQITQVTVK* |
| Ga0116101_10788092 | 3300009759 | Peatland | GPGQSKPFRLTFESISAQWNHQYPEIQVTDVATK* |
| Ga0116134_13346951 | 3300009764 | Peatland | SLSPLAPGQSKPFRLTFENISAQWNHAYPDLQITQVTVK* |
| Ga0126380_104751312 | 3300010043 | Tropical Forest Soil | SPLVPGQSKPFRLTFESISSQWNHEYPELKVTDVAVK* |
| Ga0126373_103668662 | 3300010048 | Tropical Forest Soil | VLQTSGPYPDAVDLTVSPLAAGQSKPFRLTFEGISAQWNHEYPELKVVDVTVK* |
| Ga0126373_105697012 | 3300010048 | Tropical Forest Soil | VDLNVAPLGPGQSAPFRLTFDRISEQWNRQYPQLRITDVTTK* |
| Ga0099796_100603801 | 3300010159 | Vadose Zone Soil | TGGPYDEAVDLTLSPLAPGQSKPFRLTFESISAQWNHAYPDMQITDVRTR* |
| Ga0074046_101214113 | 3300010339 | Bog Forest Soil | DLNLSPLAPGQSKPFRLTFENISAQWNHAYPDLQITQVSVR* |
| Ga0074046_107364121 | 3300010339 | Bog Forest Soil | EAVDLSLSPLAPGQSKPFRLTFENISAQWNHAYPDLQITQVTVK* |
| Ga0126370_116178531 | 3300010358 | Tropical Forest Soil | LRVLSSSGPYPEAVDLNALPLPPGQNKPFRLTFESISAQWNHEYPELKVVDVTVK* |
| Ga0126370_119272792 | 3300010358 | Tropical Forest Soil | REELPLRVLRTGGPYDEAVDFSMSPLTPGQTKPFRLTFENISVQWNHAYPDMQVTQIVVK |
| Ga0126378_103693551 | 3300010361 | Tropical Forest Soil | LTVSPLAPRQNKPFRLTFEGISAQWNHEYPELKVMDVTAK* |
| Ga0126381_1016811693 | 3300010376 | Tropical Forest Soil | VSPLAAGQTKPFRLTFESISAQWNHSYPDLNITDVRLR* |
| Ga0126381_1036937281 | 3300010376 | Tropical Forest Soil | YPEAVDLSMSPLGPGQSKPFRLTFESISEQWSHEYPDLKIVDVAVK* |
| Ga0136449_1017542902 | 3300010379 | Peatlands Soil | LSVSPLAPGQTQPFRLTFDSISAQWNRNYPEMRVTDVTVK* |
| Ga0136449_1029550081 | 3300010379 | Peatlands Soil | AVDLNLSPLAPGQSKPFRLTFENISAQWNHAYPDLQITQVSVK* |
| Ga0126383_108121502 | 3300010398 | Tropical Forest Soil | LKTSGPYPEAVDLSMSPLGPGQSKPFRLTFESISEQWSHEYPGLKIVDVTAK* |
| Ga0126350_105006451 | 3300010880 | Boreal Forest Soil | PLAPGQSQTFRLTFEAISAQWNHQYPDIEVTDVAVK* |
| Ga0138550_1013521 | 3300011055 | Peatlands Soil | LSASPLGPGQTQPFRLTFEGISAQWNRQYPDIRVTDVTAK* |
| Ga0150983_147944002 | 3300011120 | Forest Soil | SPLAPGQSAPFRLTFDHISNDWDRAYPDLKVTDVSVK* |
| Ga0137391_107039592 | 3300011270 | Vadose Zone Soil | SPLAPGQGKPFRLTFENISAQWNHTYPDLQITQVTAK* |
| Ga0137393_112394421 | 3300011271 | Vadose Zone Soil | PLAPGQSKPFRLTFEGISAQWNHKYPEIQVMDVAAK* |
| Ga0137381_114484293 | 3300012207 | Vadose Zone Soil | EAVDLSIAPLASGQSKPFRLTFESISTQWNHEYPGIKVTDVTVK* |
| Ga0137376_114236021 | 3300012208 | Vadose Zone Soil | VPLHVLQTSGPYPDAVDVSVSPLGSGRSEPFRLTFESISSQWNHEYPELKVADVTVK* |
| Ga0137361_112369951 | 3300012362 | Vadose Zone Soil | DLSISPLPPGQSQPFLLTFEGISTQWNHQYPEIQIADVVVK* |
| Ga0137361_112653371 | 3300012362 | Vadose Zone Soil | SGPYPDAVDVSVSPLGSGQSKPFRLTFESISSQWNHEYPKLKVADVTVK* |
| Ga0137398_105966012 | 3300012683 | Vadose Zone Soil | LRTGGPYDEAVDLNVSPLASGQSKQFRLTFENISAQWNHAYPDLQITQVTLK* |
| Ga0137413_110544962 | 3300012924 | Vadose Zone Soil | SASALGPNQSKPFRLTFEGISAQWNHQYPEIQVTDVAVK* |
| Ga0137407_120991071 | 3300012930 | Vadose Zone Soil | LAPGQSKPFRLTFESISAQWNHAYPEMQITDVRTR* |
| Ga0164299_102128242 | 3300012958 | Soil | YPEAVDLNLSPLAPGQSKPFRLTVEGISAQWNHEYPGIKVTDVTVK* |
| Ga0164305_112639342 | 3300012989 | Soil | PLAPGQSKPFRLTVEGISAQWNHEYPGIKVTDVTVK* |
| Ga0181538_102241902 | 3300014162 | Bog | AVDLNLSPLAPGESKPFRLTFENISAQWNHAYPDLQITQVTIK* |
| Ga0181528_100318503 | 3300014167 | Bog | SPLAPGESKPFRLTFENISAQWNHAYPELQITQAATR* |
| Ga0182018_104889952 | 3300014489 | Palsa | AVDFGVSPLGPGQSTTFRLTFESISAQWNHQYPDIQVTDVTAK* |
| Ga0182019_100316204 | 3300014498 | Fen | VDLSLSPLAPGQSKPFRLTFENISSQWNRAYPDLQITQVTVK* |
| Ga0181525_104870081 | 3300014654 | Bog | EAVDFGVSPLGPGQSKTFRLTFEGISAQWNRQYPDIQVTDVVLK* |
| Ga0181519_102983132 | 3300014658 | Bog | SPLAPGQSATFRLTFEGISAQWNHQFPDIQVTDVTVK* |
| Ga0167661_10336732 | 3300015167 | Glacier Forefield Soil | PLAPGQSESFRLTFENISAQWNHAYPDLQITQVNLK* |
| Ga0132256_1010192621 | 3300015372 | Arabidopsis Rhizosphere | VSASPLAPVQSKTFRLTFESISSQWNHEYPELKVIDVAVK* |
| Ga0132257_1015190701 | 3300015373 | Arabidopsis Rhizosphere | ESVPLRVLQTQGPYPDALDLGVSPLTAGQAKTFRLTFEGISAQWNHEYPELKVIDVTAK* |
| Ga0182032_101088343 | 3300016357 | Soil | VLDTSGPYADAVDLSAAPLGPGQSKLFRLTFETISQQWNHEYPELTVTDVKVK |
| Ga0182040_114252991 | 3300016387 | Soil | DTVDLSLSPIPPGQSKPFRLIFEHLSEQWSHAYPGLAISEVQVK |
| Ga0182037_110436291 | 3300016404 | Soil | DLNVAPLTPGQSAPFRLTFDSISQQWNRQYPQIRVTDVTVR |
| Ga0187825_103026742 | 3300017930 | Freshwater Sediment | YPEAVDFSVSPLAPGQSQPFRLTFESISAQWNRQYPEIQITNVTLK |
| Ga0187819_100590781 | 3300017943 | Freshwater Sediment | LNLSPLAPGQSKPFRLTFENISAQWNHAYPDLQITQVTLK |
| Ga0187819_102386381 | 3300017943 | Freshwater Sediment | MSPLEPGQSKPFRLIFESISAQWNHAYPDMQITQVNTK |
| Ga0187817_107606641 | 3300017955 | Freshwater Sediment | DEAVDLNLSPLAPGQSKPFRLTFENISAQWNHAYPDLQITQVTVK |
| Ga0187783_104232443 | 3300017970 | Tropical Peatland | DLNMSPLAPGQSKPFRLTFENISAQWNHAYPDLKLTQVVVK |
| Ga0187781_104078631 | 3300017972 | Tropical Peatland | VSPLGPGQSKLFRLTFESISAQWNHQVPEILVTDVVVK |
| Ga0187804_103738472 | 3300018006 | Freshwater Sediment | LAPGQSKPFRLTFENISAQWNHAYPDLQITQVTLK |
| Ga0187884_103340721 | 3300018009 | Peatland | EALDFSVSPLGPSQSKTFRLTFESISAQWNHQYPEIQVTDVVLK |
| Ga0187810_103869292 | 3300018012 | Freshwater Sediment | DLNLSPLAPGQSKPFRLTFENISAQWNHAYPDLQITQVTVK |
| Ga0187864_103699432 | 3300018022 | Peatland | EAVPFSTSPLEPGQNKLFRLTFESISAQWNHSYPDIQITDLSLK |
| Ga0187863_104034431 | 3300018034 | Peatland | PLAPGESKPFRLIFENISAQWNHAYPDLQINEVTVR |
| Ga0187784_114971332 | 3300018062 | Tropical Peatland | PLAPSQARPFRLTFDHISAQWNRQYPEMRVTDVTVK |
| Ga0187769_100116607 | 3300018086 | Tropical Peatland | PLQVLKTTGPYPEAVDFSLSPLAPGQSKPFRLTFVSISAQWNRQVPEIQITDVTVK |
| Ga0066667_120070201 | 3300018433 | Grasslands Soil | PLVPGKSEYFRLTFDSISAQWNHQYPDITITDVTVK |
| Ga0182031_15077031 | 3300019787 | Bog | VDLNLSPLAPGQSKPFRLTFENISAQWNHAYPDLQITEVSVK |
| Ga0193722_10701501 | 3300019877 | Soil | LRVLQTSGPYPDAVDLSVSPLASGQSKPFRLTFEGISTQWNHEYPELKVTDVTAK |
| Ga0210407_100103838 | 3300020579 | Soil | IRVLRTGGPYDEAVDLTLSPLAPGQSKPFRLTFENISAQWNHAYPDLQITQVITK |
| Ga0210403_100430581 | 3300020580 | Soil | VLRTGGPYDEAVDLTLSPLAPGQSKPFRLTFENISAQWNHAYPDLQITQVITK |
| Ga0210395_101269552 | 3300020582 | Soil | NGPYPDAVDLTVSPLAAGQSKPFRLTFESISTQWNHEYPELKVVDVTVK |
| Ga0210401_102652244 | 3300020583 | Soil | DGPYPEAVDFSVSPLGPGQSKTFRLTFESISAQWNHQFPDIQVVDLTVK |
| Ga0210405_109624312 | 3300021171 | Soil | TLSPLAPGQSKPFRLTFENISAQWNHAYPDLQITQVITK |
| Ga0210405_112689252 | 3300021171 | Soil | LSVSPLATGQAQPFRLTFDSISAQWNRNYPEIRVTDVTVK |
| Ga0210388_103645641 | 3300021181 | Soil | LNLSPLMPGESKPFRLTFENISAQWNHTYPELVITQVSVK |
| Ga0210388_109382541 | 3300021181 | Soil | EAVDLNMSPLLPGQTKPFRLTFEDISAQWNHAYPDMQVTQVVAK |
| Ga0193719_101902652 | 3300021344 | Soil | PLASGQSKPFRLTFEGISTQWNHEYPELKVTDVTAK |
| Ga0210393_104265901 | 3300021401 | Soil | VDLGFSALGPGQTQPFRLTFDSISAQWNHEYPEMRVTDVSVK |
| Ga0210393_108203041 | 3300021401 | Soil | VAPLGPGQSQPFRLTFDHISAQWSHQYPEIKVTDVAVK |
| Ga0210397_113116591 | 3300021403 | Soil | GFSALGPGQTQPFRLTFDSISAQWNHEYPEMRVTDVSVK |
| Ga0210389_113915861 | 3300021404 | Soil | EAVDFSVSPLPPAQSKAFRLTFEGISAQWNHQYPAIQVTDVAVK |
| Ga0210387_112814192 | 3300021405 | Soil | PLMPGESKPFRLTFENISAQWNHTYPELVITQVSVK |
| Ga0210383_113075841 | 3300021407 | Soil | NLSPLMPGQSKPFRLTFENISAQWNHAYPELAITQVSVK |
| Ga0193709_10639872 | 3300021411 | Soil | DLTLSPLAPGQIKPFRLTFENISAQWNHAYPDLQITQVITQ |
| Ga0210394_104005651 | 3300021420 | Soil | LASSPLLPGQTEHFRLTFDSISAQWNRQYPEMRVTDVVAK |
| Ga0210394_114577332 | 3300021420 | Soil | LSPLAPGQSKPFRLIFDNISAQWNRAYPDLQITQVSVK |
| Ga0210392_104947671 | 3300021475 | Soil | SGPYPDAVDLSVAPLAPGQSKPFRLTFETISQQWNHEYPELIVSDVKLK |
| Ga0210410_102967333 | 3300021479 | Soil | PLAPGQSQTFRLTFEGISAQWNHQYPDIEVTDVAVK |
| Ga0210410_112339631 | 3300021479 | Soil | DEAVDLTLSPLAPGQSKPFRLTFENISAQWNHAYPDLQITQVGTR |
| Ga0242666_11224062 | 3300022721 | Soil | SPLAPGQTQPFRLTFDRISAQWNRQYPDMRVTDVVVK |
| Ga0224569_1027153 | 3300022732 | Rhizosphere | SVSPLGPGQSQTFRLTFEGISTQWNHQYPDIQVTDVAVK |
| Ga0224564_10216403 | 3300024271 | Soil | YPEAVDFSVSPLASGQSNTFRLTFESISAQWNHQYPEIQVTDVAVK |
| Ga0224564_10240432 | 3300024271 | Soil | YPEAVDFSISPLGPGQSKPFRLTFENISAQWNRQYPEIQITDVAVK |
| Ga0247668_10960692 | 3300024331 | Soil | VDLNVVPLAPGQSVPFRLTFDSISAQWNHQYPDIRITDVAVK |
| Ga0209584_104170561 | 3300025878 | Arctic Peat Soil | DLNLSPLAPGQSKPFRLTFENISAQWNHAYPDLEITQVTLK |
| Ga0207682_101940632 | 3300025893 | Miscanthus Rhizosphere | FNLSPLAPGQTKPFRLTFESLSTQWNHQYPDIQVTDVVTR |
| Ga0207664_107057202 | 3300025929 | Agricultural Soil | PLAPGKSEYFRLTFDSISAQWNHQYPDITITDVTVK |
| Ga0209804_12226052 | 3300026335 | Soil | PLAPGESKPFRLTFENISAQWNHAYPDLQITQVSVK |
| Ga0257180_10386591 | 3300026354 | Soil | AVDLNLSPLAPGQGKPFRLTFENISAQWNHTYPDLQITQIAVK |
| Ga0257181_10399692 | 3300026499 | Soil | AVDLSISPLPPGQSQPFLLTFEGISAQWNHQYPEIEIADVVVK |
| Ga0209806_12734471 | 3300026529 | Soil | NVSPLGPGQTQPFRLTFDSISAQWNHEYPEIRVTDVALK |
| Ga0207860_10226102 | 3300026921 | Tropical Forest Soil | IRVLRTGGPYDEAVDLAMSPLAPGQSKPFRLTLENISAQWSHTYPDMKVTDVRTR |
| Ga0208241_10373342 | 3300027297 | Forest Soil | IPMQVLKTTGPYPEAVDFSVSPLGPGESKTFRLTFESISAQWNRQYPNIQVTDVVLK |
| Ga0209904_10018952 | 3300027394 | Thawing Permafrost | DLNLSPLAPGQSKPFRLTFENISAQWNHAYPDLQITQVSVK |
| Ga0207761_10049034 | 3300027516 | Tropical Forest Soil | EELPIRVLRTGGPYDEAVDLAMSPLAPGQSKPFRLTLENISAQWSHTYPDMKVTDVRTR |
| Ga0209905_10296231 | 3300027634 | Thawing Permafrost | GGPYDEAVDLSLSPLAPGQSEPFRLTFENISAQWNHAYPDLQITQVTVK |
| Ga0208827_11986992 | 3300027641 | Peatlands Soil | VDLNLSPLAPGQSKPFRLTFENISAQWNHAYPDLQITQVTVK |
| Ga0209420_10194101 | 3300027648 | Forest Soil | LKTSGPYPEAVDFSVSPLGPGQSTTFRLTFEGISAQWNHAYPDIQVTDVTVK |
| Ga0209217_11084741 | 3300027651 | Forest Soil | DLTLSPLAPGQSKPFRLTFENISAQWNHAYPELQITQVNTR |
| Ga0209736_10632531 | 3300027660 | Forest Soil | SVSPLAPRQAEHFRLTFDSISAQWNRQYPEMRVTDVSVK |
| Ga0209446_11065262 | 3300027698 | Bog Forest Soil | NLSPLAPGQSKPFRLTFENISAQWNHAYPDLQITQVSVK |
| Ga0209248_101016452 | 3300027729 | Bog Forest Soil | YPEAVDFSASPLGPGQRKTFRLTFEGISAQWNRQYPDIQITDVTTK |
| Ga0209772_102459722 | 3300027768 | Bog Forest Soil | REELPIRVLRTGGPYDEAVDLNLSPLVPGQSQPFRLTLENISAQWNHTYPDLQITQINTK |
| Ga0209580_100596391 | 3300027842 | Surface Soil | LAPGQSQAFRLTFESISAQWNHQYPEIQITDVVVK |
| Ga0209580_104819652 | 3300027842 | Surface Soil | DLNVAPLAPAQTMPFRLTFDRISDQWNHQYPEITITDVTMK |
| Ga0209274_105391352 | 3300027853 | Soil | FSLAPLGPGQSATFRLTFEGISAQWNHQVPEIQITDVSVK |
| Ga0209579_100301284 | 3300027869 | Surface Soil | LAAGQSKPFRLTFESISTQWNHEYPELKVVDVAVK |
| Ga0209169_101637342 | 3300027879 | Soil | PEAVDFGVSPLGPGQSTTFRLTFESISAQWNHQYPDIQVTDVTAK |
| Ga0209590_105030871 | 3300027882 | Vadose Zone Soil | VDLSVSPLVPGQSQPFRLTFESISAQWNRQYPEIKVIDVTVK |
| Ga0209275_109139142 | 3300027884 | Soil | LGPGQSEPFRLTFDSISAQWSHQYPDLKITDVTVK |
| Ga0209380_100125721 | 3300027889 | Soil | SPLGPGESKTFRLTFESISAQWNRQYPDIQVTDVVLK |
| Ga0209068_107261291 | 3300027894 | Watersheds | DLSVSPLAPGQSKPFRLTFESISAQWNHEYPEIKVTDVTAK |
| Ga0209006_103544573 | 3300027908 | Forest Soil | VPIHVLRTGGAYDEAVDISQSPLAPGQSEPFRLTFENISAQWNHAYPDLQITQVNLR |
| Ga0209698_109935492 | 3300027911 | Watersheds | NNGAYTEPVDLSVAPLGPGQAQTFRLTFERISAQWNHAYPDIRVTDVVVK |
| Ga0268264_101931923 | 3300028381 | Switchgrass Rhizosphere | PLAPGQTKPFRLTFESLSTQWNHQYPDIQVTDVVTR |
| Ga0137415_114908701 | 3300028536 | Vadose Zone Soil | PYDEAVDLNLSPLAPGQGKPFRLTFENISAQWNHTYPDLQITQIAVK |
| Ga0302147_101031722 | 3300028566 | Bog | SASPLAPGESKPFRLTFENISAQWNHAYPELQITQVSTK |
| Ga0302222_101933691 | 3300028798 | Palsa | AVDISVSPLAPGQSLPFRLTFESISAQWNHQYPDIQITEVALK |
| Ga0302146_104175412 | 3300028867 | Bog | IPMQVLKTDGPYPEAVDFSVSTLGPGQSKPFRLTFEGISAQWNRQYPEIQISDVAVR |
| Ga0246001_10112444 | 3300029889 | Peat | GAVDLNLSPLAPGQSKPFRLTFENISAQWNHAYPDLQVTQVTVK |
| Ga0311362_100937245 | 3300029913 | Bog | AQREDIPMQVLKTDGPYPEAVDFSVSPLAPAQSKTFRLTFEGISAQWNHSYPDIQITDVALQ |
| Ga0311340_100535241 | 3300029943 | Palsa | KTTGPYPEAVDFGVSPLGPGQSTTFRLTFESISAQWNHQYPDIQVTDVTAK |
| Ga0311340_110776911 | 3300029943 | Palsa | DEAVDFNLSPLAPGQSKPFRLIFENISAQWNHAYPDLRITQVSVK |
| Ga0311338_109649501 | 3300030007 | Palsa | PEAVDFSVSPLGPGQGKPFRLTFEGISAQWNRQYPDIQITDVMVK |
| Ga0311338_120230902 | 3300030007 | Palsa | AVDFGVSPLGPGQSTTFRLTFESISAQWNHQYPDIQVTDVTAK |
| Ga0311344_102063492 | 3300030020 | Bog | VLRTGGPYDEAVDLTVSPLAPGESKPFRLTFENISAQWNHAYPELQITQAATR |
| Ga0302274_102537181 | 3300030041 | Bog | DFSVSTLGPGQSKPFRLTFEGISAQWNRQYPEIQISDVAVR |
| Ga0302176_104824122 | 3300030057 | Palsa | NLSPLAPGQSKPFRLIFENISAQWNHAYPDLRITQVSVK |
| Ga0311353_101025431 | 3300030399 | Palsa | YPDAVDISVSPLAPGQSLPFRLTFESISAQWNHQYPDIQITEVALK |
| Ga0310037_104811441 | 3300030494 | Peatlands Soil | VDLNLSPLAPGQSKPFRLTFENISAQWNHAYPDLQITQVSVK |
| Ga0311370_122371351 | 3300030503 | Palsa | VDLSAAPLAPGQSANYRLAFDSISAQWNRQYPDITVTDVAVK |
| Ga0302194_103063802 | 3300030506 | Bog | TLGPGQSKPFRLTFEGISAQWNRQYPEIQISDVAVR |
| Ga0302185_103384461 | 3300030508 | Bog | SSSPLAPGESKPFRLTFENISAQWNHAYPELQITQVSTK |
| Ga0302275_105245142 | 3300030518 | Bog | HVLRTGGPYDEAVDLTVSPLAPGESKPFRLTFENISAQWNHAYPELQITQAATR |
| Ga0311372_127422821 | 3300030520 | Palsa | VDLVQSPLAPGQGKPFRLTFENISAQWNHAYPDIQITQLALK |
| Ga0311372_127585782 | 3300030520 | Palsa | LAPGQAQPFRLTFDSISAQWNRQYPEMRVLDVTTK |
| Ga0310038_104777102 | 3300030707 | Peatlands Soil | LSPLAPGQSKPFRLTFENISAQWNHAYPDLQITQVTVK |
| Ga0302310_102037791 | 3300030737 | Palsa | LQVLKTSGPYPEAVDFSVSPLGPGQSTTFRLTFEGISAQWNHAYPDIQVTDVAVK |
| Ga0170820_138732261 | 3300031446 | Forest Soil | SPLAPGQTQPFRLTFDSISAQWNRNYPEIRVTDVSVK |
| Ga0170818_1129144741 | 3300031474 | Forest Soil | NVAPLGPGQSEPFRLTFDSISAQWNRQYPDLKITDVTVK |
| Ga0302320_108550383 | 3300031524 | Bog | VSPLGPGQSKAFRLTFESISAQWNHQYPEINVTDVAVK |
| Ga0310686_1079051101 | 3300031708 | Soil | MQVLKTSGPYPEAVDFSVSPLGPGQSKTFRLTFESISAQWNRQYPEIQITDVTVK |
| Ga0310686_1082999241 | 3300031708 | Soil | EAVDLNLSPLAPGQSKPFRLTFENISAQWNHAYPDLQITQVSVK |
| Ga0307474_101109483 | 3300031718 | Hardwood Forest Soil | LMVSPLPPGQGKPFRLTFEHISNDWNQTYPDLQVTDVSVK |
| Ga0307469_107157332 | 3300031720 | Hardwood Forest Soil | SPLAPGQGKSFRLTFEGISAQWNHEYPQIKVTNVTVK |
| Ga0307475_102288192 | 3300031754 | Hardwood Forest Soil | KTSGPYPEAVDFSVSPLGPGQSKPFRLTFEGISAQWNRQVPEIQITDAAVK |
| Ga0318521_101235092 | 3300031770 | Soil | VLRTSGPYPEAVDLGVSSLGPGQSKPFRLTFESISEQWNHEYPDLKVKDVTVK |
| Ga0318546_104420832 | 3300031771 | Soil | VDLGVSSLGPGQSKPFRLTFESISEQWNHEYPDLKVKDVTVK |
| Ga0307478_117526252 | 3300031823 | Hardwood Forest Soil | EAVDLGISPLAPGQSKPFRLIFESISEQWNHEYPELKVLDVAVK |
| Ga0310917_100181804 | 3300031833 | Soil | PYPEAVDLGVSSLGPGQSKPFRLTFESISEQWNHEYPDLKVKDVTVK |
| Ga0302315_106070511 | 3300031837 | Palsa | DLSAAPLAPGQSANYRLAFDSISAQWNRQYPDITVTDVAVK |
| Ga0307479_101940373 | 3300031962 | Hardwood Forest Soil | LSVSPLGPGQSKSFRLTFEGISTQWNHEYPGLKVTDVAVK |
| Ga0307479_115684791 | 3300031962 | Hardwood Forest Soil | PYPDAVDLSVSPLAPGQTEHFRLTFDSISAQWNRQYPDMRVTDVTVK |
| Ga0306922_101631411 | 3300032001 | Soil | ALHVLDTSGPYADAVDLSAAPLGPGQSKLFRLTFETISQQWNHEYPELTVTDVKVK |
| Ga0307470_101491632 | 3300032174 | Hardwood Forest Soil | YPDAVDVGVSPLAPGQSKPFRLTFESISSQWNHEYPELKVADVTVK |
| Ga0307472_1008680701 | 3300032205 | Hardwood Forest Soil | LQTSGPYPDAVDLGVSPLAPGQGKPFRLTFEGISAQWNHEYPQIKVTDVTVK |
| Ga0335085_104238702 | 3300032770 | Soil | GVDLNLSPLAPGQTKTFRLTFENISAQWNHAYPDMQVLQVTTK |
| Ga0335079_101172274 | 3300032783 | Soil | LAPGQSQPYRLTFDSISAQWNHQYPDITITDVTVK |
| Ga0335078_114116931 | 3300032805 | Soil | SPLPPGQSKPFRLTFESISAQWNHAYPDLKITQLATR |
| Ga0335081_122053621 | 3300032892 | Soil | VDLNMSPLLPGQTKPFRLTFEDISAQWNHAYPDLKVMQVAVK |
| Ga0335081_126906772 | 3300032892 | Soil | NIAPLVPGQTAPFRLTFDSISQQWNRQYPQIRITDVTVK |
| Ga0310914_103815792 | 3300033289 | Soil | SAAPLGPGQSKLFRLTFETISQQWNHEYPELTVTDVKVK |
| Ga0371489_0098655_2_109 | 3300033755 | Peat Soil | LGPGQSKPFRLTFENISAQWNHAYPELRITDVTVK |
| ⦗Top⦘ |